BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022J17

Length=796
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI17197.3|  unnamed protein product                                373   5e-122   Vitis vinifera
gb|AJB84628.1|  magnesium-chelatase subunit D                           374   1e-120   Camellia sinensis [black tea]
ref|XP_010651832.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    373   2e-120   Vitis vinifera
gb|ADN33929.1|  magnesium-chelatase subunit chID                        366   3e-120   Cucumis melo subsp. melo
ref|XP_010557506.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    372   6e-120   Tarenaya hassleriana [spider flower]
ref|XP_006446210.1|  hypothetical protein CICLE_v100143612mg            367   9e-120   
ref|XP_006573815.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    367   1e-119   Glycine max [soybeans]
gb|AAL24388.1|  similar to magnesium-chelatase subunit ChlD precu...    362   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246237.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    366   4e-119   Nelumbo nucifera [Indian lotus]
gb|EPS67334.1|  hypothetical protein M569_07437                         359   4e-119   Genlisea aurea
ref|XP_010031750.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    370   5e-119   Eucalyptus grandis [rose gum]
ref|XP_011080379.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    369   7e-119   Sesamum indicum [beniseed]
ref|XP_006843428.1|  hypothetical protein AMTR_s00053p00152680          360   7e-119   
ref|XP_008227213.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    369   8e-119   Prunus mume [ume]
ref|XP_007214542.1|  hypothetical protein PRUPE_ppa001804mg             369   9e-119   Prunus persica
ref|XP_002513534.1|  Magnesium-chelatase subunit chlD, chloroplas...    369   9e-119   Ricinus communis
ref|XP_009337032.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    369   1e-118   Pyrus x bretschneideri [bai li]
ref|XP_004172067.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    364   1e-118   
gb|EYU35928.1|  hypothetical protein MIMGU_mgv1a001714mg                369   2e-118   Erythranthe guttata [common monkey flower]
emb|CAB58179.1|  Mg-protoporphyrin IX                                   356   2e-118   Hordeum vulgare [barley]
ref|XP_003538089.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    368   2e-118   Glycine max [soybeans]
ref|XP_006379057.1|  hypothetical protein POPTR_0009s05400g             368   2e-118   
ref|XP_010105401.1|  Magnesium-chelatase subunit chlD                   368   2e-118   Morus notabilis
gb|KJB21817.1|  hypothetical protein B456_004G015600                    367   4e-118   Gossypium raimondii
gb|KDP22132.1|  hypothetical protein JCGZ_25963                         367   4e-118   Jatropha curcas
gb|KHG27451.1|  Magnesium-chelatase subunit chlD, chloroplastic         367   4e-118   Gossypium arboreum [tree cotton]
ref|XP_003517516.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    367   4e-118   Glycine max [soybeans]
gb|KHN25632.1|  Magnesium-chelatase subunit chlD, chloroplastic         367   5e-118   Glycine soja [wild soybean]
ref|XP_006470704.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    367   5e-118   Citrus sinensis [apfelsine]
ref|XP_008363236.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    367   5e-118   
ref|XP_002314091.2|  Mg-chelatase subunit D family protein              368   5e-118   
ref|XP_008806573.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    363   5e-118   
ref|XP_007015160.1|  Albina 1                                           367   6e-118   
ref|XP_009802534.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    367   6e-118   Nicotiana sylvestris
ref|XP_004981316.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    366   1e-117   Setaria italica
ref|XP_009629316.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    366   1e-117   Nicotiana tomentosiformis
ref|XP_010246236.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    366   1e-117   Nelumbo nucifera [Indian lotus]
ref|XP_003610971.1|  Magnesium-chelatase subunit chlD                   366   1e-117   Medicago truncatula
ref|XP_010922222.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    365   2e-117   Elaeis guineensis
ref|XP_008644403.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    365   2e-117   Zea mays [maize]
ref|XP_008449685.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    365   2e-117   Cucumis melo [Oriental melon]
sp|O24133.1|CHLD_TOBAC  RecName: Full=Magnesium-chelatase subunit...    365   2e-117   Nicotiana tabacum [American tobacco]
ref|XP_002466225.1|  hypothetical protein SORBIDRAFT_01g003860          365   2e-117   Sorghum bicolor [broomcorn]
gb|KDO50420.1|  hypothetical protein CISIN_1g004256mg                   365   2e-117   Citrus sinensis [apfelsine]
ref|XP_011032080.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    366   3e-117   Populus euphratica
ref|XP_007158593.1|  hypothetical protein PHAVU_002G165600g             364   4e-117   Phaseolus vulgaris [French bean]
ref|XP_009413526.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    364   6e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413527.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    364   7e-117   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP08502.1|  unnamed protein product                                364   7e-117   Coffea canephora [robusta coffee]
gb|KJB21818.1|  hypothetical protein B456_004G015600                    363   1e-116   Gossypium raimondii
ref|XP_004236627.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    364   1e-116   Solanum lycopersicum
ref|XP_004140205.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    363   1e-116   
ref|XP_008806572.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    362   3e-116   Phoenix dactylifera
ref|XP_010673713.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    362   3e-116   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006350212.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    362   4e-116   Solanum tuberosum [potatoes]
ref|XP_006651947.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    359   5e-116   
gb|AAD52031.1|AF083555_1  magnesium-chelatase subunit CHLD precursor    360   8e-116   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95054.1|  BnaC05g06170D                                          361   9e-116   
ref|XP_009148107.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    361   1e-115   Brassica rapa
ref|NP_563821.2|  magnesium-chelatase subunit chlD                      360   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889699.1|  T27G7.20                                           360   2e-115   
ref|XP_010475652.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    360   3e-115   Camelina sativa [gold-of-pleasure]
ref|XP_003563940.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    359   5e-115   Brachypodium distachyon [annual false brome]
ref|XP_010458091.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    359   5e-115   Camelina sativa [gold-of-pleasure]
sp|O22437.1|CHLD_PEA  RecName: Full=Magnesium-chelatase subunit C...    359   5e-115   Pisum sativum [garden pea]
ref|XP_006417679.1|  hypothetical protein EUTSA_v10006894mg             359   6e-115   Eutrema salsugineum [saltwater cress]
ref|XP_010488958.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    359   7e-115   Camelina sativa [gold-of-pleasure]
emb|CDX93557.1|  BnaA06g04910D                                          358   7e-115   
ref|XP_006306844.1|  hypothetical protein CARUB_v10008387mg             358   8e-115   Capsella rubella
ref|XP_008359243.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    347   2e-114   
gb|KGN48112.1|  hypothetical protein Csa_6G434320                       365   3e-114   Cucumis sativus [cucumbers]
ref|XP_011459478.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    357   4e-114   Fragaria vesca subsp. vesca
gb|KFK43171.1|  hypothetical protein AALP_AA1G089000                    356   6e-114   Arabis alpina [alpine rockcress]
gb|AAP73850.1|  putative magnesium chelatase subunit chlD               355   8e-114   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051668.1|  Os03g0811100                                       355   1e-113   
gb|AAF22895.1|AC006932_12  T27G7.20                                     356   1e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ32779.1|  chloroplast Mg-chelatase subunit XANTHA-G precursor     355   2e-113   Hordeum vulgare [barley]
gb|EMT09999.1|  Magnesium-chelatase subunit chlD, chloroplastic         355   1e-112   
ref|XP_002977545.1|  hypothetical protein SELMODRAFT_176264             344   2e-109   
ref|XP_002975141.1|  hypothetical protein SELMODRAFT_174616             343   2e-109   
ref|XP_001764245.1|  predicted protein                                  343   9e-109   
ref|XP_009338554.1|  PREDICTED: LOW QUALITY PROTEIN: magnesium-ch...    318   6e-99    
ref|WP_040650351.1|  magnesium chelatase                                281   8e-91    
ref|WP_038297159.1|  magnesium chelatase, partial [                     267   6e-86    
ref|WP_007357531.1|  protoporphyrin IX magnesium-chelatase (fragm...    265   4e-85    
ref|XP_002956151.1|  magnesium chelatase subunit D chloroplast pr...    277   3e-84    Volvox carteri f. nagariensis
ref|WP_042152210.1|  magnesium chelatase                                276   4e-84    Planktothrix agardhii
ref|WP_026786559.1|  magnesium chelatase                                276   4e-84    Planktothrix rubescens
ref|WP_027255545.1|  magnesium chelatase                                276   4e-84    Planktothrix agardhii
ref|WP_026794098.1|  MULTISPECIES: magnesium chelatase                  276   5e-84    Planktothrix
ref|WP_026797831.1|  magnesium chelatase                                276   5e-84    Planktothrix
ref|WP_011614175.1|  magnesium-chelatase subunit ChlD                   275   9e-84    Trichodesmium erythraeum
ref|WP_016873557.1|  magnesium-chelatase subunit ChlD                   275   1e-83    Chlorogloeopsis fritschii
ref|WP_041041571.1|  magnesium chelatase                                276   1e-83    Tolypothrix campylonemoides
ref|WP_015148342.1|  protoporphyrin IX magnesium-chelatase              275   2e-83    Oscillatoria acuminata
ref|XP_001700902.1|  magnesium chelatase subunit D                      276   4e-83    Chlamydomonas reinhardtii
ref|WP_017716658.1|  magnesium-chelatase subunit ChlD                   274   4e-83    Oscillatoria sp. PCC 10802
ref|WP_035150399.1|  magnesium chelatase                                274   5e-83    Calothrix sp. 336/3
ref|WP_015224439.1|  protoporphyrin IX magnesium-chelatase              274   5e-83    Halothece sp. PCC 7418
ref|WP_015172429.1|  protoporphyrin IX magnesium-chelatase              273   5e-83    Geitlerinema sp. PCC 7407
gb|KIJ82576.1|  magnesium chelatase                                     274   9e-83    Scytonema tolypothrichoides VB-61278
ref|WP_015176521.1|  protoporphyrin IX magnesium-chelatase              273   9e-83    Oscillatoria nigro-viridis
ref|WP_015230419.1|  Mg-chelatase subunit ChlI                          273   9e-83    Dactylococcopsis salina
ref|WP_013192842.1|  magnesium-chelatase subunit ChlD                   273   1e-82    Trichormus azollae
gb|EGK88663.1|  LOW QUALITY PROTEIN: Magnesium chelatase                273   1e-82    Microcoleus vaginatus FGP-2
ref|WP_015160910.1|  magnesium chelatase ATPase subunit D               272   1e-82    Chamaesiphon minutus
ref|WP_014275943.1|  magnesium chelatase subunit D                      272   1e-82    Arthrospira platensis
ref|WP_035735687.1|  magnesium chelatase                                272   1e-82    Arthrospira platensis
ref|WP_017315498.1|  magnesium-chelatase subunit ChlD                   273   1e-82    Mastigocladopsis repens
ref|WP_017321794.1|  magnesium-chelatase subunit ChlD                   272   2e-82    cyanobacterium PCC 7702
ref|XP_003059510.1|  magnesium-chelatase subunit chlD chloroplast...    272   2e-82    Micromonas pusilla CCMP1545
ref|WP_035996666.1|  magnesium chelatase                                272   2e-82    [Leptolyngbya] sp. JSC-1
ref|XP_005645047.1|  magnesium chelatase subunit D                      273   3e-82    Coccomyxa subellipsoidea C-169
ref|WP_019493900.1|  magnesium-chelatase subunit ChlD                   271   4e-82    Calothrix sp. PCC 7103
ref|WP_041780025.1|  magnesium chelatase                                271   5e-82    Microcoleus sp. PCC 7113
gb|AFZ18337.1|  protoporphyrin IX magnesium-chelatase                   271   6e-82    Microcoleus sp. PCC 7113
ref|WP_006670731.1|  magnesium-chelatase subunit ChlD                   270   6e-82    Arthrospira
ref|WP_006624555.1|  magnesium-chelatase subunit ChlD                   270   6e-82    Arthrospira platensis
ref|WP_012408069.1|  magnesium-chelatase subunit ChlD                   270   8e-82    Nostoc punctiforme
ref|WP_008051164.1|  magnesium-chelatase subunit ChlD                   270   8e-82    Arthrospira sp. PCC 8005
ref|WP_037221118.1|  magnesium chelatase                                270   8e-82    
ref|WP_015165944.1|  protoporphyrin IX magnesium-chelatase              271   8e-82    Pseudanabaena sp. PCC 7367
ref|WP_017741312.1|  magnesium-chelatase subunit ChlD                   272   8e-82    
ref|WP_026721783.1|  magnesium chelatase                                271   9e-82    Fischerella sp. PCC 9431
gb|KIY99567.1|  magnesium chelatase subunit D                           258   9e-82    Monoraphidium neglectum
gb|KIE06603.1|  magnesium chelatase                                     271   9e-82    Tolypothrix bouteillei VB521301
ref|WP_006196704.1|  magnesium-chelatase subunit ChlD                   270   1e-81    Nodularia spumigena
ref|WP_026104071.1|  magnesium chelatase                                270   1e-81    Anabaena sp. PCC 7108
ref|WP_015080654.1|  magnesium chelatase ATPase subunit                 270   1e-81    Anabaena sp. 90
ref|WP_009631867.1|  magnesium chelatase ATPase subunit D               269   1e-81    Synechocystis sp. PCC 7509
ref|WP_017310168.1|  magnesium-chelatase subunit ChlD                   270   1e-81    Fischerella sp. PCC 9339
ref|WP_044450019.1|  magnesium chelatase                                270   1e-81    Mastigocladus laminosus
ref|WP_026103229.1|  magnesium chelatase                                270   1e-81    Pseudanabaena sp. PCC 6802
ref|WP_009784151.1|  magnesium-chelatase subunit ChlD                   270   2e-81    Lyngbya sp. PCC 8106
ref|WP_015137423.1|  magnesium chelatase ATPase subunit D               270   2e-81    Nostoc sp. PCC 7524
ref|WP_016860550.1|  magnesium-chelatase subunit ChlD                   270   2e-81    Fischerella muscicola
ref|WP_023065348.1|  magnesium chelatase ATPase subunit D               269   2e-81    Lyngbya aestuarii
ref|WP_015204373.1|  protoporphyrin IX magnesium-chelatase              270   2e-81    Crinalium epipsammum
ref|WP_015216626.1|  protoporphyrin IX magnesium-chelatase              269   3e-81    Anabaena cylindrica
ref|WP_006101723.1|  magnesium-chelatase subunit ChlD                   269   3e-81    Coleofasciculus chthonoplastes
ref|WP_015115743.1|  protoporphyrin IX magnesium-chelatase              269   3e-81    Nostoc sp. PCC 7107
ref|WP_028082200.1|  magnesium chelatase                                269   4e-81    Dolichospermum circinale
ref|WP_009457764.1|  MULTISPECIES: magnesium-chelatase subunit ChlD     269   4e-81    Fischerella thermalis
ref|WP_017660572.1|  magnesium-chelatase subunit ChlD                   268   5e-81    Geitlerinema sp. PCC 7105
ref|WP_026733423.1|  magnesium chelatase                                268   5e-81    Fischerella sp. PCC 9605
ref|WP_039200580.1|  magnesium chelatase                                268   6e-81    Aphanizomenon flos-aquae
ref|WP_015197436.1|  protoporphyrin IX magnesium-chelatase              268   6e-81    Calothrix parietina
ref|WP_042342578.1|  magnesium chelatase                                268   7e-81    Calothrix sp. PCC 7507
ref|WP_016864776.1|  magnesium-chelatase subunit ChlD                   268   7e-81    Fischerella muscicola
ref|WP_027404926.1|  magnesium chelatase                                268   7e-81    Aphanizomenon flos-aquae
gb|AFY36234.1|  protoporphyrin IX magnesium-chelatase                   268   7e-81    Calothrix sp. PCC 7507
ref|WP_015186804.1|  protoporphyrin IX magnesium-chelatase              268   8e-81    Gloeocapsa sp. PCC 7428
ref|WP_028089282.1|  magnesium chelatase                                268   8e-81    Dolichospermum circinale
ref|WP_011319823.1|  magnesium-chelatase subunit ChlD                   268   1e-80    Trichormus variabilis
ref|XP_002508833.1|  predicted protein                                  269   1e-80    Micromonas commoda
ref|WP_040553567.1|  magnesium chelatase                                267   1e-80    Raphidiopsis brookii
ref|WP_017297332.1|  hypothetical protein                               267   1e-80    Nodosilinea nodulosa
ref|WP_006277092.1|  magnesium-chelatase subunit ChlD                   267   2e-80    Cylindrospermopsis raciborskii
gb|EFA73344.1|  Magnesium chelatase ATPase subunit D                    267   2e-80    Raphidiopsis brookii D9
ref|WP_017651554.1|  magnesium-chelatase subunit ChlD                   267   2e-80    Fortiea contorta
ref|WP_017289571.1|  magnesium-chelatase subunit ChlD                   267   2e-80    Leptolyngbya boryana
ref|WP_010994455.1|  magnesium-chelatase subunit ChlD                   267   2e-80    Nostocaceae
ref|WP_008309117.1|  magnesium chelatase ATPase subunit D               267   2e-80    Leptolyngbya sp. PCC 6406
ref|WP_009555513.1|  Mg-chelatase subunit ChlI                          268   2e-80    Oscillatoriales cyanobacterium JSC-12
ref|WP_039739178.1|  magnesium chelatase                                267   3e-80    
ref|WP_027840190.1|  magnesium chelatase                                266   5e-80    Mastigocoleus testarum
ref|WP_015153650.1|  protoporphyrin IX magnesium-chelatase              267   6e-80    Chroococcidiopsis thermalis
ref|WP_015207701.1|  protoporphyrin IX magnesium-chelatase              265   7e-80    Cylindrospermum stagnale
emb|CCQ67554.1|  Protoporphyrin IX Mg-chelatase subunit D               256   8e-80    Crocosphaera watsonii WH 0402
ref|WP_039715972.1|  magnesium chelatase                                266   8e-80    
ref|WP_026099665.1|  magnesium chelatase                                265   1e-79    Prochlorothrix hollandica
ref|WP_008185168.1|  magnesium-chelatase subunit ChlD                   265   1e-79    Moorea producens
ref|WP_035985411.1|  magnesium chelatase                                265   2e-79    Leptolyngbya sp. KIOST-1
ref|WP_015120155.1|  protoporphyrin IX magnesium-chelatase              264   3e-79    Rivularia sp. PCC 7116
ref|WP_039727978.1|  MULTISPECIES: magnesium chelatase                  264   3e-79    Lyngbya confervoides
ref|WP_015194081.1|  protoporphyrin IX magnesium-chelatase              263   3e-79    Stanieria cyanosphaera
ref|WP_017304357.1|  magnesium-chelatase subunit ChlD                   263   4e-79    Spirulina subsalsa
ref|WP_008227854.1|  Protoporphyrin IX Mg-chelatase subunit D           263   7e-79    Richelia intracellularis
ref|WP_015142056.1|  magnesium chelatase ATPase subunit D               263   7e-79    Pleurocapsa minor
ref|WP_008232821.1|  Protoporphyrin IX Mg-chelatase subunit D           262   1e-78    Richelia intracellularis
ref|WP_038331170.1|  magnesium chelatase                                262   1e-78    
ref|XP_003079609.1|  Mg-chelatase subunit (ISS)                         263   2e-78    Ostreococcus tauri
ref|WP_015167493.1|  magnesium chelatase ATPase subunit D               261   3e-78    Synechococcus sp. PCC 7502
ref|WP_015124174.1|  protoporphyrin IX magnesium-chelatase              261   4e-78    Synechococcus sp. PCC 6312
ref|WP_015956003.1|  magnesium-chelatase subunit ChlD                   261   4e-78    Cyanothece sp. PCC 7424
ref|WP_036476619.1|  magnesium chelatase                                260   5e-78    Myxosarcina sp. GI1
ref|WP_011057253.1|  magnesium-chelatase subunit ChlD                   260   5e-78    Thermosynechococcus elongatus
ref|XP_001418124.1|  predicted protein                                  259   1e-77    Ostreococcus lucimarinus CCE9901
ref|WP_012161187.1|  magnesium-chelatase subunit ChlD                   259   1e-77    Acaryochloris marina
ref|WP_010478137.1|  magnesium-chelatase subunit ChlD                   259   2e-77    Acaryochloris sp. CCMEE 5410
gb|ACL43185.1|  magnesium chelatase ATPase subunit D                    258   2e-77    Cyanothece sp. PCC 7425
ref|WP_041236163.1|  magnesium chelatase                                258   3e-77    
ref|WP_040054553.1|  magnesium chelatase                                258   3e-77    
ref|WP_011244135.1|  MULTISPECIES: magnesium-chelatase subunit ChlD     258   3e-77    Synechococcus
ref|XP_004517295.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    259   4e-77    Cicer arietinum [garbanzo]
ref|XP_002956152.1|  hypothetical protein VOLCADRAFT_121490             259   7e-77    Volvox carteri f. nagariensis
ref|WP_019507353.1|  magnesium-chelatase subunit ChlD                   257   8e-77    Pleurocapsa sp. PCC 7319
ref|WP_012306227.1|  magnesium-chelatase subunit ChlD                   257   8e-77    Synechococcus
ref|WP_006456157.1|  magnesium-chelatase subunit ChlD                   256   2e-76    Synechococcus sp. PCC 7335
gb|EHJ10536.1|  Protoporphyrin IX Mg-chelatase subunit D                256   2e-76    Crocosphaera watsonii WH 0003
ref|WP_021829762.1|  Protoporphyrin IX Mg-chelatase subunit D           256   2e-76    
gb|EAM48772.1|  Magnesium chelatase, ChlI subunit                       256   2e-76    Crocosphaera watsonii WH 8501
emb|CCQ62029.1|  Protoporphyrin IX Mg-chelatase subunit D               256   2e-76    Crocosphaera watsonii WH 0401
ref|WP_042712310.1|  magnesium chelatase                                256   2e-76    Crocosphaera watsonii
ref|WP_015784261.1|  magnesium-chelatase subunit ChlD                   256   2e-76    Cyanothece sp. PCC 8802
ref|WP_035828596.1|  magnesium chelatase                                256   2e-76    Crocosphaera watsonii
ref|WP_013321313.1|  magnesium-chelatase subunit ChlD                   256   2e-76    Cyanothece sp. PCC 7822
ref|WP_012596729.1|  magnesium-chelatase subunit ChlD                   256   2e-76    Cyanothece sp. PCC 8801
ref|WP_023074366.1|  protoporphyrin ix magnesium-chelatase              256   3e-76    Leptolyngbya sp. Heron Island J
ref|WP_012954455.1|  magnesium-chelatase subunit ChlD                   256   3e-76    Candidatus Atelocyanobacterium thalassa
dbj|BAA20346.1|  magnesium-chelatase subunit                            255   5e-76    Synechococcus elongatus PCC 7942
ref|WP_024750240.1|  MULTISPECIES: magnesium chelatase                  255   5e-76    Cyanothece
gb|ACB50424.1|  magnesium chelatase, ATPase subunit D                   255   5e-76    Cyanothece sp. ATCC 51142
gb|AFW67236.1|  hypothetical protein ZEAMMB73_644992                    255   5e-76    
ref|WP_040940037.1|  magnesium chelatase                                254   7e-76    
ref|WP_040945156.1|  magnesium chelatase                                254   8e-76    
ref|WP_030005855.1|  magnesium chelatase                                254   8e-76    Synechococcus sp. NKBG042902
ref|WP_015222191.1|  protoporphyrin IX magnesium-chelatase              254   1e-75    
ref|WP_006517412.1|  protoporphyrin IX magnesium-chelatase              254   1e-75    Leptolyngbya sp. PCC 7375
gb|ELS01041.1|  magnesium chelatase ATPase subunit D                    254   1e-75    Xenococcus sp. PCC 7305
ref|WP_040899190.1|  magnesium chelatase                                253   3e-75    
ref|XP_011397801.1|  Magnesium-chelatase subunit ChlD, chloroplastic    251   3e-75    Auxenochlorella protothecoides
gb|AFZ55087.1|  protoporphyrin IX magnesium-chelatase                   253   4e-75    Cyanobacterium aponinum PCC 10605
emb|CAA65418.1|  magnesium chelatase                                    253   5e-75    Synechocystis sp. PCC 6803
ref|WP_041922943.1|  magnesium chelatase                                253   5e-75    
ref|WP_010871417.1|  magnesium-chelatase subunit ChlD                   252   6e-75    Synechocystis
ref|WP_008278652.1|  magnesium-chelatase subunit ChlD                   252   6e-75    Cyanothece sp. CCY0110
ref|WP_040687697.1|  magnesium chelatase                                252   6e-75    
ref|XP_007514351.1|  protoporphyrin IX magnesium chelatase subuni...    254   6e-75    Bathycoccus prasinos
gb|ELS33326.1|  protoporphyrin IX magnesium-chelatase                   252   7e-75    Pseudanabaena biceps PCC 7429
ref|WP_039782182.1|  magnesium chelatase                                251   9e-75    
ref|WP_040466875.1|  magnesium chelatase                                251   2e-74    Geminocystis herdmanii
ref|WP_006529845.1|  magnesium chelatase ATPase subunit D               249   6e-74    Gloeocapsa sp. PCC 73106
ref|WP_028947660.1|  magnesium chelatase                                249   6e-74    Synechocystis sp. PCC 6714
dbj|GAL95165.1|  protoporphyrin IX Mg-chelatase subunit D               248   2e-73    Microcystis aeruginosa NIES-44
ref|WP_002799821.1|  magnesium-chelatase subunit ChlD                   248   2e-73    Microcystis aeruginosa
ref|WP_012267152.1|  magnesium-chelatase subunit ChlD                   248   2e-73    Microcystis
ref|WP_002761257.1|  magnesium-chelatase subunit ChlD                   248   2e-73    Microcystis aeruginosa
ref|WP_004162637.1|  magnesium-chelatase subunit ChlD                   248   2e-73    Microcystis aeruginosa
ref|WP_002792527.1|  magnesium-chelatase subunit ChlD                   248   2e-73    Microcystis aeruginosa
ref|WP_016516746.1|  Magnesium-chelatase 38 kDa subunit                 248   2e-73    Microcystis aeruginosa
ref|WP_002744710.1|  magnesium chelatase ATPase subunit D               248   2e-73    Microcystis aeruginosa
ref|WP_008196613.1|  magnesium-chelatase subunit ChlD                   248   2e-73    Microcystis sp. T1-4
ref|WP_002753131.1|  magnesium-chelatase subunit ChlD                   248   3e-73    Microcystis aeruginosa
ref|WP_015135326.1|  protoporphyrin IX magnesium-chelatase              248   4e-73    Leptolyngbya sp. PCC 7376
emb|CAO87035.1|  unnamed protein product                                248   5e-73    Microcystis aeruginosa PCC 7806
ref|WP_004160664.1|  Magnesium-chelatase subunit ChlD                   247   6e-73    Microcystis aeruginosa
ref|WP_002776007.1|  magnesium-chelatase subunit ChlD                   246   8e-73    Microcystis aeruginosa
ref|WP_002736428.1|  magnesium chelatase ATPase subunit D               246   9e-73    Microcystis aeruginosa
ref|WP_024970736.1|  magnesium chelatase                                246   9e-73    Microcystis aeruginosa
ref|WP_002768301.1|  magnesium-chelatase subunit ChlD                   246   9e-73    Microcystis aeruginosa
gb|AFK36310.1|  unknown                                                 231   1e-72    Lotus japonicus
ref|WP_011432356.1|  magnesium-chelatase subunit ChlD                   246   1e-72    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_004161459.1|  magnesium-chelatase subunit ChlD                   246   1e-72    Microcystis aeruginosa
ref|WP_023173042.1|  magnesium chelatase                                245   3e-72    Gloeobacter kilaueensis
ref|WP_011140872.1|  magnesium-chelatase subunit ChlD                   244   4e-72    Gloeobacter violaceus
ref|WP_011429273.1|  magnesium-chelatase subunit ChlD                   244   8e-72    Synechococcus
ref|XP_005715829.1|  magnesium chelatase subunits I and D               243   2e-71    Chondrus crispus [carageen]
emb|CBJ27091.1|  Magnesium chelatase subunit D, putative chloropl...    243   3e-71    Ectocarpus siliculosus
ref|WP_015224247.1|  protoporphyrin IX magnesium-chelatase              242   4e-71    Halothece sp. PCC 7418
ref|WP_022609398.1|  magnesium chelatase ATPase subunit D               241   1e-70    Rubidibacter lacunae
ref|WP_035984823.1|  magnesium chelatase                                241   2e-70    Leptolyngbya sp. KIOST-1
ref|WP_025965314.1|  hypothetical protein                               232   3e-70    
ref|WP_025944395.1|  hypothetical protein                               228   4e-70    
ref|WP_029984379.1|  hypothetical protein                               227   4e-70    
ref|WP_025892679.1|  hypothetical protein                               230   6e-70    
ref|WP_025927318.1|  hypothetical protein                               230   8e-70    
ref|WP_006042395.1|  magnesium-chelatase subunit ChlD                   239   1e-69    Synechococcus sp. WH 7805
gb|ADI46569.1|  magnesium chelatase subunit D                           229   1e-69    Vaucheria litorea
ref|WP_025929739.1|  magnesium chelatase                                231   1e-69    
ref|WP_011618229.1|  magnesium-chelatase subunit ChlD                   238   1e-69    Synechococcus sp. CC9311
ref|WP_041428738.1|  magnesium chelatase                                239   2e-69    
ref|WP_006853735.1|  magnesium-chelatase subunit ChlD                   238   2e-69    Synechococcus sp. WH 8016
emb|CAK22684.1|  Protoporphyrin IX Mg-chelatase subunit ChlD            239   2e-69    Synechococcus sp. WH 7803
ref|WP_017327748.1|  hypothetical protein                               237   4e-69    Synechococcus sp. PCC 7336
ref|XP_005820500.1|  Mg chelatase, subunitD                             238   4e-69    Guillardia theta CCMP2712
gb|ABF61893.1|  magnesium chelatase D subunit                           236   5e-69    Arthrospira platensis
ref|XP_005537136.1|  magnesium chelatase subunits I and D               237   9e-69    Cyanidioschyzon merolae strain 10D
ref|WP_038556681.1|  magnesium chelatase                                236   1e-68    Synechococcus sp. KORDI-52
gb|AHF62617.1|  Magnesium chelatase ATPase subunit D                    236   1e-68    
gb|AII47828.1|  magnesium-chelatase subunit ChlD                        236   1e-68    
ref|WP_011363240.1|  magnesium-chelatase subunit ChlD                   236   1e-68    
ref|WP_011823133.1|  magnesium-chelatase subunit ChlD                   236   2e-68    
ref|WP_036906244.1|  magnesium chelatase                                236   2e-68    
ref|WP_038651205.1|  magnesium chelatase                                236   2e-68    
gb|KGG20309.1|  Protoporphyrin IX Mg-chelatase subunit D                236   2e-68    
ref|WP_038024611.1|  magnesium chelatase                                236   2e-68    
ref|WP_011127089.1|  magnesium-chelatase subunit ChlD                   235   2e-68    
gb|EAU72630.1|  Protoporphyrin IX Magnesium chelatase subunit ChlD      236   2e-68    
gb|KGG16640.1|  Protoporphyrin IX Mg-chelatase subunit D                235   3e-68    
gb|KGG13076.1|  Protoporphyrin IX Mg-chelatase subunit D                235   3e-68    
ref|WP_011359072.1|  magnesium-chelatase subunit ChlD                   235   3e-68    
ref|WP_011294287.1|  magnesium-chelatase subunit ChlD                   235   3e-68    
ref|WP_009788319.1|  magnesium-chelatase subunit ChlD                   235   3e-68    
ref|WP_036901348.1|  magnesium chelatase                                235   3e-68    
ref|WP_036916567.1|  MULTISPECIES: magnesium chelatase                  235   3e-68    
ref|WP_028953453.1|  magnesium chelatase                                234   4e-68    
ref|WP_007100860.1|  magnesium-chelatase subunit ChlD                   235   4e-68    
ref|XP_009032566.1|  hypothetical protein AURANDRAFT_58588              234   5e-68    
ref|WP_012194870.1|  magnesium-chelatase subunit ChlD                   234   5e-68    
ref|WP_038542858.1|  magnesium chelatase                                234   5e-68    
ref|WP_043694463.1|  magnesium chelatase                                234   8e-68    
ref|WP_042116207.1|  magnesium chelatase                                233   1e-67    
ref|WP_019478148.1|  magnesium-chelatase subunit ChlD                   233   1e-67    
ref|WP_036920198.1|  magnesium chelatase                                233   1e-67    
ref|WP_036930943.1|  magnesium chelatase                                233   2e-67    
emb|CAE18747.1|  Protoporphyrin IX Magnesium chelatase, ChlD subunit    233   2e-67    
ref|WP_026032414.1|  magnesium chelatase                                233   2e-67    
ref|WP_025943910.1|  magnesium chelatase                                230   3e-67    
ref|WP_025969634.1|  magnesium chelatase                                231   3e-67    
ref|WP_010312198.1|  magnesium-chelatase subunit ChlD                   232   3e-67    
gb|KGF96252.1|  Protoporphyrin IX Mg-chelatase subunit D                233   3e-67    
ref|WP_032527578.1|  magnesium chelatase                                233   4e-67    
ref|WP_025914139.1|  magnesium chelatase                                232   4e-67    
ref|WP_019474229.1|  magnesium-chelatase subunit ChlD                   232   5e-67    
ref|WP_010314405.1|  magnesium-chelatase subunit ChlD                   231   5e-67    
ref|WP_025979552.1|  magnesium chelatase                                232   6e-67    
ref|WP_025924145.1|  MULTISPECIES: magnesium chelatase                  232   7e-67    
ref|WP_025921448.1|  magnesium chelatase                                232   7e-67    
gb|ABM69599.1|  Protoporphyrin IX Magnesium chelatase, ChlD subunit     232   7e-67    
ref|WP_025971722.1|  magnesium chelatase                                232   7e-67    
ref|WP_025957562.1|  magnesium chelatase                                231   7e-67    
ref|WP_025906191.1|  MULTISPECIES: magnesium chelatase                  231   8e-67    
ref|WP_032515663.1|  magnesium chelatase                                231   8e-67    
ref|WP_025960254.1|  magnesium chelatase                                230   8e-67    
ref|WP_041484507.1|  magnesium chelatase                                231   9e-67    
ref|WP_011862328.1|  magnesium-chelatase subunit ChlD                   231   9e-67    
ref|WP_025922150.1|  magnesium chelatase                                231   9e-67    
ref|WP_025893972.1|  MULTISPECIES: magnesium chelatase                  231   9e-67    
ref|WP_011124474.1|  magnesium-chelatase subunit ChlD                   231   9e-67    
ref|WP_025929152.1|  magnesium chelatase                                231   9e-67    
gb|AIQ94356.1|  Protoporphyrin IX Mg-chelatase subunit D                231   9e-67    
ref|WP_025925959.1|  magnesium chelatase                                231   9e-67    
ref|WP_036891654.1|  MULTISPECIES: magnesium chelatase                  231   9e-67    
ref|WP_025937366.1|  magnesium chelatase                                231   1e-66    
ref|WP_042849785.1|  magnesium chelatase                                231   1e-66    
ref|WP_032519617.1|  magnesium chelatase                                231   1e-66    
ref|WP_025955184.1|  MULTISPECIES: magnesium chelatase                  231   1e-66    
ref|WP_025979228.1|  magnesium chelatase                                231   1e-66    
ref|WP_025922876.1|  magnesium chelatase                                231   1e-66    
gb|KGG03875.1|  Protoporphyrin IX Mg-chelatase subunit D                231   1e-66    
ref|WP_033829909.1|  magnesium chelatase                                231   1e-66    
gb|EEE39311.1|  magnesium chelatase ATPase subunit D                    231   1e-66    
ref|WP_032517409.1|  magnesium chelatase                                231   1e-66    
ref|WP_025927960.1|  magnesium chelatase                                231   1e-66    
ref|WP_025978765.1|  magnesium chelatase                                230   1e-66    
ref|WP_012007087.1|  magnesium-chelatase subunit ChlD                   231   1e-66    
ref|WP_032524043.1|  magnesium chelatase                                231   2e-66    
ref|WP_042709728.1|  magnesium chelatase                                230   2e-66    
gb|KGF94491.1|  Protoporphyrin IX Mg-chelatase subunit D                230   2e-66    
ref|WP_025957102.1|  MULTISPECIES: magnesium chelatase                  230   2e-66    
ref|WP_032522801.1|  magnesium chelatase                                230   2e-66    
ref|WP_025900308.1|  magnesium chelatase                                230   2e-66    
ref|WP_025980208.1|  magnesium chelatase                                230   2e-66    
ref|WP_025951811.1|  magnesium chelatase                                230   2e-66    
ref|WP_025880354.1|  magnesium chelatase                                230   2e-66    
ref|WP_025939889.1|  magnesium chelatase                                230   2e-66    
ref|WP_025890400.1|  MULTISPECIES: magnesium chelatase                  230   2e-66    
ref|WP_025972851.1|  magnesium chelatase                                230   2e-66    
ref|WP_025959645.1|  magnesium chelatase                                230   3e-66    
ref|WP_025920589.1|  magnesium chelatase                                230   3e-66    
ref|WP_025963528.1|  magnesium chelatase                                230   3e-66    
ref|WP_025940129.1|  magnesium chelatase                                230   3e-66    
ref|WP_025941290.1|  magnesium chelatase                                230   3e-66    
ref|WP_036924228.1|  magnesium chelatase                                230   3e-66    
ref|WP_025940420.1|  magnesium chelatase                                230   3e-66    
ref|WP_025953404.1|  magnesium chelatase                                230   3e-66    
ref|WP_023075338.1|  protoporphyrin ix magnesium-chelatase              229   3e-66    
ref|WP_025970600.1|  magnesium chelatase                                230   3e-66    
gb|ABB49351.1|  protoporphyrin IX magnesium-chelatase                   230   3e-66    
ref|WP_025975271.1|  magnesium chelatase                                230   3e-66    
ref|WP_025933088.1|  magnesium chelatase                                230   3e-66    
ref|WP_015109688.1|  magnesium chelatase ATPase subunit D               229   5e-66    
ref|WP_039727652.1|  MULTISPECIES: magnesium chelatase                  228   6e-66    
ref|WP_035832672.1|  magnesium chelatase                                229   7e-66    
gb|ABM71530.1|  Protoporphyrin IX Magnesium chelatase, ChlD subunit     229   8e-66    
gb|EJK75273.1|  hypothetical protein THAOC_03006                        222   8e-66    
ref|WP_041710546.1|  magnesium chelatase                                228   1e-65    
ref|WP_025958244.1|  magnesium chelatase                                228   1e-65    
emb|CAK27124.1|  Protoporphyrin IX Mg-chelatase subunit ChlD            226   3e-65    
ref|WP_043736429.1|  magnesium chelatase                                226   3e-65    
gb|KGF89119.1|  Protoporphyrin IX Mg-chelatase subunit D                227   4e-65    
ref|WP_032514526.1|  magnesium chelatase                                227   4e-65    
ref|XP_002288014.1|  predicted protein                                  227   5e-65    
ref|WP_011827097.1|  magnesium-chelatase subunit ChlD                   225   1e-64    
ref|WP_011131253.1|  magnesium-chelatase subunit ChlD                   225   2e-64    
gb|KGG26614.1|  Protoporphyrin IX Mg-chelatase subunit D                224   2e-64    
ref|XP_005707985.1|  magnesium chelatase subunit D                      224   3e-64    
ref|WP_036913678.1|  MULTISPECIES: magnesium chelatase                  224   3e-64    
ref|WP_006173019.1|  magnesium-chelatase subunit ChlD                   224   4e-64    
ref|WP_029979901.1|  magnesium chelatase                                210   6e-64    
ref|YP_002049144.1|  Magnesium chelatase ATPase subunit D               222   2e-63    
ref|XP_002178119.1|  predicted protein                                  221   9e-63    
ref|WP_006910211.1|  magnesium-chelatase subunit ChlD                   218   5e-62    
ref|WP_029977942.1|  magnesium chelatase                                203   2e-61    
ref|XP_002292830.1|  mg chelatase                                       215   5e-61    
ref|XP_002981296.1|  hypothetical protein SELMODRAFT_444832             215   1e-59    
ref|WP_006170999.1|  magnesium-chelatase subunit ChlD                   209   7e-59    
ref|XP_005761791.1|  hypothetical protein EMIHUDRAFT_420555             208   3e-58    
ref|WP_029977636.1|  magnesium chelatase                                182   2e-53    
gb|KDO50422.1|  hypothetical protein CISIN_1g004256mg                   191   2e-52    
ref|WP_012282387.1|  magnesium-chelatase subunit                        191   3e-52    
gb|KEH27405.1|  protoporphyrin IX magnesium chelatase subunit ChlD      189   7e-52    
ref|XP_010031751.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    189   2e-51    
gb|KCW51126.1|  hypothetical protein EUGRSUZ_J00729                     189   2e-51    
sp|Q9ZGE6.1|BCHD_HELMO  RecName: Full=Magnesium-chelatase 67 kDa ...    188   3e-51    
gb|KDO50421.1|  hypothetical protein CISIN_1g004256mg                   187   8e-51    
ref|XP_003058744.1|  predicted protein                                  183   2e-49    
ref|XP_006590475.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    182   4e-49    
ref|WP_029981768.1|  magnesium chelatase                                170   2e-48    
ref|WP_025958768.1|  hypothetical protein                               168   4e-46    
ref|XP_002503003.1|  predicted protein                                  172   3e-45    
ref|WP_032567732.1|  hypothetical protein                               157   4e-44    
ref|WP_012474475.1|  magnesium-chelatase subunit                        164   5e-43    
ref|XP_001419269.1|  predicted protein                                  164   1e-42    
ref|XP_003083272.1|  unnamed protein product                            162   3e-42    
ref|WP_011362635.1|  magnesium-chelatase subunit                        162   5e-42    
ref|WP_012505990.1|  magnesium-chelatase subunit                        161   1e-41    
ref|WP_012466420.1|  magnesium-chelatase subunit                        160   1e-41    
ref|WP_010932965.1|  magnesium-chelatase subunit                        160   2e-41    
ref|WP_011890295.1|  magnesium-chelatase subunit                        155   7e-40    
ref|WP_012508514.1|  magnesium-chelatase subunit                        155   1e-39    
ref|WP_012501978.1|  magnesium-chelatase subunit                        155   1e-39    
ref|WP_011357533.1|  magnesium-chelatase subunit                        155   1e-39    
ref|WP_011745461.1|  magnesium-chelatase subunit                        155   2e-39    
ref|WP_031460352.1|  magnesium chelatase                                154   3e-39    
ref|WP_006366346.1|  magnesium-chelatase subunit                        153   7e-39    
ref|WP_035403510.1|  magnesium chelatase                                152   2e-38    
ref|WP_028457138.1|  magnesium chelatase                                152   2e-38    
ref|WP_012256326.1|  MULTISPECIES: magnesium chelatase                  150   7e-38    
gb|AAG15217.1|AF288461_3  BchD                                          150   9e-38    
ref|WP_015941828.1|  magnesium chelatase                                149   2e-37    
ref|WP_012500609.1|  magnesium-chelatase subunit                        148   3e-37    
ref|WP_029980358.1|  magnesium chelatase                                139   4e-37    
ref|WP_011957538.1|  magnesium chelatase                                147   5e-37    
ref|WP_012121043.1|  magnesium chelatase                                147   6e-37    
gb|EFO79824.1|  magnesium chelatase ATPase subunit D                    146   2e-36    
gb|ADD60152.1|  magnesium chelatase subunit D                           136   2e-36    
ref|WP_044200768.1|  magnesium chelatase                                146   2e-36    
ref|WP_029981341.1|  magnesium chelatase                                132   3e-34    
ref|WP_041569342.1|  hypothetical protein                               135   1e-32    
gb|AEP11158.1|  magnesium chelatase ATPase subunit D                    135   1e-32    
ref|WP_011695638.1|  magnesium chelatase                                134   7e-32    
ref|WP_013718550.1|  magnesium chelatase                                132   2e-31    
ref|WP_028498600.1|  magnesium chelatase                                132   2e-31    
ref|WP_015284903.1|  magnesium chelatase ATPase subunit D               131   5e-31    
ref|WP_021832353.1|  Protoporphyrin IX Mg-chelatase subunit D           129   9e-31    
gb|AIS51716.1|  magnesium-chelatase subunit ChlD                        125   1e-30    
ref|WP_035052084.1|  magnesium chelatase                                128   7e-30    
ref|WP_013719767.1|  magnesium chelatase                                128   8e-30    
ref|WP_021832354.1|  Protoporphyrin IX Mg-chelatase subunit D           119   1e-29    
ref|WP_032122508.1|  magnesium chelatase                                127   2e-29    
ref|WP_014406288.1|  Magnesium chelatase subunit ChlD                   122   2e-29    
gb|EDZ43541.1|  magnesium chelatase ATPase subunit D                    125   4e-29    
ref|WP_040778592.1|  magnesium chelatase                                124   5e-29    
ref|WP_042686408.1|  magnesium chelatase                                125   7e-29    
ref|WP_004077464.1|  magnesium chelatase                                125   1e-28    
gb|EQC67675.1|  ChlI/ ChlD component of cobalt chelatase                119   1e-28    
ref|WP_025053878.1|  magnesium chelatase                                124   1e-28    
ref|WP_021170450.1|  magnesium-chelatase subunit ChlD                   124   1e-28    
ref|WP_027131804.1|  magnesium chelatase                                123   3e-28    
ref|WP_011033935.1|  magnesium chelatase                                124   3e-28    
ref|WP_015412256.1|  magnesium-chelatase subunit ChlI                   124   3e-28    
ref|WP_039122321.1|  magnesium chelatase                                123   3e-28    
ref|WP_005960627.1|  magnesium chelatase                                123   3e-28    
ref|WP_035919210.1|  magnesium chelatase                                123   4e-28    
ref|WP_035914860.1|  magnesium chelatase                                122   4e-28    
ref|WP_034436041.1|  hypothetical protein                               123   4e-28    
ref|WP_008603331.1|  von Willebrand factor A                            123   5e-28    
ref|WP_022026825.1|  magnesium-chelatase subunit D/I family             122   5e-28    
ref|WP_021718607.1|  aTPase family                                      122   6e-28    
ref|WP_043123502.1|  magnesium chelatase                                119   6e-28    
ref|WP_007130964.1|  von Willebrand factor type A                       122   6e-28    
gb|ERK49387.1|  hypothetical protein HMPREF0682_0839                    119   7e-28    
ref|WP_038125261.1|  von Willebrand factor A                            122   7e-28    
ref|XP_004511506.1|  PREDICTED: magnesium-chelatase subunit ChlD,...    112   7e-28    
emb|CEO88728.1|  Cobaltochelatase subunit (fragment)                    119   9e-28    
ref|WP_024048998.1|  ATPase family                                      122   9e-28    
ref|WP_004078651.1|  magnesium chelatase                                122   1e-27    
ref|WP_039688730.1|  magnesium chelatase                                118   1e-27    
ref|WP_007069252.1|  magnesium chelatase                                122   1e-27    
ref|WP_035901451.1|  magnesium chelatase                                121   2e-27    
ref|WP_040327278.1|  magnesium chelatase                                121   2e-27    
ref|WP_005957237.1|  magnesium chelatase                                121   2e-27    
ref|WP_021721195.1|  aTPase family                                      121   2e-27    
ref|WP_004694348.1|  von Willebrand factor A                            121   2e-27    
ref|WP_006520959.1|  magnesium chelatase                                121   2e-27    
ref|WP_014587157.1|  magnesium chelatase                                121   3e-27    
ref|WP_011447357.1|  magnesium chelatase                                120   3e-27    
ref|WP_024061449.1|  von Willebrand factor type A protein               120   3e-27    
ref|WP_029452558.1|  magnesium chelatase                                120   4e-27    
ref|WP_011020921.1|  magnesium chelatase                                120   5e-27    
ref|WP_020830270.1|  ChlI component of cobalt chelatase involved ...    120   5e-27    
ref|WP_011306763.1|  magnesium chelatase                                120   5e-27    
emb|CBH38029.1|  putitive magnesium-chelatase subunit                   120   6e-27    
ref|WP_005949909.1|  magnesium chelatase                                119   6e-27    
emb|CBH38494.1|  conserved hypothetical protein                         120   6e-27    
ref|WP_009145751.1|  magnesium chelatase                                119   7e-27    
ref|WP_008715107.1|  von Willebrand factor A                            119   8e-27    
ref|WP_031438691.1|  magnesium chelatase                                119   8e-27    



>emb|CBI17197.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QK RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  378  QKGRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  437

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV+IIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  438  QVAIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  497

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GR+MIVAITDGRANISLKRSTDPEAAA++DAPRPSAQELKDEILEVAGKIYKAGMSLLVI
Sbjct  498  GRVMIVAITDGRANISLKRSTDPEAAAAADAPRPSAQELKDEILEVAGKIYKAGMSLLVI  557

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA+IAQGKYYYLPNASDAVISAT
Sbjct  558  DTENKFVSTGFAKEIARIAQGKYYYLPNASDAVISAT  594



>gb|AJB84628.1| magnesium-chelatase subunit D [Camellia sinensis]
Length=758

 Score =   374 bits (959),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QK+RKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  531  QKNRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  590

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  591  QVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  650

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTDPEA A+SDAPRPS QELKDEILEVAGKIYKAGMSLLVI
Sbjct  651  GRIMIVAITDGRANISLKRSTDPEATAASDAPRPSTQELKDEILEVAGKIYKAGMSLLVI  710

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  711  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  747



>ref|XP_010651832.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Vitis 
vinifera]
Length=747

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QK RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  520  QKGRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  579

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV+IIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  580  QVAIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  639

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GR+MIVAITDGRANISLKRSTDPEAAA++DAPRPSAQELKDEILEVAGKIYKAGMSLLVI
Sbjct  640  GRVMIVAITDGRANISLKRSTDPEAAAAADAPRPSAQELKDEILEVAGKIYKAGMSLLVI  699

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA+IAQGKYYYLPNASDAVISAT
Sbjct  700  DTENKFVSTGFAKEIARIAQGKYYYLPNASDAVISAT  736



>gb|ADN33929.1| magnesium-chelatase subunit chID [Cucumis melo subsp. melo]
Length=533

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 202/217 (93%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +Q +RKVFVEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  305  VQNNRKVFVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  364

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  365  DQVSIIPFRGDCAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  424

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLK+STDPEAAA++DAP+PSAQELKDEILEVAGKIYK+GMSLLV
Sbjct  425  VGRVMIVAITDGRANISLKKSTDPEAAAAADAPKPSAQELKDEILEVAGKIYKSGMSLLV  484

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  485  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  521



>ref|XP_010557506.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010557507.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=753

 Score =   372 bits (955),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 216/216 (100%), Gaps = 0/216 (0%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            +SRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ
Sbjct  527  RSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  586

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            V+IIPFRGD+AEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVG
Sbjct  587  VAIIPFRGDAAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVG  646

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            RIMIVAITDGRANISLKRSTDPEAAA+SDAPRPS+QELKDEILEVAGKIYKAGMSLLVID
Sbjct  647  RIMIVAITDGRANISLKRSTDPEAAATSDAPRPSSQELKDEILEVAGKIYKAGMSLLVID  706

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            TENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  707  TENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  742



>ref|XP_006446210.1| hypothetical protein CICLE_v100143612mg, partial [Citrus clementina]
 gb|ESR59450.1| hypothetical protein CICLE_v100143612mg, partial [Citrus clementina]
Length=605

 Score =   367 bits (942),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 204/217 (94%), Positives = 212/217 (98%), Gaps = 1/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QK+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  379  QKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  438

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+ AVRVG+NAEKSGDV
Sbjct  439  QVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGDV  498

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTD   A +SDAPRPS+QELKDEILEVAGKIYKAGMSLLVI
Sbjct  499  GRIMIVAITDGRANISLKRSTD-PEATASDAPRPSSQELKDEILEVAGKIYKAGMSLLVI  557

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  558  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  594



>ref|XP_006573815.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
isoform X2 [Glycine max]
Length=615

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            SRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV
Sbjct  390  SRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  449

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            SIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGR
Sbjct  450  SIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGR  509

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +MIVAITDGRANISLKRSTDPE AA++DAP+PSAQELKDEILEVAGKIYKAGMSLLVIDT
Sbjct  510  VMIVAITDGRANISLKRSTDPEVAAATDAPKPSAQELKDEILEVAGKIYKAGMSLLVIDT  569

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            ENKFVSTGFAKEIA++AQGKYYYLPNASDAVIS+
Sbjct  570  ENKFVSTGFAKEIARVAQGKYYYLPNASDAVISS  603



>gb|AAL24388.1| similar to magnesium-chelatase subunit ChlD precursor [Arabidopsis 
thaliana]
 gb|AAM48012.1| magnesium-chelatase subunit ChlD-like protein [Arabidopsis thaliana]
Length=471

 Score =   362 bits (929),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 210/218 (96%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  244  ISGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  303

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  304  DQVSIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  363

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRSTD   + + DAPRP+++ELKDEILEVAGKIYKAGMSLLV
Sbjct  364  VGRIMIVAITDGRANITLKRSTD-PESIAPDAPRPTSKELKDEILEVAGKIYKAGMSLLV  422

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  423  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  460



>ref|XP_010246237.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Nelumbo nucifera]
 ref|XP_010246238.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Nelumbo nucifera]
 ref|XP_010246239.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Nelumbo nucifera]
 ref|XP_010246240.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=634

 Score =   366 bits (940),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 214/218 (98%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQK RKVFVEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLL+ESYTSR
Sbjct  407  IQKIRKVFVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLSESYTSR  466

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  467  DQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  526

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLK+STD   AA++DAP+PS+QELKDEILEVAGKIYKAGMSLLV
Sbjct  527  VGRVMIVAITDGRANISLKKSTD-PEAAATDAPKPSSQELKDEILEVAGKIYKAGMSLLV  585

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  586  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  623



>gb|EPS67334.1| hypothetical protein M569_07437, partial [Genlisea aurea]
Length=427

 Score =   359 bits (922),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 196/216 (91%), Positives = 206/216 (95%), Gaps = 2/216 (1%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            K+RKVFVEK DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ
Sbjct  203  KTRKVFVEKMDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  262

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            V IIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG
Sbjct  263  VCIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  322

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            R MIVAITDGRAN+SLKRSTD     ++D PRPS++ELKDEILEVAGKIYKAGMSLLVID
Sbjct  323  RTMIVAITDGRANVSLKRSTD--VENAADLPRPSSKELKDEILEVAGKIYKAGMSLLVID  380

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            TENKFVSTGFAKEIA++AQGKYYYLPNASD VISAT
Sbjct  381  TENKFVSTGFAKEIARVAQGKYYYLPNASDGVISAT  416



>ref|XP_010031750.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Eucalyptus grandis]
 gb|KCW51125.1| hypothetical protein EUGRSUZ_J00729 [Eucalyptus grandis]
Length=763

 Score =   370 bits (949),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 205/218 (94%), Positives = 215/218 (99%), Gaps = 0/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + KSRKV+VEK DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  535  VHKSRKVYVEKADMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  594

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  595  DQVSIIPFRGDAAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  654

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLKRSTDPEAAA++DAPRPS+QELKDEILEVAGKIYK GMSLLV
Sbjct  655  VGRVMIVAITDGRANISLKRSTDPEAAAANDAPRPSSQELKDEILEVAGKIYKTGMSLLV  714

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  715  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  752



>ref|XP_011080379.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Sesamum 
indicum]
Length=757

 Score =   369 bits (947),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 204/218 (94%), Positives = 211/218 (97%), Gaps = 2/218 (1%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  531  IQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  590

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV IIPFRGD+AEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD
Sbjct  591  DQVCIIPFRGDAAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  650

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIV +TDGRANISLKRSTD    A++D PRPSAQELKDEILEVAGKIYKAGMS+LV
Sbjct  651  VGRIMIVVLTDGRANISLKRSTD--LEATADMPRPSAQELKDEILEVAGKIYKAGMSVLV  708

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  709  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  746



>ref|XP_006843428.1| hypothetical protein AMTR_s00053p00152680 [Amborella trichopoda]
 gb|ERN05103.1| hypothetical protein AMTR_s00053p00152680 [Amborella trichopoda]
Length=460

 Score =   360 bits (924),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 196/217 (90%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
             ++++VFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAL+LLAESYTSRD
Sbjct  233  NENKRVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALQLLAESYTSRD  292

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV+IIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+TAVRVG+NAEKSGDV
Sbjct  293  QVAIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSTAVRVGLNAEKSGDV  352

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTDP+A+  S+APRPS+QELKDEIL+VAGKI+KAGMSLLVI
Sbjct  353  GRIMIVAITDGRANISLKRSTDPDASTDSEAPRPSSQELKDEILDVAGKIFKAGMSLLVI  412

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  413  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  449



>ref|XP_008227213.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Prunus 
mume]
Length=763

 Score =   369 bits (948),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  536  QSGRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  595

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSISMAR+RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  596  QVSIIPFRGDSAEVLLPPSRSISMARRRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  655

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTDPEAAA++DAPRPS QELKDEILEVAGKIYK+GMSLLVI
Sbjct  656  GRIMIVAITDGRANISLKRSTDPEAAAANDAPRPSLQELKDEILEVAGKIYKSGMSLLVI  715

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  716  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  751



>ref|XP_007214542.1| hypothetical protein PRUPE_ppa001804mg [Prunus persica]
 gb|EMJ15741.1| hypothetical protein PRUPE_ppa001804mg [Prunus persica]
Length=763

 Score =   369 bits (947),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  536  QSGRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  595

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSISMAR+RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  596  QVSIIPFRGDSAEVLLPPSRSISMARRRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  655

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTDPEAAA++DAPRPS QELKDEILEVAGKIYK+GMSLLVI
Sbjct  656  GRIMIVAITDGRANISLKRSTDPEAAAANDAPRPSLQELKDEILEVAGKIYKSGMSLLVI  715

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  716  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  751



>ref|XP_002513534.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF48937.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative 
[Ricinus communis]
Length=760

 Score =   369 bits (947),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 213/217 (98%), Gaps = 1/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAA+KLLAESYTSRD
Sbjct  535  QKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAIKLLAESYTSRD  594

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV+IIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  595  QVAIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  654

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTD    A+SDAPRPSAQELKDEILEVAGKIYKAGMSLLVI
Sbjct  655  GRIMIVAITDGRANISLKRSTD-PDVAASDAPRPSAQELKDEILEVAGKIYKAGMSLLVI  713

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  714  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  750



>ref|XP_009337032.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009337033.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009337034.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X3 [Pyrus x bretschneideri]
Length=771

 Score =   369 bits (948),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q SRKVFVE++DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  544  QSSRKVFVERSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  603

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSISMAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  604  QVSIIPFRGDSAEVLLPPSRSISMARNRLERLPCGGGSPLAHGLTTAVRVGINAEKSGDV  663

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTDPEAAA+SD P+PS+QELKDEILEVAGKIYKAGMSLLVI
Sbjct  664  GRIMIVAITDGRANISLKRSTDPEAAAASDVPKPSSQELKDEILEVAGKIYKAGMSLLVI  723

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  724  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  759



>ref|XP_004172067.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like, 
partial [Cucumis sativus]
Length=606

 Score =   364 bits (934),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 201/217 (93%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +Q +RKV+VEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  378  VQNNRKVYVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  437

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  438  DQVSIIPFRGDCAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  497

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLK+STDPEAAA++DAP+PSAQELKDEILEVAGKIYK+GMSLLV
Sbjct  498  VGRVMIVAITDGRANISLKKSTDPEAAAAADAPKPSAQELKDEILEVAGKIYKSGMSLLV  557

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  558  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  594



>gb|EYU35928.1| hypothetical protein MIMGU_mgv1a001714mg [Erythranthe guttata]
Length=769

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/218 (94%), Positives = 215/218 (99%), Gaps = 0/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + K+RKVFVEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  541  VLKTRKVFVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  600

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD
Sbjct  601  DQVSIIPFRGDAAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  660

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANISLKRS DPEAAA+SD PRP+A+E+KDEILEVAGKIYKAGMSLLV
Sbjct  661  VGRIMIVAITDGRANISLKRSNDPEAAAASDMPRPTAKEIKDEILEVAGKIYKAGMSLLV  720

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  721  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  758



>emb|CAB58179.1| Mg-protoporphyrin IX [Hordeum vulgare]
Length=375

 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/217 (91%), Positives = 212/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  148  LDKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  207

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV+IIPFRGD AEVLLPPSRSI+MARKRLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGD
Sbjct  208  DQVAIIPFRGDYAEVLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGD  267

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRAN+SLK+S DPEAAA+SDAPRPS QELKDEIL+V+ KI+KAGMSLLV
Sbjct  268  VGRIMIVAITDGRANVSLKKSNDPEAAAASDAPRPSTQELKDEILDVSAKIFKAGMSLLV  327

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  328  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  364



>ref|XP_003538089.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN35088.1| Magnesium-chelatase subunit chlD, chloroplastic [Glycine soja]
Length=750

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 214/214 (100%), Gaps = 0/214 (0%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV
Sbjct  525  NRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  584

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            SIIPFRGD+AEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGR
Sbjct  585  SIIPFRGDAAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGR  644

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            IMIVAITDGRANISLKRSTDPEAAA++DAP+PSAQELKDEILEVAGKIYKAGMSLLVIDT
Sbjct  645  IMIVAITDGRANISLKRSTDPEAAAATDAPKPSAQELKDEILEVAGKIYKAGMSLLVIDT  704

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            ENKFVSTGFAKEIA++AQGKYYYLPNASDAVIS+
Sbjct  705  ENKFVSTGFAKEIARVAQGKYYYLPNASDAVISS  738



>ref|XP_006379057.1| hypothetical protein POPTR_0009s05400g [Populus trichocarpa]
 gb|ERP56854.1| hypothetical protein POPTR_0009s05400g [Populus trichocarpa]
Length=763

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 211/217 (97%), Gaps = 1/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QKSRKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  537  QKSRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  596

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV+IIPFRGD+AEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  597  QVAIIPFRGDAAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  656

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTD   AA  DAPRPS QELKDEILEVAGKIYKAGMSLLVI
Sbjct  657  GRIMIVAITDGRANISLKRSTD-PEAAGPDAPRPSTQELKDEILEVAGKIYKAGMSLLVI  715

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  716  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  752



>ref|XP_010105401.1| Magnesium-chelatase subunit chlD [Morus notabilis]
 gb|EXC04601.1| Magnesium-chelatase subunit chlD [Morus notabilis]
Length=760

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  533  QKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  592

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGD AEV+LPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  593  QVSIIPFRGDCAEVILPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  652

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GR+MIV +TDGRANISLK+STDPEAAA++DAPRPSAQELKDEILEVAGKIYKAGMSLLVI
Sbjct  653  GRVMIVVLTDGRANISLKKSTDPEAAAAADAPRPSAQELKDEILEVAGKIYKAGMSLLVI  712

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  713  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  749



>gb|KJB21817.1| hypothetical protein B456_004G015600 [Gossypium raimondii]
Length=755

 Score =   367 bits (943),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 205/218 (94%), Positives = 214/218 (98%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  528  IQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  587

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+ AVRVG+NAEKSGD
Sbjct  588  DQVSIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGD  647

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLKRSTD   AA+SDAPRPSAQELKDEILEV+GKIYKAGMSLLV
Sbjct  648  VGRVMIVAITDGRANISLKRSTD-PEAAASDAPRPSAQELKDEILEVSGKIYKAGMSLLV  706

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  707  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  744



>gb|KDP22132.1| hypothetical protein JCGZ_25963 [Jatropha curcas]
Length=756

 Score =   367 bits (942),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 212/217 (98%), Gaps = 1/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QKSRKVFVEK DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  530  QKSRKVFVEKADMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  589

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV+IIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  590  QVAIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  649

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRS+D   AA+ DAPRPSAQELKDEILEVAGKIYKAGMSLLVI
Sbjct  650  GRIMIVAITDGRANISLKRSSD-PEAAAPDAPRPSAQELKDEILEVAGKIYKAGMSLLVI  708

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  709  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  745



>gb|KHG27451.1| Magnesium-chelatase subunit chlD, chloroplastic [Gossypium arboreum]
Length=755

 Score =   367 bits (942),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 205/218 (94%), Positives = 214/218 (98%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  528  IQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  587

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+ AVRVG+NAEKSGD
Sbjct  588  DQVSIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGD  647

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLKRSTD   AA+SDAPRPSAQELKDEILEV+GKIYKAGMSLLV
Sbjct  648  VGRVMIVAITDGRANISLKRSTD-PEAAASDAPRPSAQELKDEILEVSGKIYKAGMSLLV  706

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  707  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  744



>ref|XP_003517516.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
isoform X1 [Glycine max]
Length=750

 Score =   367 bits (942),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            SRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV
Sbjct  525  SRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  584

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            SIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGR
Sbjct  585  SIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGR  644

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +MIVAITDGRANISLKRSTDPE AA++DAP+PSAQELKDEILEVAGKIYKAGMSLLVIDT
Sbjct  645  VMIVAITDGRANISLKRSTDPEVAAATDAPKPSAQELKDEILEVAGKIYKAGMSLLVIDT  704

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            ENKFVSTGFAKEIA++AQGKYYYLPNASDAVIS+
Sbjct  705  ENKFVSTGFAKEIARVAQGKYYYLPNASDAVISS  738



>gb|KHN25632.1| Magnesium-chelatase subunit chlD, chloroplastic [Glycine soja]
Length=750

 Score =   367 bits (942),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            SRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV
Sbjct  525  SRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  584

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            SIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGR
Sbjct  585  SIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGR  644

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +MIVAITDGRANISLKRSTDPE AA++DAP+PSAQELKDEILEVAGKIYKAGMSLLVIDT
Sbjct  645  VMIVAITDGRANISLKRSTDPEVAAATDAPKPSAQELKDEILEVAGKIYKAGMSLLVIDT  704

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            ENKFVSTGFAKEIA++AQGKYYYLPNASDAVIS+
Sbjct  705  ENKFVSTGFAKEIARVAQGKYYYLPNASDAVISS  738



>ref|XP_006470704.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Citrus sinensis]
Length=765

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 204/217 (94%), Positives = 212/217 (98%), Gaps = 1/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QK+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  539  QKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  598

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+ AVRVG+NAEKSGDV
Sbjct  599  QVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGDV  658

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTD   A +SDAPRPS+QELKDEILEVAGKIYKAGMSLLVI
Sbjct  659  GRIMIVAITDGRANISLKRSTD-PEATASDAPRPSSQELKDEILEVAGKIYKAGMSLLVI  717

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  718  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  754



>ref|XP_008363236.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Malus 
domestica]
Length=772

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 211/216 (98%), Gaps = 0/216 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q SRK FVE++DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  545  QSSRKXFVERSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  604

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSISMAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  605  QVSIIPFRGDSAEVLLPPSRSISMARNRLERLPCGGGSPLAHGLTTAVRVGINAEKSGDV  664

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTDPEAAA+SD  +PS+QELKDEILEVAGKIYKAGMSLLVI
Sbjct  665  GRIMIVAITDGRANISLKRSTDPEAAAASDVSKPSSQELKDEILEVAGKIYKAGMSLLVI  724

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  725  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  760



>ref|XP_002314091.2| Mg-chelatase subunit D family protein [Populus trichocarpa]
 gb|EEE88046.2| Mg-chelatase subunit D family protein [Populus trichocarpa]
Length=786

 Score =   368 bits (944),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 211/217 (97%), Gaps = 1/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QKSRKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  560  QKSRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  619

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV+IIPFRGD+AEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  620  QVAIIPFRGDAAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  679

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTD   AA  DAPRPS QELKDEILEVAGKIYKAGMSLLVI
Sbjct  680  GRIMIVAITDGRANISLKRSTD-PEAAGPDAPRPSTQELKDEILEVAGKIYKAGMSLLVI  738

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  739  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  775



>ref|XP_008806573.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Phoenix dactylifera]
Length=612

 Score =   363 bits (931),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 200/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAL+LLAESYTSR
Sbjct  384  VNKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALQLLAESYTSR  443

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+TAVRVG+NAEKSGD
Sbjct  444  DQVSIIPFRGDYAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSTAVRVGLNAEKSGD  503

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRAN+SLK STDPEAAAS+DAP+ SAQELKDEIL+VAGKIYK GMSLLV
Sbjct  504  VGRVMIVAITDGRANVSLKISTDPEAAASADAPKLSAQELKDEILDVAGKIYKTGMSLLV  563

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  564  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  601



>ref|XP_007015160.1| Albina 1 [Theobroma cacao]
 gb|EOY32779.1| Albina 1 [Theobroma cacao]
Length=761

 Score =   367 bits (942),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 205/218 (94%), Positives = 214/218 (98%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQKSRKVFVEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  534  IQKSRKVFVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  593

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+ AVRVG+NAEKSGD
Sbjct  594  DQVSIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGD  653

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLKRSTD   AA+SDAPRPSAQELKDEILEVAGKIYKAGMSLLV
Sbjct  654  VGRVMIVAITDGRANISLKRSTD-PEAAASDAPRPSAQELKDEILEVAGKIYKAGMSLLV  712

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  713  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  750



>ref|XP_009802534.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Nicotiana 
sylvestris]
Length=758

 Score =   367 bits (941),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 204/217 (94%), Positives = 211/217 (97%), Gaps = 1/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQK+RKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  531  IQKTRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  590

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV IIPFRGD+AEVLLPPSRSISMAR RLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD
Sbjct  591  DQVCIIPFRGDAAEVLLPPSRSISMARNRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  650

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANISLKRSTD   A +SDAPRPS+QELKDEILEVAGKIYKAGMSLLV
Sbjct  651  VGRIMIVAITDGRANISLKRSTD-PEAEASDAPRPSSQELKDEILEVAGKIYKAGMSLLV  709

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  710  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  746



>ref|XP_004981316.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Setaria italica]
Length=755

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 204/215 (95%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ
Sbjct  529  KTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  588

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            VSIIPFRGD AEVLLPPSRSI+MARKRLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGDVG
Sbjct  589  VSIIPFRGDYAEVLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVG  648

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            RIMIVAITDGRAN+SLKRSTDPEAAA+SDAPRPS QELKDEILEVAGKIYKAGMSLLVID
Sbjct  649  RIMIVAITDGRANVSLKRSTDPEAAAASDAPRPSTQELKDEILEVAGKIYKAGMSLLVID  708

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            TENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  709  TENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  743



>ref|XP_009629316.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Nicotiana 
tomentosiformis]
Length=759

 Score =   366 bits (939),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 203/217 (94%), Positives = 211/217 (97%), Gaps = 1/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +QK+RKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  532  VQKTRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  591

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV IIPFRGD+AEVLLPPSRSISMAR RLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD
Sbjct  592  DQVCIIPFRGDAAEVLLPPSRSISMARNRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  651

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANISLKRSTD   A +SDAPRPS+QELKDEILEVAGKIYKAGMSLLV
Sbjct  652  VGRIMIVAITDGRANISLKRSTD-PEAEASDAPRPSSQELKDEILEVAGKIYKAGMSLLV  710

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  711  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  747



>ref|XP_010246236.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=754

 Score =   366 bits (939),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 214/218 (98%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQK RKVFVEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLL+ESYTSR
Sbjct  527  IQKIRKVFVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLSESYTSR  586

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  587  DQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  646

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLK+STD   AA++DAP+PS+QELKDEILEVAGKIYKAGMSLLV
Sbjct  647  VGRVMIVAITDGRANISLKKSTD-PEAAATDAPKPSSQELKDEILEVAGKIYKAGMSLLV  705

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  706  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  743



>ref|XP_003610971.1| Magnesium-chelatase subunit chlD [Medicago truncatula]
 gb|AES93929.1| protoporphyrin IX magnesium chelatase subunit ChlD [Medicago 
truncatula]
Length=754

 Score =   366 bits (939),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 201/215 (93%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  527  ENRRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  586

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  587  QVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  646

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTDPEAAA++DAP+P++QELKDEILEVAGKIYK+GMSLLVI
Sbjct  647  GRIMIVAITDGRANISLKRSTDPEAAAATDAPKPTSQELKDEILEVAGKIYKSGMSLLVI  706

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAV+S
Sbjct  707  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVVS  741



>ref|XP_010922222.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Elaeis 
guineensis]
Length=753

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I K++KVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAL+LLAESYTSR
Sbjct  525  INKTKKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALQLLAESYTSR  584

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+TAVRVG+NAEKSGD
Sbjct  585  DQVSIIPFRGDYAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSTAVRVGLNAEKSGD  644

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRAN+SLKRSTDPEAA S+DA +PSAQELKDEIL+VAGKIYKAGMSLLV
Sbjct  645  VGRVMIVAITDGRANVSLKRSTDPEAATSADAHKPSAQELKDEILDVAGKIYKAGMSLLV  704

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA+IAQGKYYYLPNASDAVIS T
Sbjct  705  IDTENKFVSTGFAKEIARIAQGKYYYLPNASDAVISGT  742



>ref|XP_008644403.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Zea 
mays]
 gb|AFW67237.1| hypothetical protein ZEAMMB73_644992 [Zea mays]
Length=755

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 204/215 (95%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ
Sbjct  529  KTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  588

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            VSIIPFRGD AEVLLPPSRSI+MARKRLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGDVG
Sbjct  589  VSIIPFRGDYAEVLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVG  648

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            RIMIVAITDGRAN+SLKRSTDPEAAA+SDAPRPS+QELKDEILEVAGKIYKAGMSLLVID
Sbjct  649  RIMIVAITDGRANVSLKRSTDPEAAAASDAPRPSSQELKDEILEVAGKIYKAGMSLLVID  708

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            TENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  709  TENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  743



>ref|XP_008449685.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Cucumis 
melo]
Length=748

 Score =   365 bits (937),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 202/217 (93%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +Q +RKVFVEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  520  VQNNRKVFVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  579

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  580  DQVSIIPFRGDCAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  639

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLK+STDPEAAA++DAP+PSAQELKDEILEVAGKIYK+GMSLLV
Sbjct  640  VGRVMIVAITDGRANISLKKSTDPEAAAAADAPKPSAQELKDEILEVAGKIYKSGMSLLV  699

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  700  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  736



>sp|O24133.1|CHLD_TOBAC RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; Flags: Precursor [Nicotiana tabacum]
 emb|CAA71128.1| CHLD magnesium chelatase subunit [Nicotiana tabacum]
Length=758

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 203/217 (94%), Positives = 210/217 (97%), Gaps = 1/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQK+RKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  531  IQKTRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  590

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV IIPFRGD+AEVLLPPSRSISMAR RLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD
Sbjct  591  DQVCIIPFRGDAAEVLLPPSRSISMARNRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  650

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANISLKRSTD   A +SDAPRPS+QELKDEILEVAGKIYK GMSLLV
Sbjct  651  VGRIMIVAITDGRANISLKRSTD-PEAEASDAPRPSSQELKDEILEVAGKIYKTGMSLLV  709

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  710  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  746



>ref|XP_002466225.1| hypothetical protein SORBIDRAFT_01g003860 [Sorghum bicolor]
 gb|EER93223.1| hypothetical protein SORBIDRAFT_01g003860 [Sorghum bicolor]
Length=755

 Score =   365 bits (937),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 204/215 (95%), Positives = 214/215 (99%), Gaps = 0/215 (0%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ
Sbjct  529  KARKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  588

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            VSIIPFRGD AEVLLPPSRSI+MARKRLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGDVG
Sbjct  589  VSIIPFRGDYAEVLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVG  648

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            RIMIVAITDGRAN+SLKRSTDPEAAA+SDAPRPS+QELKDEILEVAGKIYKAGMSLLVID
Sbjct  649  RIMIVAITDGRANVSLKRSTDPEAAAASDAPRPSSQELKDEILEVAGKIYKAGMSLLVID  708

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            TENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  709  TENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  743



>gb|KDO50420.1| hypothetical protein CISIN_1g004256mg [Citrus sinensis]
Length=765

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 203/217 (94%), Positives = 211/217 (97%), Gaps = 1/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QK+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYT RD
Sbjct  539  QKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRD  598

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+ AVRVG+NAEKSGDV
Sbjct  599  QVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGDV  658

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTD   A +SDAPRPS+QELKDEILEVAGKIYKAGMSLLVI
Sbjct  659  GRIMIVAITDGRANISLKRSTD-PEATASDAPRPSSQELKDEILEVAGKIYKAGMSLLVI  717

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  718  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  754



>ref|XP_011032080.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Populus 
euphratica]
Length=801

 Score =   366 bits (940),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 204/217 (94%), Positives = 211/217 (97%), Gaps = 1/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QKSRKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  575  QKSRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  634

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV+IIPFRGD+AEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  635  QVAIIPFRGDAAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  694

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTD   AA  D PRPSA+ELKDEILEVAGKIYKAGMSLLVI
Sbjct  695  GRIMIVAITDGRANISLKRSTD-PEAAGPDTPRPSARELKDEILEVAGKIYKAGMSLLVI  753

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  754  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  790



>ref|XP_007158593.1| hypothetical protein PHAVU_002G165600g [Phaseolus vulgaris]
 gb|ESW30587.1| hypothetical protein PHAVU_002G165600g [Phaseolus vulgaris]
Length=746

 Score =   364 bits (935),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 208/213 (98%), Gaps = 2/213 (1%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            SRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV
Sbjct  523  SRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  582

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            SIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGR
Sbjct  583  SIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGR  642

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            IMIVAITDGRANISLKRSTD    A++DA +PSAQELKDEILEVAGKIYKAGMSLLVIDT
Sbjct  643  IMIVAITDGRANISLKRSTD--PEAAADASKPSAQELKDEILEVAGKIYKAGMSLLVIDT  700

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            ENKFVSTGFAKEIA++AQGKYYYLPNASDAVIS
Sbjct  701  ENKFVSTGFAKEIARVAQGKYYYLPNASDAVIS  733



>ref|XP_009413526.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=759

 Score =   364 bits (934),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 200/217 (92%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
             KSRKVFVEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAL+LLAESYTSRD
Sbjct  532  NKSRKVFVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALQLLAESYTSRD  591

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+ AVRVG+NAEKSGDV
Sbjct  592  QVSIIPFRGDYAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGDV  651

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GR+MIVAITDGRANISLKRSTDPEAAA++D P+PS+QELKDEIL+VAGKIYKAGMSLLVI
Sbjct  652  GRVMIVAITDGRANISLKRSTDPEAAAATDTPKPSSQELKDEILDVAGKIYKAGMSLLVI  711

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  712  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  748



>ref|XP_009413527.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=756

 Score =   364 bits (934),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 200/217 (92%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
             KSRKVFVEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAL+LLAESYTSRD
Sbjct  529  NKSRKVFVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALQLLAESYTSRD  588

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+ AVRVG+NAEKSGDV
Sbjct  589  QVSIIPFRGDYAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGDV  648

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GR+MIVAITDGRANISLKRSTDPEAAA++D P+PS+QELKDEIL+VAGKIYKAGMSLLVI
Sbjct  649  GRVMIVAITDGRANISLKRSTDPEAAAATDTPKPSSQELKDEILDVAGKIYKAGMSLLVI  708

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  709  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  745



>emb|CDP08502.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   364 bits (935),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 202/218 (93%), Positives = 212/218 (97%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQKS++VFVEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  536  IQKSKRVFVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  595

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV IIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD
Sbjct  596  DQVCIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  655

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANISLKRSTD    AS+DAPRPS Q+LKDEILEVAGKIYK+GMSLLV
Sbjct  656  VGRIMIVAITDGRANISLKRSTD-PEGASADAPRPSTQDLKDEILEVAGKIYKSGMSLLV  714

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  715  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  752



>gb|KJB21818.1| hypothetical protein B456_004G015600 [Gossypium raimondii]
Length=755

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 203/218 (93%), Positives = 212/218 (97%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            IQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  528  IQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  587

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+   RVG+NAEKSGD
Sbjct  588  DQVSIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMVFRVGLNAEKSGD  647

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLKRSTD   AA+SDAPRPSAQELKDEILEV+GKIYKAGMSLLV
Sbjct  648  VGRVMIVAITDGRANISLKRSTD-PEAAASDAPRPSAQELKDEILEVSGKIYKAGMSLLV  706

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  707  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  744



>ref|XP_004236627.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Solanum 
lycopersicum]
Length=766

 Score =   364 bits (934),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 202/217 (93%), Positives = 209/217 (96%), Gaps = 1/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +QKSRKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  539  VQKSRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  598

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV IIPFRGD+AEVLLPPSRSISMAR RLE+LPCGGGSPLAHGLTTAVRVGMNAEKSGD
Sbjct  599  DQVCIIPFRGDAAEVLLPPSRSISMARNRLEKLPCGGGSPLAHGLTTAVRVGMNAEKSGD  658

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANISLKRS D   A +SD PRPSAQELKDEILEVAGKIYKAGMSLLV
Sbjct  659  VGRIMIVAITDGRANISLKRSND-PEAEASDVPRPSAQELKDEILEVAGKIYKAGMSLLV  717

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  718  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  754



>ref|XP_004140205.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Cucumis sativus]
Length=748

 Score =   363 bits (932),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 201/217 (93%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +Q +RKV+VEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  520  VQNNRKVYVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  579

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  580  DQVSIIPFRGDCAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  639

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLK+STDPEAAA++DAP+PSAQELKDEILEVAGKIYK+GMSLLV
Sbjct  640  VGRVMIVAITDGRANISLKKSTDPEAAAAADAPKPSAQELKDEILEVAGKIYKSGMSLLV  699

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  700  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  736



>ref|XP_008806572.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=753

 Score =   362 bits (930),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 200/218 (92%), Positives = 213/218 (98%), Gaps = 0/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAL+LLAESYTSR
Sbjct  525  VNKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALQLLAESYTSR  584

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+TAVRVG+NAEKSGD
Sbjct  585  DQVSIIPFRGDYAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSTAVRVGLNAEKSGD  644

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRAN+SLK STDPEAAAS+DAP+ SAQELKDEIL+VAGKIYK GMSLLV
Sbjct  645  VGRVMIVAITDGRANVSLKISTDPEAAASADAPKLSAQELKDEILDVAGKIYKTGMSLLV  704

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  705  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  742



>ref|XP_010673713.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=757

 Score =   362 bits (930),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 201/218 (92%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + K RKV+VEK DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  530  VLKGRKVYVEKMDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  589

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV+IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  590  DQVAIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  649

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANISLKRSTD   A  +DAPRP+ +ELKDEILEVAGKIYKAGMSLLV
Sbjct  650  VGRIMIVAITDGRANISLKRSTD-PEAVPADAPRPTTKELKDEILEVAGKIYKAGMSLLV  708

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA+IAQGKYYYLPNASDAVISAT
Sbjct  709  IDTENKFVSTGFAKEIARIAQGKYYYLPNASDAVISAT  746



>ref|XP_006350212.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Solanum tuberosum]
Length=765

 Score =   362 bits (930),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 201/217 (93%), Positives = 209/217 (96%), Gaps = 1/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +QK+RKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  538  VQKTRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  597

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV IIPFRGD+AEVLLPPSRSISMAR RLE+LPCGGGSPLAHGLTTAVRVGMNAEKSGD
Sbjct  598  DQVCIIPFRGDAAEVLLPPSRSISMARNRLEKLPCGGGSPLAHGLTTAVRVGMNAEKSGD  657

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANISLKRS D   A +SD PRPSAQELKDEILEVAGKIYKAGMSLLV
Sbjct  658  VGRIMIVAITDGRANISLKRSND-PEAEASDVPRPSAQELKDEILEVAGKIYKAGMSLLV  716

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  717  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  753



>ref|XP_006651947.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Oryza brachyantha]
Length=670

 Score =   359 bits (922),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 198/217 (91%), Positives = 210/217 (97%), Gaps = 2/217 (1%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  444  LDKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  503

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MAR+RLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGD
Sbjct  504  DQVSIIPFRGDFAEVLLPPSRSIAMARRRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGD  563

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRAN+SLKRSTD     +SDAPRPS+QELKDEILEVAGKIYKAGMSLLV
Sbjct  564  VGRIMIVAITDGRANVSLKRSTD--PEGTSDAPRPSSQELKDEILEVAGKIYKAGMSLLV  621

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  622  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  658



>gb|AAD52031.1|AF083555_1 magnesium-chelatase subunit CHLD precursor [Arabidopsis thaliana]
Length=726

 Score =   360 bits (925),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 210/218 (96%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  499  ISGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  558

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  559  DQVSIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  618

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRSTD   + + DAPRP+++ELKDEILEVAGKIYKAGMSLLV
Sbjct  619  VGRIMIVAITDGRANITLKRSTD-PESIAPDAPRPTSKELKDEILEVAGKIYKAGMSLLV  677

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  678  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  715



>emb|CDX95054.1| BnaC05g06170D [Brassica napus]
Length=754

 Score =   361 bits (926),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  527  ISGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  586

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV+IIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  587  DQVAIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  646

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRSTD     + DAPRPS+QELKDEILEVAGKIYKAGMSLLV
Sbjct  647  VGRIMIVAITDGRANITLKRSTD-PEGIAPDAPRPSSQELKDEILEVAGKIYKAGMSLLV  705

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  706  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  743



>ref|XP_009148107.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Brassica 
rapa]
Length=756

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 209/218 (96%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  529  ISGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  588

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV+IIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  589  DQVAIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  648

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRSTD     + DAPRPS+QELKDEILEVAGKIYKAGMSLLV
Sbjct  649  VGRIMIVAITDGRANITLKRSTD-PEGIAPDAPRPSSQELKDEILEVAGKIYKAGMSLLV  707

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  708  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  745



>ref|NP_563821.2| magnesium-chelatase subunit chlD [Arabidopsis thaliana]
 sp|Q9SJE1.3|CHLD_ARATH RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; AltName: Full=Protein ALBINA 
1; AltName: Full=Protein PIGMENT DEFECTIVE EMBRYO 166; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL36177.1| putative Mg-chelatase [Arabidopsis thaliana]
 gb|AAM14341.1| putative Mg-chelatase [Arabidopsis thaliana]
 dbj|BAE98674.1| Mg-chelatase like protein [Arabidopsis thaliana]
 gb|AEE28301.1| magnesium-chelatase subunit chlD [Arabidopsis thaliana]
Length=760

 Score =   360 bits (925),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 210/218 (96%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  533  ISGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  592

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  593  DQVSIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  652

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRSTD   + + DAPRP+++ELKDEILEVAGKIYKAGMSLLV
Sbjct  653  VGRIMIVAITDGRANITLKRSTD-PESIAPDAPRPTSKELKDEILEVAGKIYKAGMSLLV  711

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  712  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  749



>ref|XP_002889699.1| T27G7.20 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65958.1| T27G7.20 [Arabidopsis lyrata subsp. lyrata]
Length=772

 Score =   360 bits (925),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 210/218 (96%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  545  ITGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  604

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  605  DQVSIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  664

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRSTD   + + DAPRP+++ELKDEILEVAGKIYKAGMSLLV
Sbjct  665  VGRIMIVAITDGRANITLKRSTD-PDSIAPDAPRPTSKELKDEILEVAGKIYKAGMSLLV  723

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  724  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  761



>ref|XP_010475652.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Camelina 
sativa]
Length=759

 Score =   360 bits (923),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 210/215 (98%), Gaps = 1/215 (0%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV
Sbjct  535  TRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  594

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            +IIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGR
Sbjct  595  AIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGR  654

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            IMIVAITDGRANI+LKRSTD   + ++DAPRP+++ELKDEILEVAGKIYKAGMSLLVIDT
Sbjct  655  IMIVAITDGRANITLKRSTD-PESIAADAPRPTSKELKDEILEVAGKIYKAGMSLLVIDT  713

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            ENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  714  ENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  748



>ref|XP_003563940.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Brachypodium 
distachyon]
Length=758

 Score =   359 bits (922),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 200/217 (92%), Positives = 212/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  531  LNKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  590

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MARKRLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGD
Sbjct  591  DQVSIIPFRGDFAEVLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGD  650

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRAN+SLK+S DPEAAA+SDAPRPS QELKDEILEV+ KIYKAGMSLLV
Sbjct  651  VGRIMIVAITDGRANVSLKKSNDPEAAAASDAPRPSTQELKDEILEVSAKIYKAGMSLLV  710

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  711  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  747



>ref|XP_010458091.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Camelina sativa]
Length=746

 Score =   359 bits (921),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 210/215 (98%), Gaps = 1/215 (0%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV
Sbjct  522  TRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  581

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            +IIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGR
Sbjct  582  AIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGR  641

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            IMIVAITDGRANI+LKRSTD   + ++DAPRP+++ELKDEILEVAGKIYKAGMSLLVIDT
Sbjct  642  IMIVAITDGRANITLKRSTD-PESIAADAPRPTSKELKDEILEVAGKIYKAGMSLLVIDT  700

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            ENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  701  ENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  735



>sp|O22437.1|CHLD_PEA RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; Flags: Precursor [Pisum sativum]
 gb|AAB72194.1| Mg-chelatase subunit D [Pisum sativum]
Length=754

 Score =   359 bits (921),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 198/215 (92%), Positives = 210/215 (98%), Gaps = 0/215 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  RKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  527  ENRRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  586

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  587  QVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  646

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRS DPEAAA+SDAP+P++QELKDEI+EVA KIYK GMSLLVI
Sbjct  647  GRIMIVAITDGRANISLKRSNDPEAAAASDAPKPTSQELKDEIIEVAAKIYKTGMSLLVI  706

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAV+S
Sbjct  707  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVVS  741



>ref|XP_006417679.1| hypothetical protein EUTSA_v10006894mg [Eutrema salsugineum]
 gb|ESQ36032.1| hypothetical protein EUTSA_v10006894mg [Eutrema salsugineum]
Length=753

 Score =   359 bits (921),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 208/218 (95%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  526  ISGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  585

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV+IIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  586  DQVAIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  645

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRSTD     + DAPRPS+QELKDEILEVA KIYKAGMSLLV
Sbjct  646  VGRIMIVAITDGRANITLKRSTD-PEGIAPDAPRPSSQELKDEILEVAAKIYKAGMSLLV  704

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  705  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  742



>ref|XP_010488958.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Camelina sativa]
Length=759

 Score =   359 bits (921),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 210/215 (98%), Gaps = 1/215 (0%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV
Sbjct  535  TRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  594

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            +IIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGR
Sbjct  595  AIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGR  654

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            IMIVAITDGRANI+LKRSTD   + ++DAPRP+++ELKDEILEVAGKIYKAGMSLLVIDT
Sbjct  655  IMIVAITDGRANITLKRSTD-PESIAADAPRPTSKELKDEILEVAGKIYKAGMSLLVIDT  713

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            ENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  714  ENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  748



>emb|CDX93557.1| BnaA06g04910D [Brassica napus]
Length=756

 Score =   358 bits (920),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 198/218 (91%), Positives = 208/218 (95%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEK DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  529  ISGTRKVFVEKADMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  588

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV+IIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  589  DQVAIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  648

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRSTD     + DAPRPS+QELKDEILEVAGKIYKAGMSLLV
Sbjct  649  VGRIMIVAITDGRANITLKRSTD-PEGIAPDAPRPSSQELKDEILEVAGKIYKAGMSLLV  707

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  708  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  745



>ref|XP_006306844.1| hypothetical protein CARUB_v10008387mg [Capsella rubella]
 gb|EOA39742.1| hypothetical protein CARUB_v10008387mg [Capsella rubella]
Length=758

 Score =   358 bits (920),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 210/218 (96%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEK DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  531  ISGTRKVFVEKPDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  590

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  591  DQVSIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  650

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRSTD   + ++DAPRP+++ELKDEILEVAGKIYKAGMSLLV
Sbjct  651  VGRIMIVAITDGRANITLKRSTD-PDSIAADAPRPTSKELKDEILEVAGKIYKAGMSLLV  709

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  710  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  747



>ref|XP_008359243.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Malus domestica]
Length=414

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 193/216 (89%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q SRKVFVE++DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKG ALKLLAESYTSRD
Sbjct  187  QSSRKVFVERSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGEALKLLAESYTSRD  246

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPF+GDSAEVLLPPSRSISMAR RLERLPC G SPLAHGLT AVRVG+NAE SGDV
Sbjct  247  QVSIIPFQGDSAEVLLPPSRSISMARNRLERLPCXGXSPLAHGLTRAVRVGINAEMSGDV  306

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIVAITDGRANISLKRSTDPEAAA++D P+PS+QELKDEILEVAGKIYKAGM LLVI
Sbjct  307  GRIMIVAITDGRANISLKRSTDPEAAAATDVPKPSSQELKDEILEVAGKIYKAGMCLLVI  366

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFA E A++AQGKYYYLP+ SDAVISA
Sbjct  367  DTENKFVSTGFAXEXARVAQGKYYYLPBXSDAVISA  402



>gb|KGN48112.1| hypothetical protein Csa_6G434320 [Cucumis sativus]
Length=1091

 Score =   365 bits (936),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 201/217 (93%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +Q +RKV+VEK+DMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  520  VQNNRKVYVEKSDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  579

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  580  DQVSIIPFRGDCAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  639

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGR+MIVAITDGRANISLK+STDPEAAA++DAP+PSAQELKDEILEVAGKIYK+GMSLLV
Sbjct  640  VGRVMIVAITDGRANISLKKSTDPEAAAAADAPKPSAQELKDEILEVAGKIYKSGMSLLV  699

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  700  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  736



>ref|XP_011459478.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=757

 Score =   357 bits (915),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 202/217 (93%), Positives = 211/217 (97%), Gaps = 1/217 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKVFVEKTDMRAKRMARKAGALVIF+VDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  529  QVGRKVFVEKTDMRAKRMARKAGALVIFLVDASGSMALNRMQNAKGAALKLLAESYTSRD  588

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  589  QVSIIPFRGDSAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  648

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassd-aprpsAQELKDEILEVAGKIYKAGMSLLV  254
            GR+MIVAITDGRANISLKRS DPEAAA++  APRPSA+ELKDEILEVAGKIYKAGMSLLV
Sbjct  649  GRVMIVAITDGRANISLKRSNDPEAAAAATDAPRPSAKELKDEILEVAGKIYKAGMSLLV  708

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  709  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  745



>gb|KFK43171.1| hypothetical protein AALP_AA1G089000 [Arabis alpina]
Length=753

 Score =   356 bits (914),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 196/218 (90%), Positives = 207/218 (95%), Gaps = 1/218 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEKTDMRAKRMARKAGALVIF+VDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  526  ISGTRKVFVEKTDMRAKRMARKAGALVIFLVDASGSMALNRMQNAKGAALKLLAESYTSR  585

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQVSIIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGD
Sbjct  586  DQVSIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGD  645

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRANI+LKRS D     + DAPRP++QELKDEILEVA KIYKAGMSLLV
Sbjct  646  VGRIMIVAITDGRANITLKRSID-PEGIAPDAPRPTSQELKDEILEVAAKIYKAGMSLLV  704

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  705  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  742



>gb|AAP73850.1| putative magnesium chelatase subunit chlD [Oryza sativa Japonica 
Group]
Length=745

 Score =   355 bits (912),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 209/215 (97%), Gaps = 2/215 (1%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ
Sbjct  521  KTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  580

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            VSIIPFRGD AEVLLPPSRSI+MAR RLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGDVG
Sbjct  581  VSIIPFRGDFAEVLLPPSRSIAMARNRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVG  640

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            RIMIVAITDGRAN+SLK+STD    A+SDAPRPS+QELKDEILEVAGKIYKAG+SLLVID
Sbjct  641  RIMIVAITDGRANVSLKKSTD--PEATSDAPRPSSQELKDEILEVAGKIYKAGISLLVID  698

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            TENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  699  TENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  733



>ref|NP_001051668.1| Os03g0811100 [Oryza sativa Japonica Group]
 sp|Q6ATS0.1|CHLD_ORYSJ RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; AltName: Full=Protein CHLORINA 
1; Flags: Precursor [Oryza sativa Japonica Group]
 sp|B8AMB8.1|CHLD_ORYSI RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; 
Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin 
IX chelatase subunit ChlD; AltName: Full=Protein CHLORINA 
1; Flags: Precursor [Oryza sativa Indica Group]
 gb|AAT77900.1| putative magnesium chelatase [Oryza sativa Japonica Group]
 gb|ABF99490.1| magnesium chelatase ATPase subunit D family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13582.1| Os03g0811100 [Oryza sativa Japonica Group]
 gb|ABK58606.1| magnesium chelatase subunit D [Oryza sativa Japonica Group]
 gb|ABK58607.1| magnesium chelatase subunit D [Oryza sativa Japonica Group]
 dbj|BAG92983.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76389.1| hypothetical protein OsI_14020 [Oryza sativa Indica Group]
 gb|EEE60156.1| hypothetical protein OsJ_13066 [Oryza sativa Japonica Group]
Length=754

 Score =   355 bits (912),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 209/215 (97%), Gaps = 2/215 (1%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ
Sbjct  530  KTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  589

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            VSIIPFRGD AEVLLPPSRSI+MAR RLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGDVG
Sbjct  590  VSIIPFRGDFAEVLLPPSRSIAMARNRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVG  649

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            RIMIVAITDGRAN+SLK+STD    A+SDAPRPS+QELKDEILEVAGKIYKAG+SLLVID
Sbjct  650  RIMIVAITDGRANVSLKKSTD--PEATSDAPRPSSQELKDEILEVAGKIYKAGISLLVID  707

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            TENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  708  TENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  742



>gb|AAF22895.1|AC006932_12 T27G7.20 [Arabidopsis thaliana]
Length=778

 Score =   356 bits (913),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 198/220 (90%), Positives = 210/220 (95%), Gaps = 3/220 (1%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            I  +RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  549  ISGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  608

Query  613  DQV--SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKS  440
            DQV  SIIPFRGD+AEVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKS
Sbjct  609  DQVKVSIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKS  668

Query  439  GDVGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSL  260
            GDVGRIMIVAITDGRANI+LKRSTD   + + DAPRP+++ELKDEILEVAGKIYKAGMSL
Sbjct  669  GDVGRIMIVAITDGRANITLKRSTD-PESIAPDAPRPTSKELKDEILEVAGKIYKAGMSL  727

Query  259  LVIDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            LVIDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISAT
Sbjct  728  LVIDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISAT  767



>gb|AAZ32779.1| chloroplast Mg-chelatase subunit XANTHA-G precursor [Hordeum 
vulgare]
 dbj|BAJ86238.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=761

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 197/217 (91%), Positives = 212/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  534  LDKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  593

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV+IIPFRGD AEVLLPPSRSI+MARKRLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGD
Sbjct  594  DQVAIIPFRGDYAEVLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGD  653

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRAN+SLK+S DPEAAA+SDAPRPS QELKDEIL+V+ KI+KAGMSLLV
Sbjct  654  VGRIMIVAITDGRANVSLKKSNDPEAAAASDAPRPSTQELKDEILDVSAKIFKAGMSLLV  713

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  714  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  750



>gb|EMT09999.1| Magnesium-chelatase subunit chlD, chloroplastic [Aegilops tauschii]
Length=815

 Score =   355 bits (910),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 197/217 (91%), Positives = 212/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            + K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR
Sbjct  588  LDKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  647

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQV+IIPFRGD AEVLLPPSRSI+MARKRLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGD
Sbjct  648  DQVAIIPFRGDYAEVLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGD  707

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            VGRIMIVAITDGRAN+SLK+S DPEAAA+SDAPRPS QELKDEIL+V+ KI+KAGMSLLV
Sbjct  708  VGRIMIVAITDGRANVSLKKSNDPEAAAASDAPRPSTQELKDEILDVSAKIFKAGMSLLV  767

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            IDTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  768  IDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  804



>ref|XP_002977545.1| hypothetical protein SELMODRAFT_176264 [Selaginella moellendorffii]
 gb|EFJ21549.1| hypothetical protein SELMODRAFT_176264 [Selaginella moellendorffii]
Length=720

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            SRKV+VE++DMRAKRMARKAGALVIFVVDASGSMALNRM NAKGAA++LLA+SYTSRDQV
Sbjct  495  SRKVYVEQSDMRAKRMARKAGALVIFVVDASGSMALNRMNNAKGAAMQLLADSYTSRDQV  554

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            SIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+TAVRVG+NAEKSGDVGR
Sbjct  555  SIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSTAVRVGLNAEKSGDVGR  614

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            IMIVAITDGRAN+SLK+ST    A + DAPRPS QELKDEI ++AGKIYK GMSLLVIDT
Sbjct  615  IMIVAITDGRANVSLKKSTGDPEAIAPDAPRPSQQELKDEIKDIAGKIYKTGMSLLVIDT  674

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            ENKF+STGFAKEIA++AQGKYYYLPNASDAV+SA
Sbjct  675  ENKFISTGFAKEIARLAQGKYYYLPNASDAVVSA  708



>ref|XP_002975141.1| hypothetical protein SELMODRAFT_174616 [Selaginella moellendorffii]
 gb|EFJ23926.1| hypothetical protein SELMODRAFT_174616 [Selaginella moellendorffii]
Length=720

 Score =   343 bits (881),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 204/214 (95%), Gaps = 0/214 (0%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            SRKV+VE++DMRAKRMARKAGALVIFVVDASGSMALNRM NAKGAA++LLA+SYTSRDQV
Sbjct  495  SRKVYVEQSDMRAKRMARKAGALVIFVVDASGSMALNRMNNAKGAAMQLLADSYTSRDQV  554

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            SIIPFRGD+AEVLLPPSRSI+MARKRLERLPCGGGSPLAHGL+TAVRVG+NAEKSGDVGR
Sbjct  555  SIIPFRGDAAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSTAVRVGLNAEKSGDVGR  614

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            IMIVAITDGRAN+SLK+ST    A + DAPRPS QELKDEI ++AGKIYK GMSLLVIDT
Sbjct  615  IMIVAITDGRANVSLKKSTGDPEAIAPDAPRPSQQELKDEIKDIAGKIYKTGMSLLVIDT  674

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            ENKF+STGFAKEIA++AQGKYYYLPNASDAV+SA
Sbjct  675  ENKFISTGFAKEIARLAQGKYYYLPNASDAVVSA  708



>ref|XP_001764245.1| predicted protein [Physcomitrella patens]
 gb|EDQ71086.1| predicted protein [Physcomitrella patens]
Length=779

 Score =   343 bits (881),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKVFVE+ DMR+KRMARKAGALVIFVVDASGSMALNRM NAKGAA++LLA+SYTSRDQVS
Sbjct  555  RKVFVEQGDMRSKRMARKAGALVIFVVDASGSMALNRMNNAKGAAMQLLADSYTSRDQVS  614

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            IIPFRG+ AEVLLPPSRSI+MAR RL+RLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI
Sbjct  615  IIPFRGNEAEVLLPPSRSIAMARNRLDRLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  674

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            MIVAITDGRAN++LK+ST  E A   DAP+P+ +ELKDEILEVAGKIYKAGMSLLVIDTE
Sbjct  675  MIVAITDGRANVTLKKSTGDEEANKPDAPKPTQKELKDEILEVAGKIYKAGMSLLVIDTE  734

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKFVSTGFAKEIA++AQGKYYYLPNASDAV++A
Sbjct  735  NKFVSTGFAKEIARVAQGKYYYLPNASDAVVAA  767



>ref|XP_009338554.1| PREDICTED: LOW QUALITY PROTEIN: magnesium-chelatase subunit ChlD, 
chloroplastic-like [Pyrus x bretschneideri]
Length=816

 Score =   318 bits (816),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 194/216 (90%), Gaps = 13/216 (6%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q SRKVFVE++DMR KRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  602  QSSRKVFVERSDMRVKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  661

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSISMAR RLERLPCGGGSPLAHGLTT  RV M        
Sbjct  662  QVSIIPFRGDSAEVLLPPSRSISMARNRLERLPCGGGSPLAHGLTTR-RVVM--------  712

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
               + VAITDGRANISLKRSTD   AA++D P+PS+QELKDEILEVAGKIYKAGMSLLVI
Sbjct  713  ---LDVAITDGRANISLKRSTD-PEAAANDVPKPSSQELKDEILEVAGKIYKAGMSLLVI  768

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKEIA++AQGKYYYLPNASDAVISA
Sbjct  769  DTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISA  804



>ref|WP_040650351.1| magnesium chelatase, partial [Kamptonema formosum]
Length=248

 Score =   281 bits (718),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 176/215 (82%), Gaps = 6/215 (3%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            K ++VFVE  D+RAKR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRDQ
Sbjct  29   KGKRVFVESGDIRAKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQ  88

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            V++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+KSGDVG
Sbjct  89   VALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGVNAQKSGDVG  148

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            ++ IVAITDGR NI L RS                 ++K E+LE+AGKI   GM LLVID
Sbjct  149  QVAIVAITDGRGNIPLARSLG------EPILDGEKPDIKAELLEIAGKIRGLGMQLLVID  202

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            TENKFVSTGFAKE+AK++ GKYY+LP A+D  I+A
Sbjct  203  TENKFVSTGFAKELAKVSGGKYYHLPKATDQAIAA  237



>ref|WP_038297159.1| magnesium chelatase, partial [[Scytonema hofmanni] UTEX B 1581]
Length=220

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 173/213 (81%), Gaps = 5/213 (2%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            ++VFVE++D+R+KR+ RKAGALVIFVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV+
Sbjct  1    KRVFVEQSDIRSKRLVRKAGALVIFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVA  60

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGL+ AVRVG+NA+ SGD+G++
Sbjct  61   LIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLSQAVRVGLNAQMSGDIGQV  120

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+LE+A ++   GM LL+IDTE
Sbjct  121  VIVAITDGRGNIPLSRSLG-----EPQLEAGEKPDIKGELLEIAARMRVLGMQLLMIDTE  175

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKE+A  + GKYY+LP A+D  I+A
Sbjct  176  SKFVSTGFAKELAHTSGGKYYHLPKATDKAIAA  208



>ref|WP_007357531.1| protoporphyrin IX magnesium-chelatase (fragment) [[Oscillatoria] 
sp. PCC 6506]
 emb|CBN58351.1| protoporphyrin IX magnesium-chelatase (fragment) [ [[Oscillatoria] 
sp. PCC 6506]
Length=195

 Score =   265 bits (676),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 154/190 (81%), Gaps = 6/190 (3%)
 Frame = -1

Query  712  IFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDSAEVLLPPSRSISMAR  533
            +FVVDASGSMALNRMQ+AKGA ++LL E+Y SRDQV++IPFRG+ AEVLLPP+RSI++AR
Sbjct  1    MFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVALIPFRGEQAEVLLPPTRSIALAR  60

Query  532  KRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRIMIVAITDGRANISLKRSTDpeaa  353
             RLERLPCGGGSPLAHGLT AVRVG+NA+KSGDVG++ IVAITDGR NI L RS      
Sbjct  61   NRLERLPCGGGSPLAHGLTQAVRVGVNAQKSGDVGQVAIVAITDGRGNIPLARSLG----  116

Query  352  assdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAKEIAKIAQGKYYYL  173
                       ++K E+LE+AGKI   GM LLVIDTENKFVSTGFAKE+AK++ GKYY+L
Sbjct  117  --EPILDGEKPDIKAELLEIAGKIRGLGMQLLVIDTENKFVSTGFAKELAKVSGGKYYHL  174

Query  172  PNASDAVISA  143
            P A+D  I+A
Sbjct  175  PKATDQAIAA  184



>ref|XP_002956151.1| magnesium chelatase subunit D chloroplast precursor [Volvox carteri 
f. nagariensis]
 gb|EFJ42690.1| magnesium chelatase subunit D chloroplast precursor [Volvox carteri 
f. nagariensis]
Length=702

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            ++ RKV+V+K DMR+K++ARKAGALVIFVVDASGSMALNRM  AKGA ++LLAESYTSRD
Sbjct  475  KQQRKVYVDKPDMRSKKLARKAGALVIFVVDASGSMALNRMSAAKGACMRLLAESYTSRD  534

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV +IPF GD AEVLLPPS+SI+MAR+RL+ LPCGGGSPLAHGL+TAVRVGM A ++G+V
Sbjct  535  QVCLIPFYGDRAEVLLPPSKSIAMARRRLDSLPCGGGSPLAHGLSTAVRVGMQASQAGEV  594

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GR+M+V ITDGRAN+SL +S +   A   DAP+P+A +LKDE+ ++A K   AG++ LVI
Sbjct  595  GRVMMVLITDGRANVSLAKSNEDPEALKPDAPKPAADQLKDEVRDMAKKAAAAGINTLVI  654

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPN  167
            DTENKFVSTGFA+EIAK AQGKYYYLPN
Sbjct  655  DTENKFVSTGFAEEIAKAAQGKYYYLPN  682



>ref|WP_042152210.1| magnesium chelatase [Planktothrix agardhii]
 gb|KEI65960.1| ChlD [Planktothrix agardhii NIVA-CYA 126/8]
Length=657

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 175/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  RKV VE+ D+RAKR+ARK+GALV+FVVDASGSMALNRMQ+AKGA L+LL E+Y SRD
Sbjct  436  EPGRKVIVEQGDIRAKRLARKSGALVVFVVDASGSMALNRMQSAKGAVLQLLTEAYQSRD  495

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI+ ARKRLERLPCGGGSPLAHGLT AVRVG+NA++SGD+
Sbjct  496  QVSLIPFRGEQAEVLLPPTRSIAAARKRLERLPCGGGSPLAHGLTQAVRVGVNAKQSGDI  555

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NISL RS                 ++K EILE+A KI    M LLVI
Sbjct  556  GQVVIVAITDGRGNISLSRSLGEPQIEGEKP------DIKKEILEIAAKIRGLKMQLLVI  609

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KF+STGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  610  DTESKFISTGFAKELAKTAGGKYYHLPKATDQAIAA  645



>ref|WP_026786559.1| magnesium chelatase [Planktothrix rubescens]
Length=659

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 175/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  RKV VE+ D+RAKR+ARK+GALV+FVVDASGSMALNRMQ+AKGA L+LL E+Y SRD
Sbjct  438  EPGRKVIVEQGDIRAKRLARKSGALVVFVVDASGSMALNRMQSAKGAVLQLLTEAYQSRD  497

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI+ ARKRLERLPCGGGSPLAHGLT AVRVG+NA++SGD+
Sbjct  498  QVSLIPFRGEQAEVLLPPTRSIAAARKRLERLPCGGGSPLAHGLTQAVRVGVNAKQSGDI  557

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NISL RS                 ++K EILE+A KI    M LLVI
Sbjct  558  GQVVIVAITDGRGNISLSRSLGEPQIEGEKP------DIKKEILEIAAKIRGLKMQLLVI  611

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KF+STGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  612  DTESKFISTGFAKELAKTAGGKYYHLPKATDQAIAA  647



>ref|WP_027255545.1| magnesium chelatase [Planktothrix agardhii]
Length=659

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 175/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  RKV VE+ D+RAKR+ARK+GALV+FVVDASGSMALNRMQ+AKGA L+LL E+Y SRD
Sbjct  438  EPGRKVIVEQGDIRAKRLARKSGALVVFVVDASGSMALNRMQSAKGAVLQLLTEAYQSRD  497

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI+ ARKRLERLPCGGGSPLAHGLT AVRVG+NA++SGD+
Sbjct  498  QVSLIPFRGEQAEVLLPPTRSIAAARKRLERLPCGGGSPLAHGLTQAVRVGVNAKQSGDI  557

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NISL RS                 ++K EILE+A KI    M LLVI
Sbjct  558  GQVVIVAITDGRGNISLSRSLGEPQIEGEKP------DIKKEILEIAAKIRGLKMQLLVI  611

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KF+STGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  612  DTESKFISTGFAKELAKTAGGKYYHLPKATDQAIAA  647



>ref|WP_026794098.1| MULTISPECIES: magnesium chelatase [Planktothrix]
Length=659

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 175/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  RKV VE+ D+RAKR+ARK+GALV+FVVDASGSMALNRMQ+AKGA L+LL E+Y SRD
Sbjct  438  EPGRKVIVEQGDIRAKRLARKSGALVVFVVDASGSMALNRMQSAKGAVLQLLTEAYQSRD  497

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI+ ARKRLERLPCGGGSPLAHGLT AVRVG+NA++SGD+
Sbjct  498  QVSLIPFRGEQAEVLLPPTRSIAAARKRLERLPCGGGSPLAHGLTQAVRVGVNAKQSGDI  557

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NISL RS                 ++K EILE+A KI    M LLVI
Sbjct  558  GQVVIVAITDGRGNISLSRSLGEPQIEGEKP------DIKKEILEIAAKIRGLKMQLLVI  611

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KF+STGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  612  DTESKFISTGFAKELAKTAGGKYYHLPKATDQAIAA  647



>ref|WP_026797831.1| magnesium chelatase [Planktothrix prolifica]
Length=659

 Score =   276 bits (706),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 175/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  RKV VE+ D+RAKR+ARK+GALV+FVVDASGSMALNRMQ+AKGA L+LL E+Y SRD
Sbjct  438  EPGRKVIVEQGDIRAKRLARKSGALVVFVVDASGSMALNRMQSAKGAVLQLLTEAYQSRD  497

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI+ ARKRLERLPCGGGSPLAHGLT AVRVG+NA++SGD+
Sbjct  498  QVSLIPFRGEQAEVLLPPTRSIAAARKRLERLPCGGGSPLAHGLTQAVRVGVNAKQSGDI  557

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NISL RS                 ++K EILE+A KI    M LLVI
Sbjct  558  GQVVIVAITDGRGNISLSRSLGEPQIEGEKP------DIKKEILEIAAKIRGLKMQLLVI  611

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KF+STGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  612  DTESKFISTGFAKELAKTAGGKYYHLPKATDQAIAA  647



>ref|WP_011614175.1| magnesium-chelatase subunit ChlD [Trichodesmium erythraeum]
 gb|ABG53881.1| protoporphyrin IX magnesium-chelatase [Trichodesmium erythraeum 
IMS101]
Length=672

 Score =   275 bits (704),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 178/216 (82%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q +R+V VE+ DMRAKR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRD
Sbjct  452  QPNRRVIVEQGDMRAKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRD  511

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI+ AR+RLE++PCGGGSPLAHGLT AVRVG+NA++SGDV
Sbjct  512  QVSLIPFRGEQAEVLLPPTRSITSARRRLEKMPCGGGSPLAHGLTQAVRVGVNAKQSGDV  571

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS       +          +K+E+LE+AGKI   G+ LL+I
Sbjct  572  GQVVIVAITDGRGNIPLARSLGEPMLDAEKP------NIKEELLEIAGKIRGLGIQLLMI  625

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKE+AK + GKYY+LP ASD  I+A
Sbjct  626  DTENKFVSTGFAKELAKQSGGKYYHLPKASDQAIAA  661



>ref|WP_016873557.1| magnesium-chelatase subunit ChlD [Chlorogloeopsis fritschii]
Length=675

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 175/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE+ D+R+KR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  452  QPDRKVIVEQGDIRSKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  511

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ A+VLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+
Sbjct  512  QVSLIPFRGEQADVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDI  571

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++AG+I   GM LLVI
Sbjct  572  GQVVIVAITDGRGNIPLSRSLGEPQEPGEKP------DIKAELLDIAGRIRALGMQLLVI  625

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKEIAK A GKYY+LP A+D  I+A
Sbjct  626  DTESKFVSTGFAKEIAKTAGGKYYHLPKATDKAIAA  661



>ref|WP_041041571.1| magnesium chelatase [Tolypothrix campylonemoides]
 gb|KIJ74206.1| magnesium chelatase [Tolypothrix campylonemoides VB511288]
Length=714

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            QK R+VFVE++D+RAKR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  493  QKGRRVFVEQSDIRAKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  552

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG NA+ SGD+
Sbjct  553  QVALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGSNAQMSGDI  612

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+LE+  +I   GM LLVI
Sbjct  613  GQVVIVAITDGRGNIPLSRSLGEPQEPGQKP------DIKAELLEIGARIRALGMQLLVI  666

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  667  DTESKFVSTGFAKELAKTAGGKYYHLPKATDKAIAA  702



>ref|WP_015148342.1| protoporphyrin IX magnesium-chelatase [Oscillatoria acuminata]
 gb|AFY81698.1| protoporphyrin IX magnesium-chelatase [Oscillatoria acuminata 
PCC 6304]
Length=681

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 175/215 (81%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE+ D+R+KR+ARKAGALVIFVVDASGSMALNRMQ+AKGA L+LL E+Y +RD
Sbjct  460  QPDRKVIVEQGDLRSKRLARKAGALVIFVVDASGSMALNRMQSAKGAVLQLLTEAYQNRD  519

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+++IPFRG+ A+VLLPP+RSI+ AR+RLERLPCGGGSPLAHGLTTAVRVG+NA++SGD+
Sbjct  520  QIALIPFRGEQADVLLPPTRSITSARRRLERLPCGGGSPLAHGLTTAVRVGLNAQQSGDI  579

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++ IVAITDGR N+ L RS          A      ++K E+LE+AGKI   GM LL+I
Sbjct  580  GQVAIVAITDGRGNVPLSRS------LGEPAIEGEKPDIKGELLEIAGKIRGVGMQLLMI  633

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTENKFVSTGFAKE+AK A G+YY LP A+D  I+
Sbjct  634  DTENKFVSTGFAKELAKAAGGRYYSLPKATDRAIA  668



>ref|XP_001700902.1| magnesium chelatase subunit D [Chlamydomonas reinhardtii]
 gb|EDP07156.1| magnesium chelatase subunit D [Chlamydomonas reinhardtii]
Length=767

 Score =   276 bits (705),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKV+V+K DMR+K++ARKAGALVIFVVDASGSMALNRM  AKGA ++LLAESYTSRDQV 
Sbjct  542  RKVYVDKPDMRSKKLARKAGALVIFVVDASGSMALNRMSAAKGACMRLLAESYTSRDQVC  601

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPF GD AEVLLPPS+SI+MAR+RL+ LPCGGGSPLAHGL+TAVRVGM A ++G+VGR+
Sbjct  602  LIPFYGDKAEVLLPPSKSIAMARRRLDSLPCGGGSPLAHGLSTAVRVGMQASQAGEVGRV  661

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            M+V ITDGRAN+SL +S +   A   DAP+P+A  LKDE+ ++A K   AG+++LVIDTE
Sbjct  662  MMVLITDGRANVSLAKSNEDPEALKPDAPKPTADSLKDEVRDMAKKAASAGINVLVIDTE  721

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPN  167
            NKFVSTGFA+EI+K AQGKYYYLPN
Sbjct  722  NKFVSTGFAEEISKAAQGKYYYLPN  746



>ref|WP_017716658.1| magnesium-chelatase subunit ChlD [Oscillatoria sp. PCC 10802]
Length=695

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 175/213 (82%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+VFVE+ D+RAKR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRDQV+
Sbjct  477  RRVFVEEGDVRAKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLQEAYQSRDQVA  536

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSI+ AR+RLERLPCGGGSPLAHGLT AVRVG+NA++SGD+G++
Sbjct  537  LIPFRGEQADVLLPPTRSITTARRRLERLPCGGGSPLAHGLTQAVRVGVNAQQSGDIGQV  596

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+LE+A KI   G+ LLVIDTE
Sbjct  597  VIVAITDGRGNIPLARSL------GEPVVDGEKPDIKGELLEIAAKIRALGVQLLVIDTE  650

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKF+STGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  651  NKFISTGFAKELAKTAGGKYYHLPKATDQAIAA  683



>ref|WP_035150399.1| magnesium chelatase [Calothrix sp. 336/3]
 gb|KFB82235.1| magnesium chelatase [Calothrix sp. 336/3]
Length=676

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 175/213 (82%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            +KV VE+ D+R+KR+ARKAGALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y +RDQVS
Sbjct  457  KKVVVEQGDIRSKRLARKAGALVVFLVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVS  516

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G++
Sbjct  517  LIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQV  576

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NISL RS                 ++K E+LE+AG+I   GM LLVIDTE
Sbjct  577  VIVAITDGRGNISLSRSLGEPQDTEQKP------DIKGELLEIAGRIRALGMQLLVIDTE  630

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKE+AK + GKYY+LP A+D  I+A
Sbjct  631  SKFVSTGFAKELAKTSGGKYYHLPKATDKAIAA  663



>ref|WP_015224439.1| protoporphyrin IX magnesium-chelatase [Halothece sp. PCC 7418]
 gb|AFZ42561.1| protoporphyrin IX magnesium-chelatase [Halothece sp. PCC 7418]
Length=691

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 174/215 (81%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE+TDMR+KR+AR+AGALV+F+VDASGSMALNRMQ+AKGA L+LL E+Y +RD
Sbjct  472  QPHRKVIVEQTDMRSKRLARQAGALVVFLVDASGSMALNRMQSAKGAVLQLLTEAYENRD  531

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSISMAR RLE+LPCGGGSPLAHGLT AV VG NA+ SGDV
Sbjct  532  QVALIPFRGEQAEVLLPPTRSISMARNRLEKLPCGGGSPLAHGLTQAVHVGTNAQMSGDV  591

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++++VAITDGR NI L RS     +            +K+E+L++AGKI   G+ LLVI
Sbjct  592  GQVILVAITDGRGNIPLARSLGEPLSEDEKP------NIKEELLDIAGKIRAIGVKLLVI  645

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTENKFVSTGFAKE+AK A G YY+LP A+D+ I+
Sbjct  646  DTENKFVSTGFAKELAKAAGGNYYHLPKATDSAIA  680



>ref|WP_015172429.1| protoporphyrin IX magnesium-chelatase [Geitlerinema sp. PCC 7407]
 gb|AFY66864.1| protoporphyrin IX magnesium-chelatase [Geitlerinema sp. PCC 7407]
Length=680

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 175/213 (82%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+V VE+ D+R+KR+AR++GALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRDQV+
Sbjct  462  RRVIVEQPDIRSKRLARRSGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVA  521

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI+ AR+RL+RLPCGGGSPLAHGLT AVRVGMNA+++GDVG++
Sbjct  522  LIPFRGEQAEVLLPPTRSIASARRRLDRLPCGGGSPLAHGLTQAVRVGMNAQQTGDVGQV  581

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+LE+AG+I   G+ LLVIDTE
Sbjct  582  VIVAITDGRGNIPLARS------LGEVMMEGEKPDIKGELLEIAGRIRGLGIQLLVIDTE  635

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKF+STGFAKE+AK A GKYY+LP A+D  I++
Sbjct  636  NKFISTGFAKELAKTAGGKYYHLPKATDQAIAS  668



>gb|KIJ82576.1| magnesium chelatase [Scytonema tolypothrichoides VB-61278]
Length=705

 Score =   274 bits (700),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 176/215 (82%), Gaps = 6/215 (3%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            + R+VFVE++D+RAKR+ RKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ
Sbjct  485  RGRRVFVEESDIRAKRLVRKAGALIVFVVDASGSMALNRMQSAKGALMQLLTEAYQNRDQ  544

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            V++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G
Sbjct  545  VALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIG  604

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            +++IVAITDGR NI L RS      +          ++K E+LE+A ++   GM LLVID
Sbjct  605  QVVIVAITDGRGNIPLSRSLGEPQESGQKP------DIKAELLEIAARMRALGMQLLVID  658

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            TE+KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  659  TESKFVSTGFAKELAKTAGGKYYHLPKATDKAIAA  693



>ref|WP_015176521.1| protoporphyrin IX magnesium-chelatase [Oscillatoria nigro-viridis]
 gb|AFZ07238.1| protoporphyrin IX magnesium-chelatase [Oscillatoria nigro-viridis 
PCC 7112]
Length=696

 Score =   273 bits (699),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 174/213 (82%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+VFVE+ D+RAKR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRDQV+
Sbjct  479  RRVFVEQGDIRAKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVA  538

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++ARKRLERLPCGGGSPLAHGLT AVRVG+NA +SGD+G++
Sbjct  539  LIPFRGEQAEVLLPPTRSIALARKRLERLPCGGGSPLAHGLTQAVRVGVNARQSGDIGQV  598

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
             IVAITDGR NI L RS                 ++K E+LE+A KI   GM LLVIDTE
Sbjct  599  AIVAITDGRGNIPLARSLGEPIVDGEKP------DIKQELLEIAAKIRGLGMQLLVIDTE  652

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KF+STGFAKE+AK + GKYY+LP AS+  I+A
Sbjct  653  SKFISTGFAKELAKTSGGKYYHLPKASEQSIAA  685



>ref|WP_015230419.1| Mg-chelatase subunit ChlI [Dactylococcopsis salina]
 gb|AFZ51439.1| Mg-chelatase subunit ChlI [Dactylococcopsis salina PCC 8305]
Length=692

 Score =   273 bits (699),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 173/212 (82%), Gaps = 7/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+V VE++DMR+KR+ARKAGALV+F+VDASGSMALNRMQ+AKGA L+LL E+Y +RDQV+
Sbjct  477  RRVIVEQSDMRSKRLARKAGALVVFLVDASGSMALNRMQSAKGAVLQLLTEAYENRDQVA  536

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSISMAR RLE+LPCGGGSPLAHGLT AV VGMNA+ SGDVG++
Sbjct  537  LIPFRGEQAEVLLPPTRSISMARNRLEKLPCGGGSPLAHGLTQAVHVGMNAQMSGDVGQV  596

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            ++VAITDGR NI L RS         +        +K+E+LE+AGKI   G+ LLVIDTE
Sbjct  597  ILVAITDGRGNIPLARS-------LGEPLPEEKPNIKEELLEIAGKIRALGVKLLVIDTE  649

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            NKFVSTGFAKE+AK A G YY+LP A+D  I+
Sbjct  650  NKFVSTGFAKELAKTAGGNYYHLPKATDQAIA  681



>ref|WP_013192842.1| magnesium-chelatase subunit ChlD [Trichormus azollae]
 gb|ADI65832.1| magnesium chelatase ATPase subunit D ['Nostoc azollae' 0708]
Length=668

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ DMR+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  447  QPDKKVIVEQGDMRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  506

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  507  QVSLIPFRGEQAEVLLPPTRSIALAKNRLERLPCGGGSPLAHGLTQAVRVGINAQMGGDI  566

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++AG+I  AGM LLVI
Sbjct  567  GQVVIVAITDGRGNIPLARSLGEPQEPGEKP------DIKAELLDIAGRIRAAGMQLLVI  620

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  621  DTESKFVSTGFAKELAKTAGGKYYHLPKATDKAIAA  656



>gb|EGK88663.1| LOW QUALITY PROTEIN: Magnesium chelatase [Microcoleus vaginatus 
FGP-2]
Length=704

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 174/213 (82%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+VFVE+ D+RAKR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRDQV+
Sbjct  487  RRVFVEQGDIRAKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVA  546

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++ARKRLERLPCGGGSPLAHGLT AVRVG+NA +SGD+G++
Sbjct  547  LIPFRGEQAEVLLPPTRSIALARKRLERLPCGGGSPLAHGLTQAVRVGVNARQSGDIGQV  606

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
             IVAITDGR NI L RS                 ++K E+LE+A KI   GM LLVIDTE
Sbjct  607  AIVAITDGRGNIPLARSLGEPIVDGEKP------DIKQELLEIAAKIRGLGMQLLVIDTE  660

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KF+STGFAKE+AK + GKYY+LP A++  I+A
Sbjct  661  SKFISTGFAKELAKTSGGKYYHLPKATEQSIAA  693



>ref|WP_015160910.1| magnesium chelatase ATPase subunit D [Chamaesiphon minutus]
 gb|AFY94790.1| magnesium chelatase ATPase subunit D [Chamaesiphon minutus PCC 
6605]
Length=677

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 175/217 (81%), Gaps = 6/217 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE+ D+R K++ARK+GALVIFVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  458  QPDRKVIVEQGDIRGKKLARKSGALVIFVVDASGSMALNRMQSAKGAVMRLLTEAYQNRD  517

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI+MA++RLERLPCGGGSPLAHGLT AVRVG+NA+ SGDV
Sbjct  518  QVALIPFRGEQAEVLLPPTRSIAMAKRRLERLPCGGGSPLAHGLTQAVRVGVNAQSSGDV  577

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR N+ L RS                 ++K E+L++A +I   G+ LLVI
Sbjct  578  GQVVIVAITDGRGNVPLARSLGDTIPPDEKP------DIKQELLDIAARIRSIGIKLLVI  631

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISAT  140
            DTENKF+STGFAKE+AK A GKY++LP A++  I+AT
Sbjct  632  DTENKFISTGFAKELAKQANGKYHHLPKATEQAIAAT  668



>ref|WP_014275943.1| magnesium chelatase subunit D [Arthrospira platensis]
 dbj|BAI91458.1| magnesium chelatase subunit D [Arthrospira platensis NIES-39]
Length=663

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+V VE  D+R+KR+ARK+GALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRDQVS
Sbjct  446  RRVVVESGDIRSKRLARKSGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVS  505

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI+ A++RLER+PCGGGSPLAHGLT AVRVGMNA++SGD+G++
Sbjct  506  LIPFRGEQAEVLLPPTRSIAAAKRRLERMPCGGGSPLAHGLTQAVRVGMNAKQSGDIGQV  565

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+LE+A KI   G+ LLVIDTE
Sbjct  566  VIVAITDGRGNIPLARSLG------EPILEGEKPDIKGELLEIAAKIRGLGIQLLVIDTE  619

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  620  NKFVSTGFAKELAKTAGGKYYHLPKATDQAIAA  652



>ref|WP_035735687.1| magnesium chelatase [Arthrospira platensis]
 gb|KDR58513.1| magnesium chelatase [Arthrospira platensis str. Paraca]
Length=663

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+V VE  D+R+KR+ARK+GALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRDQVS
Sbjct  446  RRVVVESGDIRSKRLARKSGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVS  505

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI+ A++RLER+PCGGGSPLAHGLT AVRVGMNA++SGD+G++
Sbjct  506  LIPFRGEQAEVLLPPTRSIAAAKRRLERMPCGGGSPLAHGLTQAVRVGMNAKQSGDIGQV  565

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+LE+A KI   G+ LLVIDTE
Sbjct  566  VIVAITDGRGNIPLARSLG------EPILEGEKPDIKGELLEIAAKIRGLGIQLLVIDTE  619

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  620  NKFVSTGFAKELAKTAGGKYYHLPKATDQAIAA  652



>ref|WP_017315498.1| magnesium-chelatase subunit ChlD [Mastigocladopsis repens]
Length=702

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 174/213 (82%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LLAE+Y +RDQV+
Sbjct  484  RKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLAEAYENRDQVA  543

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G++
Sbjct  544  LIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQV  603

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS      +          ++K E+LE+A ++   GM LLVIDTE
Sbjct  604  VIVAITDGRGNIPLSRSLGEPQESGQKP------DIKAELLEIAARLRALGMQLLVIDTE  657

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  658  SKFVSTGFAKELAKTAAGKYYHLPKATDKTIAA  690



>ref|WP_017321794.1| magnesium-chelatase subunit ChlD [cyanobacterium PCC 7702]
Length=672

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            +KV +E TD+R+KR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV+
Sbjct  454  KKVIIEPTDIRSKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVA  513

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G++
Sbjct  514  LIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQISGDIGQV  573

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+L++A KI   GM LLVIDTE
Sbjct  574  VIVAITDGRGNIPLSRSLGEPQQPGEKP------DIKAELLDIAAKIRALGMQLLVIDTE  627

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKEIAK A GKYY+LP A+D  I+A
Sbjct  628  SKFVSTGFAKEIAKAAGGKYYHLPKATDQAIAA  660



>ref|XP_003059510.1| magnesium-chelatase subunit chlD chloroplast precursor [Micromonas 
pusilla CCMP1545]
 gb|EEH56642.1| magnesium-chelatase subunit chlD chloroplast precursor [Micromonas 
pusilla CCMP1545]
Length=694

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  +KV+VEK DMRAK++ARK+GAL+IF+VDASGSMALNRM  AKGAAL LL ++Y SRD
Sbjct  467  EAPKKVYVEKGDMRAKKLARKSGALIIFLVDASGSMALNRMNAAKGAALSLLNDAYQSRD  526

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
             VSIIPFRGD AEVLLPPSRSI+MAR RL+ +PCGGGSPLAHGL+ A RVG+N   SGDV
Sbjct  527  MVSIIPFRGDEAEVLLPPSRSIAMARNRLDTMPCGGGSPLAHGLSLAARVGINQMSSGDV  586

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GR+M+V +TDGRANISLK+ST        +A +PS +EL++E+ ++A KIY AGMSLLVI
Sbjct  587  GRVMVVCLTDGRANISLKKSTGDPEYIGPEAIKPSNEELEEEVNDMAAKIYGAGMSLLVI  646

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVI  149
            DTENKFVS+G A+++A+ A GKYYYLPN +D  I
Sbjct  647  DTENKFVSSGMAEKLAQKACGKYYYLPNGTDQEI  680



>ref|WP_035996666.1| magnesium chelatase [Leptolyngbya sp. JSC-1]
Length=680

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 174/213 (82%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            ++VFVE+ D+RAKR+ARKAGAL++FVVDASGSMALNRMQ+AKGA L+LL E+Y +RDQV+
Sbjct  463  KRVFVEQGDLRAKRLARKAGALIVFVVDASGSMALNRMQSAKGAVLRLLTEAYENRDQVA  522

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI+ AR+RLER+PCGGGSPLAHGLT AVRVGMNA++SGD+G++
Sbjct  523  LIPFRGEQAEVLLPPTRSITAARRRLERMPCGGGSPLAHGLTQAVRVGMNAKQSGDIGQV  582

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+L++A KI   G  LLVIDTE
Sbjct  583  VIVAITDGRGNIPLARSLGEPLPDGEKP------DIKAELLDLADKIRLTGFQLLVIDTE  636

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKFVSTGFAKEIAK A GKYY+LP A+D  I+A
Sbjct  637  NKFVSTGFAKEIAKHAGGKYYHLPKATDQAIAA  669



>ref|XP_005645047.1| magnesium chelatase subunit D [Coccomyxa subellipsoidea C-169]
 gb|EIE20503.1| magnesium chelatase subunit D [Coccomyxa subellipsoidea C-169]
Length=725

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            ++ RKV+VE+ DMR+KR+ARKAGALVIFVVDASGSMALNRM +AKGAAL LL +SYTSRD
Sbjct  498  KRERKVYVERGDMRSKRLARKAGALVIFVVDASGSMALNRMSSAKGAALTLLQQSYTSRD  557

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPF GD AEVLLPPS+SI+MAR+RL+ LPCGGGSPLAHG++ AVR  +NA+ SGD 
Sbjct  558  QVSVIPFCGDKAEVLLPPSKSIAMARRRLDSLPCGGGSPLAHGISLAVRTAINAQTSGDC  617

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRIMIV +TDGRAN+SL +S +   A +  AP+PS ++LK E+L++A ++  +G +LLVI
Sbjct  618  GRIMIVLLTDGRANVSLGKSNEDPEAIAEGAPKPSQEQLKTEVLDMAKRVAASGFNLLVI  677

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASD  158
            DTEN+FVSTGFAKEIA    GKYYYLPNAS+
Sbjct  678  DTENQFVSTGFAKEIATAGAGKYYYLPNASE  708



>ref|WP_019493900.1| magnesium-chelatase subunit ChlD [Calothrix sp. PCC 7103]
Length=681

 Score =   271 bits (694),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 174/215 (81%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q +RKV VE+ DMR+KR+ RKAGALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  461  QPNRKVVVEQGDMRSKRLVRKAGALVVFIVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  520

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+S+IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVGMNA+ SGD+
Sbjct  521  QISLIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGMNAQMSGDI  580

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++++VAITDGR NI L RS                 ++K E+L++AG+I   GM LLVI
Sbjct  581  GQVVLVAITDGRGNIPLSRSL------GEPQDPDRKPDIKAELLDIAGRIRALGMQLLVI  634

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTE+KFVSTGFAKE+A ++ GKYY+LP A+D  I+
Sbjct  635  DTESKFVSTGFAKELATVSGGKYYHLPKATDQAIA  669



>ref|WP_041780025.1| magnesium chelatase [Microcoleus sp. PCC 7113]
Length=682

 Score =   271 bits (693),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE  D+R+KR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  461  QPGRKVIVESGDIRSKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  520

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVGMNA+ SGD+
Sbjct  521  QVSLIPFRGEQAEVLLPPTRSIALARGRLERLPCGGGSPLAHGLTQAVRVGMNAKMSGDI  580

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++A +I   G+ LLVI
Sbjct  581  GQVVIVAITDGRGNIPLARSL------GEPMAEGEKPDIKAELLDIAARIRALGIQLLVI  634

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  635  DTENKFVSTGFAKELAKNAGGKYYHLPKATDRAIAA  670



>gb|AFZ18337.1| protoporphyrin IX magnesium-chelatase [Microcoleus sp. PCC 7113]
Length=692

 Score =   271 bits (693),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE  D+R+KR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  471  QPGRKVIVESGDIRSKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  530

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVGMNA+ SGD+
Sbjct  531  QVSLIPFRGEQAEVLLPPTRSIALARGRLERLPCGGGSPLAHGLTQAVRVGMNAKMSGDI  590

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++A +I   G+ LLVI
Sbjct  591  GQVVIVAITDGRGNIPLARSL------GEPMAEGEKPDIKAELLDIAARIRALGIQLLVI  644

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  645  DTENKFVSTGFAKELAKNAGGKYYHLPKATDRAIAA  680



>ref|WP_006670731.1| magnesium-chelatase subunit ChlD [Arthrospira maxima]
 gb|EDZ91982.1| magnesium chelatase ATPase subunit D [Arthrospira maxima CS-328]
Length=662

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+V VE+ D+R+KR+ARK+GALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRD VS
Sbjct  445  RRVVVEQGDIRSKRLARKSGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDMVS  504

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI+ A++RLER+PCGGGSPLAHGLT AVRVGMNA++SGD+G++
Sbjct  505  LIPFRGEQAEVLLPPTRSIAAAKRRLERMPCGGGSPLAHGLTQAVRVGMNAKQSGDIGQV  564

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+LE+A KI   G+ LLVIDTE
Sbjct  565  VIVAITDGRGNIPLARSLG------EPILEGEKPDIKGELLEIAAKIRGLGIQLLVIDTE  618

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  619  NKFVSTGFAKELAKTAGGKYYHLPKATDQAIAA  651



>ref|WP_006624555.1| magnesium-chelatase subunit ChlD [Arthrospira platensis]
 gb|EKD07397.1| magnesium chelatase ATPase subunit D [Arthrospira platensis C1]
Length=662

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+V VE+ D+R+KR+ARK+GALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRD VS
Sbjct  445  RRVVVEQGDIRSKRLARKSGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDMVS  504

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI+ A++RLER+PCGGGSPLAHGLT AVRVGMNA++SGD+G++
Sbjct  505  LIPFRGEQAEVLLPPTRSIAAAKRRLERMPCGGGSPLAHGLTQAVRVGMNAKQSGDIGQV  564

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+LE+A KI   G+ LLVIDTE
Sbjct  565  VIVAITDGRGNIPLARSLG------EPILEGEKPDIKGELLEIAAKIRGLGIQLLVIDTE  618

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  619  NKFVSTGFAKELAKTAGGKYYHLPKATDQAIAA  651



>ref|WP_012408069.1| magnesium-chelatase subunit ChlD [Nostoc punctiforme]
 gb|ACC80048.1| magnesium chelatase ATPase subunit D [Nostoc punctiforme PCC 
73102]
Length=676

 Score =   270 bits (691),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE++D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  455  QPDRKVIVEQSDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  514

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+
Sbjct  515  QIALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDI  574

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++++VAITDGR NI L RS                 ++K E+LE+A +I   GM LLVI
Sbjct  575  GQVVLVAITDGRGNIPLARSL------GEQIEPGEKPDIKGELLEIAARIRALGMQLLVI  628

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+++ A GKYY+LP A+D  I+A
Sbjct  629  DTESKFVSTGFAKELSQTAGGKYYHLPKATDQAIAA  664



>ref|WP_008051164.1| magnesium-chelatase subunit ChlD [Arthrospira sp. PCC 8005]
 emb|CCE16838.1| Magnesium-chelatase 60 kDa subunit (Mg-protoporphyrin IX chelatase) 
(Mg-chelatase subunit D) [Arthrospira sp. PCC 8005]
 emb|CDM96359.1| Magnesium-chelatase 60 kDa subunit (Mg-protoporphyrin IX chelatase) 
(Mg-chelatase subunit D) [Arthrospira sp. PCC 8005]
Length=664

 Score =   270 bits (691),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+V VE+ D+R+KR+ARK+GALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y SRD VS
Sbjct  447  RRVVVEQGDIRSKRLARKSGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQSRDMVS  506

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI+ A++RLER+PCGGGSPLAHGLT AVRVGMNA++SGD+G++
Sbjct  507  LIPFRGEQAEVLLPPTRSIAAAKRRLERMPCGGGSPLAHGLTQAVRVGMNAKQSGDIGQV  566

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+LE+A KI   G+ LLVIDTE
Sbjct  567  VIVAITDGRGNIPLARSLG------EPILEGEKPDIKGELLEIAAKIRGLGIQLLVIDTE  620

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  621  NKFVSTGFAKELAKTAGGKYYHLPKATDQAIAA  653



>ref|WP_037221118.1| magnesium chelatase [Richelia intracellularis]
 emb|CDN14055.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis]
Length=676

 Score =   270 bits (691),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKV VE+ D+R+KR+ARKAGALVIF+VDASGSMALNRMQ+AKGA ++LL E+Y SRDQV+
Sbjct  459  RKVIVEQGDIRSKRLARKAGALVIFLVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVA  518

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++AR+RLE LPCGGGSPLAHGLT AVRVG+NA+ SGDVG+I
Sbjct  519  LIPFRGEDAEVLLPPTRSIALARQRLETLPCGGGSPLAHGLTQAVRVGLNAQMSGDVGQI  578

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
             IVAITDGR NI L RS                 ++K E+LE+AG+I   G+ LLVIDTE
Sbjct  579  AIVAITDGRGNIPLSRS------LGEPQEPGEKPDIKGELLEIAGRIRSLGIQLLVIDTE  632

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKE+AK A GKYY+LP A+D  I++
Sbjct  633  SKFVSTGFAKELAKTAGGKYYHLPKATDTAIAS  665



>ref|WP_015165944.1| protoporphyrin IX magnesium-chelatase [Pseudanabaena sp. PCC 
7367]
 gb|AFY70988.1| protoporphyrin IX magnesium-chelatase [Pseudanabaena sp. PCC 
7367]
Length=683

 Score =   271 bits (692),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 170/212 (80%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKV VE  DMR+K MARKAGAL++FVVDASGSMALNRMQ+AKG+ L+LL E+Y SRDQVS
Sbjct  466  RKVIVESYDMRSKLMARKAGALIVFVVDASGSMALNRMQSAKGSVLRLLTEAYQSRDQVS  525

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSI  ARKRL++LPCGGGSPLAHGLT AVRVG+NA++SGDVG++
Sbjct  526  LIPFRGEQADVLLPPTRSIEAARKRLDQLPCGGGSPLAHGLTQAVRVGINAQQSGDVGQV  585

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            MIVAITDGR NISL RS                  +K+E+L++A KI   G+SLLVIDTE
Sbjct  586  MIVAITDGRGNISLARSLGETIDPEHKP------NIKEELLDIAKKIRGLGLSLLVIDTE  639

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            NKFVSTGFAKE+A  A G YY+LP A+D  I+
Sbjct  640  NKFVSTGFAKELANAAMGTYYHLPKATDEAIT  671



>ref|WP_017741312.1| magnesium-chelatase subunit ChlD [Scytonema hofmanni]
Length=740

 Score =   272 bits (695),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 174/213 (82%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            ++VFVE++D+R+KR+ RKAGALVIF+VDASGSMALNRMQ+AKGA ++LL E+Y +RDQV+
Sbjct  522  KRVFVEQSDIRSKRLVRKAGALVIFIVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVA  581

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G++
Sbjct  582  LIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQV  641

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+L++A +I   GM LLVIDTE
Sbjct  642  VIVAITDGRGNIPLSRS------LGETQEPGQKPDIKAELLDIAARIRALGMQLLVIDTE  695

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  696  SKFVSTGFAKELAKNAGGKYYHLPKATDKAIAA  728



>ref|WP_026721783.1| magnesium chelatase [Fischerella sp. PCC 9431]
Length=696

 Score =   271 bits (692),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 175/214 (82%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             ++VF+E+ D+R+KR+ARKAGALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  478  QKRVFIEQGDIRSKRLARKAGALVVFIVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQV  537

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G+
Sbjct  538  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQ  597

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS      A          ++K E+L++A +I   GM LLVIDT
Sbjct  598  VVLVAITDGRGNIPLSRSLGEPQEAGEKP------DIKAELLDIAARIRALGMQLLVIDT  651

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKEIAK A GKYY+LP ASD  I+A
Sbjct  652  ESKFVSTGFAKEIAKTAGGKYYHLPKASDKAIAA  685



>gb|KIY99567.1| magnesium chelatase subunit D [Monoraphidium neglectum]
Length=262

 Score =   258 bits (659),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            ++ R+V++++ D+RAKR++RKAGALV+FVVDASGSMA+NRM  AKGA L+LL ESYT RD
Sbjct  36   EEPRRVYIDQDDLRAKRLSRKAGALVLFVVDASGSMAINRMAAAKGACLQLLGESYTCRD  95

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPF GD AEVLLPPSRS+++AR+RLE LPCGGGSPLAH L+ A+R G+ A+  GDV
Sbjct  96   QVSLIPFFGDKAEVLLPPSRSVTLARRRLEALPCGGGSPLAHALSLAIRTGLQAKAMGDV  155

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            GRI  V ITDGRANISL RS D   A + DAPRPS+++L++E+L++A K+  A ++LLVI
Sbjct  156  GRITAVLITDGRANISLARSNDEPEALAPDAPRPSSEQLREEVLDMARKMAAANINLLVI  215

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPN  167
            DTENKFV +GFA EIA+ AQG Y+YLPN
Sbjct  216  DTENKFVGSGFAHEIAEAAQGHYHYLPN  243



>gb|KIE06603.1| magnesium chelatase [Tolypothrix bouteillei VB521301]
Length=698

 Score =   271 bits (692),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            ++VFVE+ D+R+KR+ RKAGALVIF+VDASGSMALNRMQ+AKGA ++LL E+Y +RDQV+
Sbjct  480  KRVFVEQGDIRSKRLVRKAGALVIFIVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVA  539

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G++
Sbjct  540  LIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQV  599

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+L++A +I   GM LLVIDTE
Sbjct  600  VIVAITDGRGNIPLSRSLGEPQEPGQKP------DIKAELLDIAARIRAVGMQLLVIDTE  653

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  654  SKFVSTGFAKELAKNAGGKYYHLPKATDKAIAA  686



>ref|WP_006196704.1| magnesium-chelatase subunit ChlD [Nodularia spumigena]
 gb|EAW45151.1| Mg chelatase subunit [Nodularia spumigena CCY9414]
 gb|AHJ28910.1| Protoporphyrin IX Mg-chelatase subunit D [Nodularia spumigena 
CCY9414]
Length=680

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q ++KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  459  QPNKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  518

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+
Sbjct  519  QVALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGVNAQMSGDI  578

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+LE+A +I   GM LLVI
Sbjct  579  GQVVIVAITDGRGNIPLARSLGEPLEPGEKP------DIKAELLEIAARIRALGMQLLVI  632

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+++ A GKYY+LP ASD  I+A
Sbjct  633  DTESKFVSTGFAKELSQTAAGKYYHLPKASDKTIAA  668



>ref|WP_026104071.1| magnesium chelatase [Anabaena sp. PCC 7108]
Length=674

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  452  QPDKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  511

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  512  QVSLIPFRGEQAEVLLPPTRSIALAKNRLERLPCGGGSPLAHGLTQAVRVGVNAQMGGDI  571

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++AG+I  +GM LLVI
Sbjct  572  GQVVIVAITDGRGNIPLARS------LGEPIEPGEKPDIKAELLDIAGRIRASGMQLLVI  625

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  626  DTESKFVSTGFAKELAKSAGGKYYHLPKATDKAIAA  661



>ref|WP_015080654.1| magnesium chelatase ATPase subunit [Anabaena sp. 90]
 gb|AFW95500.1| magnesium chelatase ATPase subunit [Anabaena sp. 90]
Length=674

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  453  QPDKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  512

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  513  QVSLIPFRGEQAEVLLPPTRSIALAKNRLERLPCGGGSPLAHGLTQAVRVGINAQMGGDI  572

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++AG+I  +GM LLVI
Sbjct  573  GQVVIVAITDGRGNIPLARSLGEPMEPGEKP------DIKAELLDIAGRIRASGMQLLVI  626

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE++K A GKYY+LP A+D  I+A
Sbjct  627  DTESKFVSTGFAKELSKTAGGKYYHLPKATDKAIAA  662



>ref|WP_009631867.1| magnesium chelatase ATPase subunit D [Synechocystis sp. PCC 7509]
Length=651

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  ++V VE++D+R KR+ RKAGAL++FVVDASGSMALNRMQ+AKGA L+LL E+Y +RD
Sbjct  430  QPDKRVIVEQSDVRVKRLVRKAGALIVFVVDASGSMALNRMQSAKGAVLRLLTEAYENRD  489

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+S+IPFRG+ AEVLLPP+RSIS A+KRLER+PCGGGSPLAHGLT AVRVG NA+ SGD+
Sbjct  490  QISLIPFRGEQAEVLLPPTRSISAAKKRLERMPCGGGSPLAHGLTQAVRVGTNAQMSGDI  549

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NISL RS                 ++K E+L +A +I   GM LLVI
Sbjct  550  GQVVIVAITDGRGNISLSRS------LGEPLAEGEKPDIKGELLNIAARIRALGMQLLVI  603

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKF+STGFAKE+A  + GKYY+LP A+D+ I++
Sbjct  604  DTENKFISTGFAKELATTSGGKYYHLPKATDSAIAS  639



>ref|WP_017310168.1| magnesium-chelatase subunit ChlD [Fischerella sp. PCC 9339]
Length=677

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             ++VF+E+ D+R+KR+ARKAGALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  459  QKRVFIEQGDVRSKRLARKAGALVVFIVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQV  518

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G+
Sbjct  519  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQ  578

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS                 ++K E+L++A +I   GM LLVIDT
Sbjct  579  VVLVAITDGRGNIPLSRSLGEPQEPGEKP------DIKAELLDIAARIRALGMQLLVIDT  632

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKEIAK A GKYY+LP A+D  I+A
Sbjct  633  ESKFVSTGFAKEIAKTAGGKYYHLPKATDKAIAA  666



>ref|WP_044450019.1| magnesium chelatase [Mastigocladus laminosus]
 gb|KIY12987.1| magnesium chelatase [Mastigocladus laminosus UU774]
Length=677

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             ++VF+E+ D+R+KR+ARKAGALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  459  QKRVFIEQGDVRSKRLARKAGALVVFIVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQV  518

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G+
Sbjct  519  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQ  578

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS                 ++K E+L++A +I   GM LLVIDT
Sbjct  579  VVLVAITDGRGNIPLSRSLGEPQEPGEKP------DIKAELLDIAARIRALGMQLLVIDT  632

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKEIAK A GKYY+LP A+D  I+A
Sbjct  633  ESKFVSTGFAKEIAKTAGGKYYHLPKATDKAIAA  666



>ref|WP_026103229.1| magnesium chelatase [Pseudanabaena sp. PCC 6802]
Length=666

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               RKV VE  DMRAKR+ARKAGALV+FVVDASGSMALNRMQ+AKGA L+LL E+Y +RD
Sbjct  446  HPDRKVIVENVDMRAKRLARKAGALVVFVVDASGSMALNRMQSAKGAVLRLLTEAYQNRD  505

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+++IPFRG+ AEVLLPP+RSI  AR+RL+ LPCGGGSPLAHGLT AVRVG+NA++SGDV
Sbjct  506  QIALIPFRGERAEVLLPPTRSIEAARRRLDLLPCGGGSPLAHGLTQAVRVGLNAQQSGDV  565

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++M+VAITDGR NI L RS          A      ++K E+L++A KI   G+SLLVI
Sbjct  566  GQVMLVAITDGRGNIPLSRSL------GEPADPNIKPDIKAELLDIAKKIRVLGLSLLVI  619

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKE+A+ A GKYY+LP A+DA I+A
Sbjct  620  DTENKFVSTGFAKELAQNAGGKYYHLPKATDAAIAA  655



>ref|WP_009784151.1| magnesium-chelatase subunit ChlD [Lyngbya sp. PCC 8106]
 gb|EAW37169.1| Mg chelatase subunit [Lyngbya sp. PCC 8106]
Length=664

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  R+V VE  D+RAK +ARK+GALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y  RD
Sbjct  444  QPDRQVIVESGDIRAKLLARKSGALVVFLVDASGSMALNRMQSAKGAVMQLLTEAYQGRD  503

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI+ A++RLER+PCGGGSPLAHGLT AVRVGMNA++SGD+
Sbjct  504  QVALIPFRGEQAEVLLPPTRSIAAAKRRLERMPCGGGSPLAHGLTQAVRVGMNAKQSGDI  563

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+LE+A KI   G+ LLV+
Sbjct  564  GQVVIVAITDGRGNIPLARSL------GEPILDEKKPDIKGELLEIAAKIRGLGIQLLVV  617

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  618  DTENKFVSTGFAKELAKTAGGKYYHLPKATDQAIAA  653



>ref|WP_015137423.1| magnesium chelatase ATPase subunit D [Nostoc sp. PCC 7524]
 gb|AFY46967.1| magnesium chelatase ATPase subunit D [Nostoc sp. PCC 7524]
Length=679

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  458  HPDKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  517

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVR+G+NA+ SGDV
Sbjct  518  QVALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRIGINAQMSGDV  577

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+LE+AG++   GM LLVI
Sbjct  578  GQVVIVAITDGRGNIPLSRSLGEPQEPGEKP------DIKGELLEIAGRMRALGMQLLVI  631

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK + GKYY+LP A+D  I+A
Sbjct  632  DTESKFVSTGFAKELAKTSGGKYYHLPKATDKAIAA  667



>ref|WP_016860550.1| magnesium-chelatase subunit ChlD [Fischerella muscicola]
Length=677

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             ++VF+E+ D+R+KR+ARKAGALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  459  QKRVFIEQGDIRSKRLARKAGALVVFIVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQV  518

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G+
Sbjct  519  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQ  578

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS                 ++K E+L++A +I   GM LLVIDT
Sbjct  579  VVLVAITDGRGNIPLSRSLGEPQEPGEKP------DIKAELLDIAARIRALGMQLLVIDT  632

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKEIAK A GKYY+LP A+D  I+A
Sbjct  633  ESKFVSTGFAKEIAKTAGGKYYHLPKATDKAIAA  666



>ref|WP_023065348.1| magnesium chelatase ATPase subunit D [Lyngbya aestuarii]
 gb|ERT08526.1| magnesium chelatase ATPase subunit D [Lyngbya aestuarii BL J]
Length=662

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  R+V VE  D+RAK +ARK+GALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y  RD
Sbjct  442  QPDRQVIVESGDIRAKLLARKSGALVVFLVDASGSMALNRMQSAKGAVMQLLTEAYQGRD  501

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI+ A++RLER+PCGGGSPLAHGLT AVRVGMNA++SGD+
Sbjct  502  QVALIPFRGEQAEVLLPPTRSIAAAKRRLERMPCGGGSPLAHGLTQAVRVGMNAKQSGDI  561

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+LE+A KI   G+ LLV+
Sbjct  562  GQVVIVAITDGRGNIPLARSL------GEPILDGEKPDIKGELLEIAAKIRGLGIQLLVV  615

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  616  DTENKFVSTGFAKELAKTAGGKYYHLPKATDQAIAA  651



>ref|WP_015204373.1| protoporphyrin IX magnesium-chelatase [Crinalium epipsammum]
 gb|AFZ14268.1| protoporphyrin IX magnesium-chelatase [Crinalium epipsammum PCC 
9333]
Length=683

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 174/215 (81%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q +RKV VE+ D+R KR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  462  QPNRKVIVEQGDIRGKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMRLLTEAYQNRD  521

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVGMNA+ SGDV
Sbjct  522  QVALIPFRGEQAEVLLPPTRSIALAKSRLERLPCGGGSPLAHGLTQAVRVGMNAQMSGDV  581

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS           P     ++K E+L++A K+   G+ LLVI
Sbjct  582  GQVVIVAITDGRGNIPLARSL------GEPIPEGEKPDIKAELLDIATKVRGVGIQLLVI  635

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTENKF+STGFAKE+AK A GKYY+LP A+D  I+
Sbjct  636  DTENKFISTGFAKELAKQAGGKYYHLPKATDQAIA  670



>ref|WP_015216626.1| protoporphyrin IX magnesium-chelatase [Anabaena cylindrica]
 gb|AFZ60010.1| protoporphyrin IX magnesium-chelatase [Anabaena cylindrica PCC 
7122]
Length=673

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  452  QPDKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  511

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  512  QVSLIPFRGEQAEVLLPPTRSIALAKNRLERLPCGGGSPLAHGLTQAVRVGVNAQMGGDI  571

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++AG+I  +GM LLVI
Sbjct  572  GQVVIVAITDGRGNIPLARSL------GEPIEPGEKPDIKAELLDIAGRIRASGMQLLVI  625

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE++K A GKYY+LP A+D  I+A
Sbjct  626  DTESKFVSTGFAKELSKAAGGKYYHLPKATDKAIAA  661



>ref|WP_006101723.1| magnesium-chelatase subunit ChlD [Coleofasciculus chthonoplastes]
 gb|EDX74903.1| magnesium chelatase ATPase subunit D [Coleofasciculus chthonoplastes 
PCC 7420]
Length=676

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q +RKV VE  DMR+KR+ARKAGALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  455  QPNRKVIVESGDMRSKRLARKAGALVVFLVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  514

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI++AR RL+RLPCGGGSPLAHGLT AVRVG NA+ SGD+
Sbjct  515  QVSLIPFRGEQAEVLLPPTRSIALARGRLDRLPCGGGSPLAHGLTQAVRVGTNAKMSGDI  574

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+I+IVAITDGR NI L RS                 ++K E+LE+A +I   G+ LLVI
Sbjct  575  GQIVIVAITDGRGNIPLARSLGEPIPEGEKP------DIKGELLEIAARIRAMGIQLLVI  628

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKFVSTGFAKE+AK A GKYY+LP A+D  I++
Sbjct  629  DTENKFVSTGFAKELAKQAGGKYYHLPKATDKAIAS  664



>ref|WP_015115743.1| protoporphyrin IX magnesium-chelatase [Nostoc sp. PCC 7107]
 gb|AFY45555.1| protoporphyrin IX magnesium-chelatase [Nostoc sp. PCC 7107]
Length=679

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q ++KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  458  QPNKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  517

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVG+NA  SGD+
Sbjct  518  QVALIPFRGEQAEVLLPPTRSIALAKNRLERLPCGGGSPLAHGLTQAVRVGLNARMSGDI  577

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++++VAITDGR NI L RS                 ++K E+LE+AG+    GM LLVI
Sbjct  578  GQVVVVAITDGRGNIPLARSLGEPQEPGEKP------DIKGELLEIAGRFRALGMQLLVI  631

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+A+ A GKYY+LP A+D  I+A
Sbjct  632  DTESKFVSTGFAKELAQTAGGKYYHLPKATDKAIAA  667



>ref|WP_028082200.1| magnesium chelatase [Dolichospermum circinale]
Length=674

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  453  QPDKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  512

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  513  QVSLIPFRGEQAEVLLPPTRSIALAKNRLERLPCGGGSPLAHGLTQAVRVGINAQMGGDI  572

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI+L RS                 ++K E+L++A +I  +GM LLVI
Sbjct  573  GQVVIVAITDGRGNITLARS------LGEPMEPGEKPDIKAELLDIAARIRASGMQLLVI  626

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE++K A GKYY+LP A+D  I+A
Sbjct  627  DTESKFVSTGFAKELSKTAGGKYYHLPKATDKAIAA  662



>ref|WP_009457764.1| MULTISPECIES: magnesium-chelatase subunit ChlD [Fischerella]
 gb|EHC12289.1| magnesium chelatase ATPase subunit D [Fischerella sp. JSC-11]
Length=678

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             ++V++E+ D+R+KR+ARKAGALVIF+VDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  460  QKRVYIEQGDIRSKRLARKAGALVIFIVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQV  519

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G+
Sbjct  520  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQ  579

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS                 ++K E+L++A +I   GM LLVIDT
Sbjct  580  VVLVAITDGRGNIPLSRSLGEPQEPGEKP------DIKAELLDIAARIRALGMQLLVIDT  633

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKEIAK A GKYY+LP A+D  I+A
Sbjct  634  ESKFVSTGFAKEIAKTAGGKYYHLPKATDKAIAA  667



>ref|WP_017660572.1| magnesium-chelatase subunit ChlD [Geitlerinema sp. PCC 7105]
Length=686

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 171/213 (80%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+V VE++D+R+KR+ RKAGALV+F+VDASGSMALNRMQ+AKGA ++LL E+Y SRDQVS
Sbjct  469  RRVIVEQSDLRSKRLVRKAGALVVFLVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQVS  528

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI+ AR+RLERLPCGGGSPLAHGLT AVRV +NA++SGDVG+ 
Sbjct  529  LIPFRGEQAEVLLPPTRSITQARRRLERLPCGGGSPLAHGLTQAVRVCVNAQQSGDVGQA  588

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
             IVAITDGR NI L RS                 ++K E+LE+AGKI    + LLVIDTE
Sbjct  589  AIVAITDGRGNIPLARSL------GEPMEPGEKPDIKKELLEIAGKIRALSIQLLVIDTE  642

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKE+AK A GKYY+LP ASD  I+A
Sbjct  643  SKFVSTGFAKELAKQAGGKYYHLPKASDQTIAA  675



>ref|WP_026733423.1| magnesium chelatase [Fischerella sp. PCC 9605]
Length=676

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 173/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            +KV +E+ D+R+KRMARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV+
Sbjct  458  KKVIIEQGDIRSKRMARKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVA  517

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G++
Sbjct  518  LIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQV  577

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+L++A +I   GM LLVIDTE
Sbjct  578  VIVAITDGRGNIPLARSLGEPQEPGEKP------DIKAELLDIAARIRALGMQLLVIDTE  631

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKEIAK + GKYY+LP A+D  I+A
Sbjct  632  SKFVSTGFAKEIAKTSGGKYYHLPKATDQAIAA  664



>ref|WP_039200580.1| magnesium chelatase [Aphanizomenon flos-aquae]
 gb|KHG42395.1| magnesium chelatase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=673

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  452  QPGKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  511

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+S+IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  512  QISLIPFRGEQAEVLLPPTRSIALAKNRLERLPCGGGSPLAHGLTQAVRVGINAQMGGDI  571

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++A +I  +GM LLVI
Sbjct  572  GQVVIVAITDGRGNIPLARSLGETIEPGEKP------DIKAELLDIAARIRASGMQLLVI  625

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  626  DTESKFVSTGFAKELAKTAGGKYYHLPKATDKAIAA  661



>ref|WP_015197436.1| protoporphyrin IX magnesium-chelatase [Calothrix parietina]
 gb|AFZ00789.1| protoporphyrin IX magnesium-chelatase [Calothrix sp. PCC 6303]
Length=675

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q +RKV VE  DMRAKR+ RKAGAL+IF+VDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  454  QPNRKVVVEPGDMRAKRLVRKAGALIIFLVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  513

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI+MA+ RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+
Sbjct  514  QVSLIPFRGEQAEVLLPPTRSIAMAKNRLERLPCGGGSPLAHGLTQAVRVGVNAQMSGDI  573

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS              +  ++K E+L++A +I   GM LLVI
Sbjct  574  GQVVIVAITDGRGNIPLSRSL------GEPQDPDNKPDIKAELLDIAARIRAMGMQLLVI  627

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK + GKYY+LP A++  I+A
Sbjct  628  DTESKFVSTGFAKELAKTSGGKYYHLPKATEQAIAA  663



>ref|WP_042342578.1| magnesium chelatase [Calothrix sp. PCC 7507]
Length=676

 Score =   268 bits (685),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            ++KV VE+ D+RAKR+ RKAGALVIFVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  457  NKKVIVEQGDIRAKRLVRKAGALVIFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQV  516

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G+
Sbjct  517  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQ  576

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS   +             ++K E+LE+A +I   G+ LLVIDT
Sbjct  577  VVLVAITDGRGNIPLARSLGEQLEPGEKP------DIKAELLEIAARIRALGIQLLVIDT  630

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKE+A+ A GKYY+LP ASD  I+A
Sbjct  631  ESKFVSTGFAKELAQTAAGKYYHLPKASDKAIAA  664



>ref|WP_016864776.1| magnesium-chelatase subunit ChlD [Fischerella muscicola]
Length=677

 Score =   268 bits (685),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 173/214 (81%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             ++V++E+ D+R+KR+ARKAGALVIF+VDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  459  QKRVYIEQGDIRSKRLARKAGALVIFIVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQV  518

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G+
Sbjct  519  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQ  578

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS                 ++K E+L +A +I   GM LLVIDT
Sbjct  579  VVLVAITDGRGNIPLSRSLGEPQEPGEKP------DIKAELLNIAARIRALGMQLLVIDT  632

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKEIAK A GKYY+LP A+D  I+A
Sbjct  633  ESKFVSTGFAKEIAKTAGGKYYHLPKATDKAIAA  666



>ref|WP_027404926.1| magnesium chelatase [Aphanizomenon flos-aquae]
Length=673

 Score =   268 bits (685),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  452  QPGKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  511

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+S+IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  512  QISLIPFRGEQAEVLLPPTRSIALAKNRLERLPCGGGSPLAHGLTQAVRVGINAQMGGDI  571

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++A +I  +GM LLVI
Sbjct  572  GQVVIVAITDGRGNIPLARSLGETIEPGEKP------DIKAELLDIAARIRASGMQLLVI  625

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  626  DTESKFVSTGFAKELAKTAGGKYYHLPKATDKAIAA  661



>gb|AFY36234.1| protoporphyrin IX magnesium-chelatase [Calothrix sp. PCC 7507]
Length=679

 Score =   268 bits (685),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 174/214 (81%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            ++KV VE+ D+RAKR+ RKAGALVIFVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  460  NKKVIVEQGDIRAKRLVRKAGALVIFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQV  519

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G+
Sbjct  520  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQ  579

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS   +             ++K E+LE+A +I   G+ LLVIDT
Sbjct  580  VVLVAITDGRGNIPLARSLGEQLEPGEKP------DIKAELLEIAARIRALGIQLLVIDT  633

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKE+A+ A GKYY+LP ASD  I+A
Sbjct  634  ESKFVSTGFAKELAQTAAGKYYHLPKASDKAIAA  667



>ref|WP_015186804.1| protoporphyrin IX magnesium-chelatase [Gloeocapsa sp. PCC 7428]
 gb|AFZ28927.1| protoporphyrin IX magnesium-chelatase [Gloeocapsa sp. PCC 7428]
Length=670

 Score =   268 bits (684),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q +RKV VE+ D+RAKR+ RKAGALV+FVVDASGSMALNRMQ AKGA ++LL E+Y +RD
Sbjct  449  QPNRKVIVEQGDIRAKRLVRKAGALVVFVVDASGSMALNRMQAAKGAVMRLLTEAYENRD  508

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI+ AR+RLERLPCGGGSPLAHGLT AVR G NA+ SGD+
Sbjct  509  QVALIPFRGEQAEVLLPPTRSIAAARRRLERLPCGGGSPLAHGLTQAVRAGTNAQMSGDI  568

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGRANI L RS                 ++K E+L++A +I   GM LLVI
Sbjct  569  GQVVIVAITDGRANIPLSRSLGEPQIEGEKP------DIKGELLDIAARIRALGMQLLVI  622

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KF+STGFAKE+A+ A GKYY+LP A+D  I+A
Sbjct  623  DTESKFISTGFAKELAQKAGGKYYHLPKATDQAIAA  658



>ref|WP_028089282.1| magnesium chelatase [Dolichospermum circinale]
Length=674

 Score =   268 bits (684),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  453  QPDKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  512

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ AEVLLPP+RSI++A+ RLERLPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  513  QVSLIPFRGEQAEVLLPPTRSIALAKNRLERLPCGGGSPLAHGLTQAVRVGINAQMGGDI  572

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++A +I  +GM LLVI
Sbjct  573  GQVVIVAITDGRGNIPLARS------LGEPIEPGEKPDIKAELLDIAARIRASGMQLLVI  626

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE++K A GKYY+LP A+D  I+A
Sbjct  627  DTESKFVSTGFAKELSKTAGGKYYHLPKATDKAIAA  662



>ref|WP_011319823.1| magnesium-chelatase subunit ChlD [Anabaena variabilis]
 gb|ABA22693.1| protoporphyrin IX magnesium-chelatase [Anabaena variabilis ATCC 
29413]
Length=678

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  457  QPDKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  516

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+  GDV
Sbjct  517  QVALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGVNAQMGGDV  576

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++A +I   GM LLVI
Sbjct  577  GQVVIVAITDGRGNIPLSRS------LGEPQESGEKPDIKAELLDIAARIRALGMQLLVI  630

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK + GKYY+LP A+D  I+A
Sbjct  631  DTESKFVSTGFAKELAKTSGGKYYHLPKATDKAIAA  666



>ref|XP_002508833.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70091.1| predicted protein [Micromonas sp. RCC299]
Length=759

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            +KV+VEK+DMRAK++ARK+GAL+IF+VDASGSMALNRM  AKGAAL LL ++Y SRD VS
Sbjct  535  KKVYVEKSDMRAKKLARKSGALIIFLVDASGSMALNRMNAAKGAALSLLEDAYQSRDMVS  594

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            IIPFRGD+AEVLLPPSRSI+MAR RL+ +PCGGGSPLAHGL+ A RVG+NA  SGDVGR+
Sbjct  595  IIPFRGDAAEVLLPPSRSIAMARNRLDTMPCGGGSPLAHGLSLAARVGINAMSSGDVGRV  654

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            M+V +TDGRANIS+ +S         +A +P+A EL++E+ ++AG++Y AGM+LLVIDTE
Sbjct  655  MVVCLTDGRANISINKSNGEPEYIGPEAIKPTADELQEEVDDMAGRLYAAGMNLLVIDTE  714

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASD  158
            NKFVS+G A+++A+ A GKYYYLPN +D
Sbjct  715  NKFVSSGTAEKLAQKALGKYYYLPNGTD  742



>ref|WP_040553567.1| magnesium chelatase [Raphidiopsis brookii]
Length=667

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  ++V VE+ DMR KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL ESY +RD
Sbjct  447  QPGKRVIVEQGDMRTKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTESYQNRD  506

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+++IPFRG+ AEVLLPP+RSI++A+ RLE+LPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  507  QIALIPFRGEQAEVLLPPTRSIALAKNRLEKLPCGGGSPLAHGLTQAVRVGVNAQMGGDI  566

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++AG+I  +GM LLVI
Sbjct  567  GQVVIVAITDGRGNIPLSRSLGESPEPGEKP------DIKGELLDIAGRIRASGMQLLVI  620

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK A GKYY LP A+D  I+A
Sbjct  621  DTESKFVSTGFAKELAKTAGGKYYQLPKATDRAIAA  656



>ref|WP_017297332.1| hypothetical protein [Nodosilinea nodulosa]
Length=681

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 173/216 (80%), Gaps = 5/216 (2%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  R+V VE+ D+RAKR+ARKAG+L+IFVVDASGSMALNRMQ+AKGA L+LL E+Y +RD
Sbjct  459  EPGRRVIVEQGDIRAKRLARKAGSLIIFVVDASGSMALNRMQSAKGAVLELLTEAYQNRD  518

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI+MAR+RLER+PCGGGSPLAHGLT AVRVG+NA++SGDV
Sbjct  519  QVALIPFRGEQAEVLLPPTRSIAMARRRLERMPCGGGSPLAHGLTQAVRVGINAQQSGDV  578

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G ++IVAITDGR N+ L RS           P     ++K E+LE+AG+I   G  LL+I
Sbjct  579  GSVVIVAITDGRGNVPLARSL-----GEMPEPDAPKPDIKQELLEIAGRIRGVGYQLLII  633

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFVSTGF KE+AK A G+YY LP A+D  I+A
Sbjct  634  DTERKFVSTGFGKELAKTAGGRYYQLPKATDQAIAA  669



>ref|WP_006277092.1| magnesium-chelatase subunit ChlD [Cylindrospermopsis raciborskii]
 gb|EFA69910.1| Mg chelatase subunit [Cylindrospermopsis raciborskii CS-505]
Length=671

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  ++V VE+ DMR KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL ESY +RD
Sbjct  451  QPGKRVIVEQGDMRTKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTESYQNRD  510

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+++IPFRG+ AEVLLPP+RSI++A+ RLE+LPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  511  QIALIPFRGEQAEVLLPPTRSIALAKTRLEKLPCGGGSPLAHGLTQAVRVGVNAQMGGDI  570

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++AG+I  +GM LLVI
Sbjct  571  GQVVIVAITDGRGNIPLSRSLGESQEPGEKP------DIKGELLDIAGRIRASGMQLLVI  624

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK A GKYY LP A+D  I+A
Sbjct  625  DTESKFVSTGFAKELAKTAGGKYYQLPKATDRAIAA  660



>gb|EFA73344.1| Magnesium chelatase ATPase subunit D [Raphidiopsis brookii D9]
Length=669

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  ++V VE+ DMR KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL ESY +RD
Sbjct  449  QPGKRVIVEQGDMRTKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTESYQNRD  508

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+++IPFRG+ AEVLLPP+RSI++A+ RLE+LPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  509  QIALIPFRGEQAEVLLPPTRSIALAKNRLEKLPCGGGSPLAHGLTQAVRVGVNAQMGGDI  568

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++AG+I  +GM LLVI
Sbjct  569  GQVVIVAITDGRGNIPLSRSLGESPEPGEKP------DIKGELLDIAGRIRASGMQLLVI  622

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK A GKYY LP A+D  I+A
Sbjct  623  DTESKFVSTGFAKELAKTAGGKYYQLPKATDRAIAA  658



>ref|WP_017651554.1| magnesium-chelatase subunit ChlD [Microchaete sp. PCC 7126]
Length=673

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 173/214 (81%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            ++KV VE  D+RAKR+ RKAGALVIFVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  455  NKKVIVESGDIRAKRLVRKAGALVIFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQI  514

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+ SGD+G+
Sbjct  515  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQ  574

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS   +             ++K E+LE+A +I   G+ LLVIDT
Sbjct  575  VVLVAITDGRGNIPLARSLGEQLEPGEKP------DIKGELLEIAARIRALGIQLLVIDT  628

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKE+A+ A GKYY+LP ASD  I+A
Sbjct  629  ESKFVSTGFAKELAQTAAGKYYHLPKASDQAIAA  662



>ref|WP_017289571.1| magnesium-chelatase subunit ChlD [Leptolyngbya boryana]
Length=678

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 174/212 (82%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            ++VFVE++D+RAKR+ARKAGAL++FVVDASGSMALNRM  AKGA L+LL E+Y +RDQ+S
Sbjct  460  KRVFVEESDIRAKRLARKAGALIVFVVDASGSMALNRMNAAKGAVLRLLTEAYQNRDQIS  519

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI  A++RL+RLPCGGGSPLAHGLT AVRVG+NA++SGD+G++
Sbjct  520  LIPFRGEQAEVLLPPTRSIEAAKRRLDRLPCGGGSPLAHGLTQAVRVGLNAKQSGDIGQV  579

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS           P     ++K E+LE+A KI   G+ LLVIDTE
Sbjct  580  VIVAITDGRGNIPLARS------LGETLPEGEKPDIKGELLELAAKIRALGIQLLVIDTE  633

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            NKF+STGFAKE+AK A GKY++LP ASDA I+
Sbjct  634  NKFISTGFAKELAKQAGGKYHHLPKASDAAIA  665



>ref|WP_010994455.1| magnesium-chelatase subunit ChlD [Nostoc sp. PCC 7120]
 dbj|BAB77802.1| Mg chelatase subunit [Nostoc sp. PCC 7120]
Length=678

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  +KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  457  QPDKKVIVEQGDIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRD  516

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+NA+  GD+
Sbjct  517  QVALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGVNAQMGGDI  576

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++A +I   GM LLVI
Sbjct  577  GQVVIVAITDGRGNIPLSRS------LGEPQESGEKPDIKAELLDIAARIRALGMQLLVI  630

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK + GKYY+LP A+D  I+A
Sbjct  631  DTESKFVSTGFAKELAKTSGGKYYHLPKATDKAIAA  666



>ref|WP_008309117.1| magnesium chelatase ATPase subunit D [Leptolyngbya sp. PCC 6406]
Length=685

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 171/216 (79%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE+ D+RAK++ARKAGAL+IFVVDASGSMALNRMQ+AKGA L+LL E+Y +RD
Sbjct  464  QPHRKVVVEQGDIRAKKLARKAGALIIFVVDASGSMALNRMQSAKGAVLQLLTEAYQNRD  523

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI+MAR+RLER+PCGGGSPLAHGLT AVRVG NA++SGD+
Sbjct  524  QVALIPFRGEQAEVLLPPTRSIAMARRRLERMPCGGGSPLAHGLTQAVRVGTNAQQSGDI  583

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+L++A ++   G  L+VI
Sbjct  584  GKVVIVAITDGRGNIPLSRSL------GESGDPDQKPDIKQELLDLAARVRATGFQLVVI  637

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFVSTGF +E+AK A GKYY LP A+D  I+A
Sbjct  638  DTERKFVSTGFGRELAKTAGGKYYQLPKATDQAIAA  673



>ref|WP_009555513.1| Mg-chelatase subunit ChlI [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ70935.1| Mg-chelatase subunit ChlI [Oscillatoriales cyanobacterium JSC-12]
Length=718

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 175/213 (82%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            ++VFVE++D+RAKR+ARKAGALV+FVVDASGSMALNRM +AKGA L+LL E+Y +RDQVS
Sbjct  500  KRVFVEQSDIRAKRLARKAGALVVFVVDASGSMALNRMNSAKGAVLRLLTEAYQNRDQVS  559

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI  A++RL+R+PCGGGSPLAHGLT AVRVGMNA++SGD+G++
Sbjct  560  LIPFRGEQAEVLLPPTRSIEAAKRRLDRMPCGGGSPLAHGLTQAVRVGMNAQQSGDIGQV  619

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR N+ L +S           P     ++K E+L++AGKI   G  LLVIDTE
Sbjct  620  VIVAITDGRGNVPLAKSL------GEPIPDGEKPDIKAELLDIAGKIRAIGFQLLVIDTE  673

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            NKF+STGFAKE+AK A GKYY+LP A+D  I++
Sbjct  674  NKFISTGFAKELAKHAGGKYYHLPKATDQAIAS  706



>ref|WP_039739178.1| magnesium chelatase [Hassallia byssoidea]
Length=710

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 172/214 (80%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             ++VFVE+ D+R+KR+ RKAGALVIFVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  491  QKRVFVEQADIRSKRLVRKAGALVIFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQV  550

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGL+ AVRVG+NA+ SGD+G+
Sbjct  551  ALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLSQAVRVGLNAQMSGDIGQ  610

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR NI L RS                 ++K E+LE+A ++   GM LL+IDT
Sbjct  611  VVIVAITDGRGNIPLSRSLGEPQETGEKP------DIKAELLEIAARMRALGMQLLMIDT  664

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKE+A  + GKYY+LP A+D  I+A
Sbjct  665  ESKFVSTGFAKELAHTSGGKYYHLPKATDKAIAA  698



>ref|WP_027840190.1| magnesium chelatase [Mastigocoleus testarum]
Length=703

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 171/213 (80%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKV VE+ DMR+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV+
Sbjct  485  RKVIVEQADMRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVA  544

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++AR RLE LPCGGGSPLAHGLT AVRVG+NA  SGD+G++
Sbjct  545  LIPFRGEEAEVLLPPTRSIALARSRLETLPCGGGSPLAHGLTQAVRVGLNARMSGDIGQV  604

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            ++VAITDGR NISL RS                 ++K E+L++A KI  A + LLVIDTE
Sbjct  605  VVVAITDGRGNISLSRSLGEPQEPGQKP------DIKGELLDIAAKIRAARIQLLVIDTE  658

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKE+A+ A GKYY+LP A+D  I+A
Sbjct  659  SKFVSTGFAKELAQTASGKYYHLPKATDKAIAA  691



>ref|WP_015153650.1| protoporphyrin IX magnesium-chelatase [Chroococcidiopsis thermalis]
 gb|AFY87102.1| protoporphyrin IX magnesium-chelatase [Chroococcidiopsis thermalis 
PCC 7203]
Length=751

 Score =   267 bits (682),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 172/213 (81%), Gaps = 6/213 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             ++VFVE+ D+R+KR+ RKAGAL++FVVDASGSMALNRMQ+AKGA  +LL E+Y +RDQV
Sbjct  533  QKRVFVEQGDIRSKRLVRKAGALIVFVVDASGSMALNRMQSAKGAVFQLLTEAYENRDQV  592

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++ARKRLE LPCGGGSPLAHGLT AVRVGMNA+ +GD+G+
Sbjct  593  ALIPFRGEQAEVLLPPTRSIALARKRLELLPCGGGSPLAHGLTQAVRVGMNAQMAGDIGQ  652

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR NI L RS                 ++K E+LE+A +I   G+ LLVIDT
Sbjct  653  VVVVAITDGRGNIPLARSLGEPLPEGEKP------DIKKELLEIAARIRGLGIQLLVIDT  706

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            ENKF+STGFAKE+A+ A GKYY+LP A+D+ I+
Sbjct  707  ENKFISTGFAKELAQTAGGKYYHLPKATDSAIA  739



>ref|WP_015207701.1| protoporphyrin IX magnesium-chelatase [Cylindrospermum stagnale]
 gb|AFZ24447.1| protoporphyrin IX magnesium-chelatase [Cylindrospermum stagnale 
PCC 7417]
Length=678

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 176/223 (79%), Gaps = 13/223 (6%)
 Frame = -1

Query  790  QKSR-------KVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLA  632
            QKSR       KV VE+ D+R+KR+ RKAGALV+FVVDASGSMALNRMQ+AKGA ++LL 
Sbjct  450  QKSRRERNPGKKVIVEQADIRSKRLVRKAGALVVFVVDASGSMALNRMQSAKGAVMQLLT  509

Query  631  ESYTSRDQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMN  452
            E+Y +RDQV++IPFRG+ AEVLLPP+RSI++AR RLERLPCGGGSPLAHGLT AVRVG+N
Sbjct  510  EAYQNRDQVALIPFRGEQAEVLLPPTRSIALARNRLERLPCGGGSPLAHGLTQAVRVGVN  569

Query  451  AEKSGDVGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKA  272
            A+ SGD+G+++IVAITDGR NI L RS   +             ++K E+LE+A +I   
Sbjct  570  AQMSGDIGQVVIVAITDGRGNIPLARSLGEQLEPGEKP------DIKAELLEIAARIRAL  623

Query  271  GMSLLVIDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            G+ LLVIDTE+KFVSTGFAKE+A+ A GKYY+LP A++  I+A
Sbjct  624  GIQLLVIDTESKFVSTGFAKELAQTAGGKYYHLPKATEQAIAA  666



>emb|CCQ67554.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii 
WH 0402]
Length=344

 Score =   256 bits (654),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 168/212 (79%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQVS
Sbjct  128  RSVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVS  187

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+G++
Sbjct  188  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDIGQV  247

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L +S           P     ++K E+L++AGKI   G+ LL+IDTE
Sbjct  248  VIVAITDGRGNIPLAKSLG------EPIPEGEKPDIKQELLDIAGKIRALGIKLLMIDTE  301

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  302  KKFVSTGFGKEMAQTAGGTYYQLPRATDQAIA  333



>ref|WP_039715972.1| magnesium chelatase [Scytonema millei]
 gb|KIF18449.1| magnesium chelatase [Scytonema millei VB511283]
Length=720

 Score =   266 bits (680),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 173/214 (81%), Gaps = 6/214 (3%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            + ++VFVE+ D+R+KR+ RKAGAL++FVVDASGSMALNRMQ+AKGA  +LL E+Y +RDQ
Sbjct  501  RQKRVFVEQGDIRSKRLVRKAGALIVFVVDASGSMALNRMQSAKGAVFQLLTEAYENRDQ  560

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            V++IPFRG+ AEVLLPP+RSI++ARKRLE LPCGGGSPLAHGLT AVRVG+NA+ +GD+G
Sbjct  561  VALIPFRGEQAEVLLPPTRSIALARKRLELLPCGGGSPLAHGLTQAVRVGINAQMAGDIG  620

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            ++++VAITDGR NI L RS                 ++K E+LE+A +I   G+ LLVID
Sbjct  621  QVVVVAITDGRGNIPLARSLGEPLPEGEKP------DIKKELLEIAARIRGLGIQLLVID  674

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            TENKF+STGFAKE+A+ A GKYY+LP A+D+ I+
Sbjct  675  TENKFISTGFAKELAQTAGGKYYHLPKATDSAIA  708



>ref|WP_026099665.1| magnesium chelatase [Prochlorothrix hollandica]
Length=675

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 174/216 (81%), Gaps = 5/216 (2%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  R+V VE+ D+RAK++ RKAGALV+F+VDASGSMA+NRMQ+AKGA L+LL E+Y +RD
Sbjct  454  QPGRRVIVEEGDLRAKQLVRKAGALVVFLVDASGSMAVNRMQSAKGAVLRLLTEAYENRD  513

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+++IPFRG+ AEVLLPP+RSI+ ARKRLE++PCGGGSPLAHGLT AVRVG+NA +SGD+
Sbjct  514  QIALIPFRGEQAEVLLPPTRSITAARKRLEKMPCGGGSPLAHGLTQAVRVGLNAMQSGDI  573

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++++VAITDGR NISL RS                 ++K E+L++AG+I   G+ LLVI
Sbjct  574  GQVVVVAITDGRGNISLSRS-----LGQPVLEDDPKPDIKAELLDIAGRIRGLGIKLLVI  628

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKF+STGFAKE+A+ A G YY+LP A+D  I+A
Sbjct  629  DTENKFISTGFAKELAQRAGGVYYHLPKATDQAIAA  664



>ref|WP_008185168.1| magnesium-chelatase subunit ChlD [Moorea producens]
 gb|EGJ32175.1| protoporphyrin IX magnesium-chelatase [Moorea producens 3L]
Length=669

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 174/216 (81%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
              +R+V +E+ D+R+KR+ARKAG+LV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  448  HPNRRVIIEQGDLRSKRLARKAGSLVVFVVDASGSMALNRMQSAKGAVMQLLTEAYENRD  507

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ A+VLLPP+RSI++A++RLERLPCGGGSPLAHGLT AV VGMNA+ SGD+
Sbjct  508  QVSLIPFRGEQADVLLPPTRSIALAKRRLERLPCGGGSPLAHGLTQAVHVGMNAQLSGDI  567

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 ++K E+LE+A +I   G+ LLVI
Sbjct  568  GQVVIVAITDGRGNIPLARSLGEPLPEGEKP------DIKGELLEIAARIRANGVQLLVI  621

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE+KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  622  DTESKFVSTGFAKELAKQAGGKYYHLPKATDKAIAA  657



>ref|WP_035985411.1| magnesium chelatase [Leptolyngbya sp. KIOST-1]
Length=680

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 174/216 (81%), Gaps = 5/216 (2%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            + +RKV VE+ D+RAKR+ARKAG+L+IFVVDASGSMALNRMQ+AKGA L+LL E+Y +RD
Sbjct  458  EPNRKVVVEQGDIRAKRLARKAGSLIIFVVDASGSMALNRMQSAKGAVLELLTEAYQNRD  517

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI+MAR+RLER+ CGGGSPLAHGLT AVRVG+NA++SGDV
Sbjct  518  QVALIPFRGEQAEVLLPPTRSIAMARRRLERMACGGGSPLAHGLTQAVRVGVNAQQSGDV  577

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G ++IVAITDGR N+ L RS        +  P     ++K E+LE+AG+I   G  LL+I
Sbjct  578  GSVVIVAITDGRGNVPLARSLGEPPEPDAPKP-----DIKQELLEIAGRIRGVGYQLLII  632

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFVSTGF KE+AK A G+YY LP A+D  I+A
Sbjct  633  DTERKFVSTGFGKELAKTAGGRYYQLPKATDQAIAA  668



>ref|WP_015120155.1| protoporphyrin IX magnesium-chelatase [Rivularia sp. PCC 7116]
 gb|AFY56593.1| protoporphyrin IX magnesium-chelatase [Rivularia sp. PCC 7116]
Length=678

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 171/213 (80%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+RAKR+ARKAGALVIFVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV+
Sbjct  461  RNVIVEQGDIRAKRLARKAGALVIFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVA  520

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEV+LPP+RSI++AR RLE++PCGGGSPLAHGLT A  VG+NA++SGD+G++
Sbjct  521  LIPFRGEQAEVMLPPTRSITLARTRLEKMPCGGGSPLAHGLTQAAHVGLNAQRSGDIGQV  580

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K E+LEVA KI   G+ LLVIDTE
Sbjct  581  VIVAITDGRGNIPLSRSL------GEPQEPGEKPDIKGELLEVAAKIRALGIQLLVIDTE  634

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +KFVSTGFAKE+AK A GKYY+LP A+D  I+A
Sbjct  635  SKFVSTGFAKELAKNAGGKYYHLPKATDKAIAA  667



>ref|WP_039727978.1| MULTISPECIES: magnesium chelatase [Oscillatoriophycideae]
 gb|KIF15739.1| magnesium chelatase [Aphanocapsa montana BDHKU210001]
 gb|KIF40663.1| magnesium chelatase [Lyngbya confervoides BDU141951]
Length=683

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 171/216 (79%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  RKV VE+ DMRAK++AR+AG+L++FVVDASGSMALNRMQ+AKGA L+LL ++Y +RD
Sbjct  463  EPHRKVIVEQGDMRAKKLARRAGSLIVFVVDASGSMALNRMQSAKGAVLQLLNDAYQNRD  522

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            +V++IPFRG+ AEVLLPP+RSISMAR+RLER+PCGGGSPLAHGL+ AVR+G NA++SGD+
Sbjct  523  EVALIPFRGEQAEVLLPPTRSISMARRRLERMPCGGGSPLAHGLSQAVRIGTNAQQSGDI  582

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G ++IVAITDGR NI L RS                 ++K E+L++AG+I   G  LLVI
Sbjct  583  GNVVIVAITDGRGNIPLARS------LGETIDPEEKPDIKQELLDIAGRIRATGFQLLVI  636

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFVSTGF KE+AK A GKYY LP A+D  I++
Sbjct  637  DTERKFVSTGFGKELAKTAGGKYYQLPKATDQAIAS  672



>ref|WP_015194081.1| protoporphyrin IX magnesium-chelatase [Stanieria cyanosphaera]
 gb|AFZ36414.1| protoporphyrin IX magnesium-chelatase [Stanieria cyanosphaera 
PCC 7437]
Length=672

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 171/213 (80%), Gaps = 6/213 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +RKV VE+ D+RAKR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  456  NRKVIVEQGDIRAKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQV  515

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            S+IPFRG+ A+VLLPP+RSI+MAR RLE LPCGGGSPLAHGLT AV VGMNA+ SGD+G+
Sbjct  516  SLIPFRGERADVLLPPTRSITMARGRLESLPCGGGSPLAHGLTQAVHVGMNAQMSGDIGQ  575

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR NI L RS                 ++K E+LE+AGKI   GM LLVIDT
Sbjct  576  VVIVAITDGRGNIPLARSL------GEPLVEGEKPDIKGELLEIAGKIRALGMKLLVIDT  629

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            E+KFV+TGFAKE+AK A G YY+LP A+D  I+
Sbjct  630  ESKFVTTGFAKELAKQAGGTYYHLPKATDRAIA  662



>ref|WP_017304357.1| magnesium-chelatase subunit ChlD [Spirulina subsalsa]
Length=655

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 173/216 (80%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            + +RKV VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  439  EPNRKVIVEQGDLRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRD  498

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI++A+KRLE++PCGGGSPLAHGLT AV +GMNA+ SGD+
Sbjct  499  QVALIPFRGEQAEVLLPPTRSITLAKKRLEKMPCGGGSPLAHGLTQAVHIGMNAKMSGDI  558

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L +S   E             ++K E+LE+AG+I   G  LLVI
Sbjct  559  GQVVIVAITDGRGNIPLAKSLGDELPEGEKP------DIKGELLEIAGRIRSIGFQLLVI  612

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFVSTGF KEIAK A GKYY LP A+D  I++
Sbjct  613  DTEKKFVSTGFGKEIAKQAGGKYYQLPKATDQAIAS  648



>ref|WP_008227854.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis]
 emb|CCH65289.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis 
HM01]
Length=673

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            ++KV +E+ D+R+KR+ RKAG+L+IF+VDASGSMALNRMQ+AKGA ++LL E+Y SRDQV
Sbjct  455  NKKVIIEQGDIRSKRLVRKAGSLIIFLVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQV  514

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++ARKRLE LPCGGGSPLAHGLT AVR G+NA+ SGD+G+
Sbjct  515  ALIPFRGEEAEVLLPPTRSIALARKRLETLPCGGGSPLAHGLTQAVRTGLNAQTSGDIGQ  574

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            I IVAITDGR NI L RS                 ++K E+LE++ +I   G+ +LVIDT
Sbjct  575  ITIVAITDGRGNIPLSRSLGEIQEVGEKP------DIKSELLEISSRIRSLGIQMLVIDT  628

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKE+AK + G YYYLP A+D  I++
Sbjct  629  ESKFVSTGFAKELAKTSGGNYYYLPKATDTTIAS  662



>ref|WP_015142056.1| magnesium chelatase ATPase subunit D [Pleurocapsa minor]
 gb|AFY75748.1| magnesium chelatase ATPase subunit D [Pleurocapsa sp. PCC 7327]
Length=668

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 173/215 (80%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
             + RKV +E+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA L+LLAE+Y +RD
Sbjct  450  HRDRKVIIEEGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVLRLLAEAYENRD  509

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI++AR+RLE LPCGGGSPLAHGLT AV VGMNA+ SGD+
Sbjct  510  QVALIPFRGERAEVLLPPTRSIALARRRLETLPCGGGSPLAHGLTQAVHVGMNAKLSGDI  569

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS           P     ++K E+LE+A K+   GM LLVI
Sbjct  570  GQVVIVAITDGRGNIPLARSL------GEPLPEGEKPDIKGELLEIAAKLRALGMKLLVI  623

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTE+KFVSTGFAKEIA  A GKYY+LP A++  I+
Sbjct  624  DTESKFVSTGFAKEIALKAGGKYYHLPKANERAIA  658



>ref|WP_008232821.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis]
 emb|CCH66879.1| Protoporphyrin IX Mg-chelatase subunit D [Richelia intracellularis 
HH01]
Length=675

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 171/214 (80%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            ++KV +E+ D+R+KR+ RKAG+L+IF+VDASGSMALNRMQ+AKGA ++LL E+Y SRDQV
Sbjct  457  NKKVIIEQEDIRSKRLVRKAGSLIIFLVDASGSMALNRMQSAKGAVMQLLTEAYQSRDQV  516

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ AEVLLPP+RSI++ARKRLE LPCGGGSPLAHGLT AVR+G+NA+ SGD+G+
Sbjct  517  ALIPFRGEEAEVLLPPTRSIALARKRLETLPCGGGSPLAHGLTQAVRIGLNAQISGDIGQ  576

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            I IVAITDGR NI L RS                 ++K E+LE++ +I   G+ +LVIDT
Sbjct  577  ITIVAITDGRGNIPLSRSLGEIQEVGEKP------DIKSELLEISSRIRSLGIQMLVIDT  630

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E+KFVSTGFAKE+AK + G YYYLP A+D  I++
Sbjct  631  ESKFVSTGFAKELAKTSGGNYYYLPKATDTNIAS  664



>ref|WP_038331170.1| magnesium chelatase [filamentous cyanobacterium ESFC-1]
Length=675

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 171/214 (80%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +RKV VE++D+RAKRMARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD+V
Sbjct  458  NRKVIVEQSDLRAKRMARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDEV  517

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP+RSISMAR RLERLPCGGGSPLAHGLT AV VGMNA+ SGD+G+
Sbjct  518  ALIPFRGEQADVLLPPTRSISMARNRLERLPCGGGSPLAHGLTQAVHVGMNAQMSGDIGQ  577

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR NI L RS           P     ++K E++++A K+   G  LL+IDT
Sbjct  578  VVIVAITDGRGNIPLARSL------GEPLPEGEKPDIKGELIDIAAKVRTTGFKLLIIDT  631

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGF KE+AK A G+YY LP A+D  I+A
Sbjct  632  ERKFVSTGFGKELAKQAGGQYYQLPKATDTAIAA  665



>ref|XP_003079609.1| Mg-chelatase subunit (ISS) [Ostreococcus tauri]
 emb|CAL54267.1| von Willebrand factor, type A [Ostreococcus tauri]
Length=756

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            + +KV+VEK DMRAK++ARK+GALVIF+VDASGSMALNRMQ AKGAAL +L  SY SRDQ
Sbjct  530  EKKKVYVEKGDMRAKKLARKSGALVIFLVDASGSMALNRMQGAKGAALSILESSYQSRDQ  589

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            VSI+PFRGD AEVLLPPSRSI+MAR RL+ + CGGGSPLAHGL+ A RVG+NA  +GDVG
Sbjct  590  VSIVPFRGDEAEVLLPPSRSIAMARNRLDSMACGGGSPLAHGLSVAARVGLNAMSTGDVG  649

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            R+MIV +TDGRANIS+ +S         DA +P+ +EL++E+ ++A ++  AGMSLLVID
Sbjct  650  RVMIVCLTDGRANISINKSQRDPEYLGPDARKPTNEELEEEVNDMAARVAAAGMSLLVID  709

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVI  149
            TENKFVS+G A+++A+  +GKYYYLPN ++  I
Sbjct  710  TENKFVSSGTAEKLAQAGRGKYYYLPNGTEREI  742



>ref|WP_015167493.1| magnesium chelatase ATPase subunit D [Synechococcus sp. PCC 7502]
 gb|AFY72834.1| magnesium chelatase ATPase subunit D [Synechococcus sp. PCC 7502]
Length=659

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 170/212 (80%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKV VE  D+RAK++ARKAGALVIF+VDASGSM+LNRMQ+AKGA L+LL E+Y +RDQVS
Sbjct  442  RKVIVENPDIRAKKLARKAGALVIFLVDASGSMSLNRMQSAKGAVLRLLTEAYQNRDQVS  501

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI  A+ RL+ LPCGGGSPLAHGLT AVRVG+NA+ SGD+G++
Sbjct  502  LIPFRGEQAEVLLPPTRSIEAAKIRLDVLPCGGGSPLAHGLTQAVRVGINAKASGDIGQV  561

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            MIVA+TDGR NISL RS              +   +K+E+LE+A K+   G++LLVIDTE
Sbjct  562  MIVAVTDGRGNISLGRSL------GETIDPENKPNIKEELLEIAKKVRALGIALLVIDTE  615

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            NKFVSTGFAKE+A  A GKYY+LP ASD  I+
Sbjct  616  NKFVSTGFAKELAAAAAGKYYHLPKASDQAIA  647



>ref|WP_015124174.1| protoporphyrin IX magnesium-chelatase [Synechococcus sp. PCC 
6312]
 gb|AFY60630.1| protoporphyrin IX magnesium-chelatase [Synechococcus sp. PCC 
6312]
Length=668

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 167/216 (77%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  R+V VE  D+R KR+ARK+GAL+IFVVDASGSMALNRM  AKGA L+LL ++Y +RD
Sbjct  451  QPQRRVIVESGDVRIKRLARKSGALIIFVVDASGSMALNRMNAAKGAVLRLLTQAYQNRD  510

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
             +S+IPFRGD A+VLLPP+RSI  AR+RL+ LPCGGGSPLAHGLT AVRVG+NA++SGDV
Sbjct  511  MISLIPFRGDQADVLLPPTRSIEAARRRLDTLPCGGGSPLAHGLTQAVRVGLNAQQSGDV  570

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++MIVAITDGR NI L +S                 ++K E+L++AGKI   G+ LLV+
Sbjct  571  GQVMIVAITDGRGNIPLAKSLGEPIPEGEKP------DIKAELLDIAGKIRGLGLKLLVV  624

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKF+STGF KE+A  A GKYY+LP A+D  I+A
Sbjct  625  DTENKFISTGFGKELAAQAGGKYYHLPKATDQAIAA  660



>ref|WP_015956003.1| magnesium-chelatase subunit ChlD [Cyanothece sp. PCC 7424]
 gb|ACK72418.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 7424]
Length=671

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 171/216 (79%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               RKV VE+ D+R+KR+ARKAGAL+IFVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  452  HPERKVIVEQGDIRSKRLARKAGALIIFVVDASGSMALNRMQSAKGAVMRLLTEAYENRD  511

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ A+VLLPP+RSI++A+KRLE LPCGGGSPL+HGLT AV VGMNA  SGD+
Sbjct  512  QVALIPFRGEKADVLLPPTRSIALAKKRLETLPCGGGSPLSHGLTQAVHVGMNAMMSGDI  571

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L +S           P     ++K E+LE+AGKI   GM LLVI
Sbjct  572  GQVVIVAITDGRGNIPLVKSL------GEPLPEGEKPDIKAELLEIAGKIRGVGMKLLVI  625

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFVSTGFAKE+A  A GKYY+LP A+D  I++
Sbjct  626  DTEKKFVSTGFAKELATQAGGKYYHLPRATDQAIAS  661



>ref|WP_036476619.1| magnesium chelatase [Myxosarcina sp. GI1]
Length=672

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 171/212 (81%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE++D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+S
Sbjct  457  RNVIVEQSDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQIS  516

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI+MAR RLE LPCGGGSPL+HGLT AV VG+NA+ SGD+G++
Sbjct  517  LIPFRGERAEVLLPPTRSITMARGRLESLPCGGGSPLSHGLTQAVNVGINAQMSGDIGQV  576

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                 ++K+E+L++AGKI   GM LLVIDTE
Sbjct  577  VIVAITDGRGNIPLSRS------LGEPQEDGEKPKIKEELLDIAGKIRGLGMKLLVIDTE  630

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            ++FVSTGFAKE+AK A G YY+LP A+D  I+
Sbjct  631  SRFVSTGFAKELAKQAGGTYYHLPKATDRAIA  662



>ref|WP_011057253.1| magnesium-chelatase subunit ChlD [Thermosynechococcus elongatus]
 ref|NP_682203.1| magnesium-chelatase subunit [Thermosynechococcus elongatus BP-1]
 dbj|BAC08965.1| magnesium-chelatase subunit [Thermosynechococcus elongatus BP-1]
Length=668

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 166/215 (77%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  R+V VE +D+R KR+ RKAGAL+IFVVDASGSMALNRM +AKGA L+LL ++Y +RD
Sbjct  451  QPQRRVIVENSDLRIKRLVRKAGALIIFVVDASGSMALNRMNSAKGAVLRLLTQAYQNRD  510

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
             V++IPFRG+ AEVLLPP+RSI  AR+RLE LPCGGGSPLAHGLT AVRVG+NA +SG++
Sbjct  511  MVALIPFRGEQAEVLLPPTRSIEAARRRLETLPCGGGSPLAHGLTQAVRVGLNARQSGEI  570

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++MIVAITDGR N+ L RS        +        ++K E+LE+A KI   G+ LLVI
Sbjct  571  GQVMIVAITDGRGNVPLSRSLGETLPPQTKP------DVKAEVLEIAAKIQALGLKLLVI  624

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTENKFVSTG  KE+A+ A GKYY+LP A+D  I+
Sbjct  625  DTENKFVSTGMGKELAQQAGGKYYHLPKATDQAIA  659



>ref|XP_001418124.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96417.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=683

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            + +KV+VEK DMRAK++ARK+GALVIF+VDASGSMALNRMQ AKGAAL +L  SY SRD 
Sbjct  457  EKKKVYVEKGDMRAKKLARKSGALVIFLVDASGSMALNRMQGAKGAALSILESSYQSRDM  516

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            VSI+PFRGD AEVLLPPSRSI+MAR RL+ + CGGGSPLAHGL+ A RVG+NA  +GDVG
Sbjct  517  VSIVPFRGDEAEVLLPPSRSIAMARNRLDTMACGGGSPLAHGLSVAARVGLNAMSTGDVG  576

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            R+MIV +TDGRAN+S+ +S         DA +P+ +EL+ E+ + A +I  AGMS+LVID
Sbjct  577  RVMIVCLTDGRANVSINKSQRDPEYLGPDAKKPTNEELEQEVADTAARIGAAGMSVLVID  636

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVI  149
            TENKF+S+G A+++A+ AQGKYYYLPN ++  I
Sbjct  637  TENKFLSSGTAEKLAQNAQGKYYYLPNGTEREI  669



>ref|WP_012161187.1| magnesium-chelatase subunit ChlD [Acaryochloris marina]
 gb|ABW25585.1| magnesium protoporphyrin IX chelatase, D subunit [Acaryochloris 
marina MBIC11017]
Length=682

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 169/216 (78%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
              +R+V VE++D+R KR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  462  HPNRRVIVEQSDVRTKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMRLLTEAYQNRD  521

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ A+VLLPP+RSI  AR+RL+ LPCGGGSPLAHGLT AVRVGMNA  SGD+
Sbjct  522  QVSLIPFRGERADVLLPPTRSIEAARRRLDTLPCGGGSPLAHGLTQAVRVGMNALSSGDI  581

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++++VAITDGR NI L  S                 ++K E+LE+AG+I    + LLVI
Sbjct  582  GQVVLVAITDGRGNIPLTTS------LGEPPVDGEKPDIKAELLEIAGRIRALNLKLLVI  635

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKF+STGFAKE+A+ A G YY+LP A+D  I+A
Sbjct  636  DTENKFISTGFAKELAQNAGGNYYHLPKATDQAIAA  671



>ref|WP_010478137.1| magnesium-chelatase subunit ChlD [Acaryochloris sp. CCMEE 5410]
Length=682

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 169/216 (78%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
              +R+V VE++D+R KR+ARKAGALV+FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  462  HPNRRVIVEQSDVRTKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMRLLTEAYQNRD  521

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPFRG+ A+VLLPP+RSI  AR+RL+ LPCGGGSPLAHGLT AVRVGMNA  SGD+
Sbjct  522  QVSLIPFRGERADVLLPPTRSIEAARRRLDTLPCGGGSPLAHGLTQAVRVGMNALSSGDI  581

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++++VAITDGR NI L  S                 ++K E+LE+AG+I    + LLVI
Sbjct  582  GQVVLVAITDGRGNIPLATS------LGEPPVDGEKPDIKAELLEIAGRIRALNLKLLVI  635

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKF+STGFAKE+A+ A G YY+LP A+D  I+A
Sbjct  636  DTENKFISTGFAKELAQNAGGNYYHLPKATDQAIAA  671



>gb|ACL43185.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 7425]
Length=664

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q +R+V VE +D+R KR+ARKAGALV+F+VDASGSMALNRMQ+AKGA L LL ++Y +RD
Sbjct  448  QPNRRVIVENSDLRIKRLARKAGALVVFLVDASGSMALNRMQSAKGAVLHLLTQAYQNRD  507

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
             V++IPFRG+ A+VLLPP+RSI  AR+RL+ LPCGGGSPLAHGLT AVRVG+NA +SGD+
Sbjct  508  MVALIPFRGEKADVLLPPTRSIEAARRRLDLLPCGGGSPLAHGLTQAVRVGLNARQSGDI  567

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++MIVAITDGR NI L +S                 ++K E+L+++ KI   G+ LLVI
Sbjct  568  GQVMIVAITDGRGNIPLAKSLGELLPEGEKP------DIKAELLDISAKIRALGLKLLVI  621

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKF+STGFAKE+A+ A GKYY+LP A+D  I+A
Sbjct  622  DTENKFISTGFAKELAEQAGGKYYHLPKATDQAIAA  657



>ref|WP_041236163.1| magnesium chelatase [Cyanothece sp. PCC 7425]
Length=667

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q +R+V VE +D+R KR+ARKAGALV+F+VDASGSMALNRMQ+AKGA L LL ++Y +RD
Sbjct  451  QPNRRVIVENSDLRIKRLARKAGALVVFLVDASGSMALNRMQSAKGAVLHLLTQAYQNRD  510

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
             V++IPFRG+ A+VLLPP+RSI  AR+RL+ LPCGGGSPLAHGLT AVRVG+NA +SGD+
Sbjct  511  MVALIPFRGEKADVLLPPTRSIEAARRRLDLLPCGGGSPLAHGLTQAVRVGLNARQSGDI  570

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G++MIVAITDGR NI L +S                 ++K E+L+++ KI   G+ LLVI
Sbjct  571  GQVMIVAITDGRGNIPLAKSLGELLPEGEKP------DIKAELLDISAKIRALGLKLLVI  624

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKF+STGFAKE+A+ A GKYY+LP A+D  I+A
Sbjct  625  DTENKFISTGFAKELAEQAGGKYYHLPKATDQAIAA  660



>ref|WP_040054553.1| magnesium chelatase [Candidatus Atelocyanobacterium thalassa]
 gb|KFF41621.1| protoporphyrin IX magnesium-chelatase [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=673

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 171/212 (81%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V V++ D+R+KR+ RKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ++
Sbjct  457  RNVIVQQEDIRSKRLVRKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQIA  516

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV+VGMNA+ SGD+G++
Sbjct  517  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVKVGMNAKMSGDIGQV  576

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            ++VAITDGR N+SL RS   EA+            +K+E+L +AGKI   G+ LL+IDTE
Sbjct  577  VVVAITDGRGNVSLSRSLGEEASQEDKP------NIKEELLNIAGKIRMLGIKLLMIDTE  630

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF +E+A+ A GKYY LP A+D  I+
Sbjct  631  KKFVSTGFGRELAEAAGGKYYQLPTATDKAIA  662



>ref|WP_011244135.1| MULTISPECIES: magnesium-chelatase subunit ChlD [Synechococcus]
 sp|O07345.2|CHLD_SYNE7 RecName: Full=Magnesium-chelatase subunit ChlD; Short=Mg-chelatase 
subunit D; AltName: Full=Mg-protoporphyrin IX chelatase 
[Synechococcus elongatus PCC 7942]
 dbj|BAD80015.1| magnesium-chelatase subunit ChlD [Synechococcus elongatus PCC 
6301]
 gb|ABB58304.1| protoporphyrin IX magnesium-chelatase [Synechococcus elongatus 
PCC 7942]
 gb|AJD57228.1| magnesium chelatase [Synechococcus sp. UTEX 2973]
Length=677

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 165/216 (76%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE  D+R+K++ RKAGALVIF+VDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  457  QPDRKVIVEDADIRSKQLVRKAGALVIFLVDASGSMALNRMQSAKGAVIRLLTEAYENRD  516

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI+ ARKRLE++PCGGGSPLAHGLT AVRVG NA +SGD+
Sbjct  517  QVALIPFRGEQAEVLLPPTRSITAARKRLEKMPCGGGSPLAHGLTQAVRVGTNAAQSGDI  576

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 +LK+E+L++A +I    M LLVI
Sbjct  577  GQVVIVAITDGRGNIPLARSLGQPMEEGEKP------DLKEELLDIAKRIRGLSMQLLVI  630

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFV  GF KE+A  A G+YY+LP  SD  I+A
Sbjct  631  DTERKFVGAGFGKELANAAGGQYYHLPKVSDQAIAA  666



>ref|XP_004517295.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like 
[Cicer arietinum]
Length=707

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            +  RKV+VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD
Sbjct  534  ENRRKVYVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  593

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVSIIPFRGDSAEVLLPPSRSI+MARKRLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDV
Sbjct  594  QVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDV  653

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKI  281
            GRIMIVAITDGRANISLKRSTDPEAAA++DAP+P+ QELK ++  + G I
Sbjct  654  GRIMIVAITDGRANISLKRSTDPEAAAATDAPKPTVQELKVQLSFLIGHI  703



>ref|XP_002956152.1| hypothetical protein VOLCADRAFT_121490 [Volvox carteri f. nagariensis]
 gb|EFJ42691.1| hypothetical protein VOLCADRAFT_121490 [Volvox carteri f. nagariensis]
Length=736

 Score =   259 bits (661),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV+++K+D+RAKR+ARKAGALVIFVVDASGSMALNRM  AKGA ++LLAESYTSRD
Sbjct  509  QPPRKVYIDKSDLRAKRLARKAGALVIFVVDASGSMALNRMSAAKGACMRLLAESYTSRD  568

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+ ++ F GD A+VLLPPSRSI++A+ RLE LPCGGG+PLAHGL TAV  G  A KS  V
Sbjct  569  QICLVAFFGDKAQVLLPPSRSITLAKHRLETLPCGGGTPLAHGLYTAVHTGCTALKSRQV  628

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G +M+V ITDGRAN+SL +S +   A   DAP+PS   LKDE+ ++A K   AG++ LVI
Sbjct  629  GHVMMVLITDGRANVSLAKSNEAPEALKPDAPKPSVDRLKDEVCDIAKKAAVAGINTLVI  688

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPN  167
            DTENKFVSTGFA+EIAK AQGKYYYLPN
Sbjct  689  DTENKFVSTGFAEEIAKAAQGKYYYLPN  716



>ref|WP_019507353.1| magnesium-chelatase subunit ChlD [Pleurocapsa sp. PCC 7319]
Length=676

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 170/212 (80%), Gaps = 5/212 (2%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKV VE++D+R+KRMARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+S
Sbjct  460  RKVIVEQSDLRSKRMARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQIS  519

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSI+MA+ RLE LPCGGGSPL+HGLT AV VG+NA+ SGD+G++
Sbjct  520  LIPFRGERADVLLPPTRSITMAKGRLESLPCGGGSPLSHGLTQAVNVGINAQMSGDIGQV  579

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS                  +K+E+L++AGKI    M LLVIDTE
Sbjct  580  VIVAITDGRGNIPLSRS-----LGEPQEEGAEKPNIKEELLDIAGKIRALNMKLLVIDTE  634

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            ++FVSTGFAKE+AK A G YY+LP A+D  I+
Sbjct  635  SRFVSTGFAKELAKQAGGTYYHLPKATDRAIA  666



>ref|WP_012306227.1| magnesium-chelatase subunit ChlD [Synechococcus sp. PCC 7002]
 gb|ACA98603.1| magnesium chelatase ATPase subunit D (Mg-protoporphyrin IX chelatase 
subunit D) [Synechococcus sp. PCC 7002]
Length=682

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 169/216 (78%), Gaps = 5/216 (2%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               RKV VE++D+R+KRMARKAGAL+IF+VDASGSMALNRMQ AKGA ++LL E+Y +RD
Sbjct  463  HPERKVIVEQSDLRSKRMARKAGALMIFLVDASGSMALNRMQAAKGAVMRLLTEAYENRD  522

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+++IPFRG+ AEVLLPP+RSI++AR RLE LPCGGGSPL+HGLT AV +G+NA+ SGDV
Sbjct  523  QIALIPFRGEMAEVLLPPTRSITLARNRLETLPCGGGSPLSHGLTQAVHIGVNAQMSGDV  582

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G ++IVAITDGR NI L RS                 ++K+E+L++AGKI  +GM LL+I
Sbjct  583  GEVVIVAITDGRGNIPLSRS-----LGEKPEEGEEKPDIKEELLDIAGKIRASGMKLLII  637

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KF+S+GF KE+A  A GKYY LP A+D  I+A
Sbjct  638  DTEKKFISSGFGKELAAKAGGKYYRLPKATDQAIAA  673



>ref|WP_006456157.1| magnesium-chelatase subunit ChlD [Synechococcus sp. PCC 7335]
 gb|EDX86391.1| magnesium chelatase ATPase subunit D [Synechococcus sp. PCC 7335]
Length=680

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 166/216 (77%), Gaps = 5/216 (2%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               RKV VE+ D+RAKR+ARKAG+L+IFVVDASGSMALNRMQNAKGA L LL ++Y +RD
Sbjct  459  HPDRKVIVEQADIRAKRLARKAGSLIIFVVDASGSMALNRMQNAKGAVLSLLTDAYQNRD  518

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ A+VLLPP+RSI+ A++RLE + CGGGSPLAHGL  A+RVGMNA+KSGDV
Sbjct  519  QVALIPFRGEQADVLLPPTRSITAAKRRLETMACGGGSPLAHGLMQALRVGMNAQKSGDV  578

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G ++IVAITDGR N+ L RS                 +LK E+LE+AG I  AG  +LVI
Sbjct  579  GSVVIVAITDGRGNVPLARS-----LGDELDEPEEKPDLKAELLEIAGNIRTAGYQMLVI  633

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFVSTGF KE+AK A GKYY LP A+D  I++
Sbjct  634  DTERKFVSTGFGKELAKTAGGKYYQLPKATDQAIAS  669



>gb|EHJ10536.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii 
WH 0003]
Length=682

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 168/212 (79%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQVS
Sbjct  466  RSVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVS  525

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+G++
Sbjct  526  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDIGQV  585

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L +S           P     ++K E+L++AGKI   G+ LL+IDTE
Sbjct  586  VIVAITDGRGNIPLAKSL------GEPIPEGEKPDIKQELLDIAGKIRALGIKLLMIDTE  639

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  640  KKFVSTGFGKEMAQTAGGTYYQLPRATDQAIA  671



>ref|WP_021829762.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii]
 emb|CCQ49919.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii 
WH 8502]
Length=682

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 168/212 (79%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQVS
Sbjct  466  RSVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVS  525

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+G++
Sbjct  526  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDIGQV  585

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L +S           P     ++K E+L++AGKI   G+ LL+IDTE
Sbjct  586  VIVAITDGRGNIPLAKSL------GEPIPEGEKPDIKQELLDIAGKIRALGIKLLMIDTE  639

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  640  KKFVSTGFGKEMAQTAGGTYYQLPRATDQAIA  671



>gb|EAM48772.1| Magnesium chelatase, ChlI subunit [Crocosphaera watsonii WH 8501]
Length=682

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 168/212 (79%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQVS
Sbjct  466  RSVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVS  525

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+G++
Sbjct  526  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDIGQV  585

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L +S           P     ++K E+L++AGKI   G+ LL+IDTE
Sbjct  586  VIVAITDGRGNIPLAKSL------GEPIPEGEKPDIKQELLDIAGKIRALGIKLLMIDTE  639

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  640  KKFVSTGFGKEMAQTAGGTYYQLPRATDQAIA  671



>emb|CCQ62029.1| Protoporphyrin IX Mg-chelatase subunit D [Crocosphaera watsonii 
WH 0401]
Length=682

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 168/212 (79%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQVS
Sbjct  466  RSVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVS  525

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+G++
Sbjct  526  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDIGQV  585

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L +S           P     ++K E+L++AGKI   G+ LL+IDTE
Sbjct  586  VIVAITDGRGNIPLAKSL------GEPIPEGEKPDIKQELLDIAGKIRALGIKLLMIDTE  639

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  640  KKFVSTGFGKEMAQTAGGTYYQLPRATDQAIA  671



>ref|WP_042712310.1| magnesium chelatase [Crocosphaera watsonii]
Length=672

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 168/212 (79%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQVS
Sbjct  456  RSVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVS  515

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+G++
Sbjct  516  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDIGQV  575

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L +S           P     ++K E+L++AGKI   G+ LL+IDTE
Sbjct  576  VIVAITDGRGNIPLAKSL------GEPIPEGEKPDIKQELLDIAGKIRALGIKLLMIDTE  629

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  630  KKFVSTGFGKEMAQTAGGTYYQLPRATDQAIA  661



>ref|WP_015784261.1| magnesium-chelatase subunit ChlD [Cyanothece sp. PCC 8802]
 gb|ACV01473.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 8802]
Length=673

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 167/215 (78%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  454  HPGRNVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRD  513

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ A+VLLPP+RSI++AR+RLE LPCGGGSPLAHGLT AV VGMNA+ SGD+
Sbjct  514  QVALIPFRGEQADVLLPPTRSIALARRRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDI  573

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L +S           P     ++K E+LE+AGKI   GM LLVI
Sbjct  574  GQVVIVAITDGRGNIPLAKSL------GEPLPEGEKPDIKGELLEIAGKIRALGMKLLVI  627

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTE KFVSTGF KE+A  A G YY LP A+D  I+
Sbjct  628  DTEKKFVSTGFGKELATTAGGTYYQLPRATDQAIA  662



>ref|WP_035828596.1| magnesium chelatase [Crocosphaera watsonii]
Length=672

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 168/212 (79%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQVS
Sbjct  456  RSVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVS  515

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+G++
Sbjct  516  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDIGQV  575

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L +S           P     ++K E+L++AGKI   G+ LL+IDTE
Sbjct  576  VIVAITDGRGNIPLAKSL------GEPIPEGEKPDIKQELLDIAGKIRALGIKLLMIDTE  629

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  630  KKFVSTGFGKEMAQTAGGTYYQLPRATDQAIA  661



>ref|WP_013321313.1| magnesium-chelatase subunit ChlD [Cyanothece sp. PCC 7822]
 gb|ADN13206.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 7822]
Length=672

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 169/216 (78%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  453  HPERNVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRD  512

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ A+VLLPP+RSI++A++RLE LPCGGGSPL+HGLT AV VGMNA+ SGD+
Sbjct  513  QVALIPFRGEKADVLLPPTRSIALAKRRLESLPCGGGSPLSHGLTQAVHVGMNAKMSGDI  572

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L +S                 ++K E+LE+A KI   GM LLVI
Sbjct  573  GQVVIVAITDGRGNIPLAKSL------GEPPAEGEKPDIKAELLEIAAKIRGLGMKLLVI  626

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFVSTGFAKE+A  A GKYY+LP A+D  I++
Sbjct  627  DTEKKFVSTGFAKELAAKAGGKYYHLPRATDQAIAS  662



>ref|WP_012596729.1| magnesium-chelatase subunit ChlD [Cyanothece sp. PCC 8801]
 gb|ACK67470.1| magnesium chelatase ATPase subunit D [Cyanothece sp. PCC 8801]
Length=673

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 167/215 (78%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  454  HPGRNVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRD  513

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ A+VLLPP+RSI++AR+RLE LPCGGGSPLAHGLT AV VGMNA+ SGD+
Sbjct  514  QVALIPFRGEQADVLLPPTRSIALARRRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDI  573

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L +S           P     ++K E+LE+AGKI   GM LLVI
Sbjct  574  GQVVIVAITDGRGNIPLAKSL------GEPLPEGEKPDIKGELLEIAGKIRALGMKLLVI  627

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTE KFVSTGF KE+A  A G YY LP A+D  I+
Sbjct  628  DTEKKFVSTGFGKELATTAGGTYYQLPRATDQAIA  662



>ref|WP_023074366.1| protoporphyrin ix magnesium-chelatase [Leptolyngbya sp. Heron 
Island J]
 gb|ESA34748.1| protoporphyrin ix magnesium-chelatase [Leptolyngbya sp. Heron 
Island J]
Length=681

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 168/215 (78%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE+ D+RAKR+ARKAG+L+IFVVDASGSMALNRMQ+AKGA L LL ++Y +RD
Sbjct  461  QPERKVIVEQGDIRAKRLARKAGSLIIFVVDASGSMALNRMQSAKGAVLSLLTDAYQNRD  520

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ A+VLLPP+RSI+ AR+RLE +PCGGGSPLAHGL+ AVRVG+NA++SGDV
Sbjct  521  QVALIPFRGEQADVLLPPTRSITSARRRLETMPCGGGSPLAHGLSQAVRVGVNAQQSGDV  580

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G ++I+AITDGR N+ L RS                 ++K E+L++AG+I   G  LL+I
Sbjct  581  GNVVIIAITDGRGNVPLARS------LGEPMEEGEKPDIKAELLDIAGRIRMTGFQLLII  634

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTE KFVSTGF KE+AK A GKYY LP A+D  I+
Sbjct  635  DTERKFVSTGFGKELAKTAGGKYYQLPKATDKAIA  669



>ref|WP_012954455.1| magnesium-chelatase subunit ChlD [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95768.1| protoporphyrin IX magnesium-chelatase [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=680

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 166/212 (78%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE  D+R+KR+ RKAGAL+IFVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ++
Sbjct  464  RNVIVEHQDIRSKRLVRKAGALIIFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQIA  523

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV++G+NA+ SGD+G++
Sbjct  524  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVKIGVNAKMSGDIGQV  583

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NISL RS   +              +K+E+L +A +I   G+ LL+IDTE
Sbjct  584  VIVAITDGRGNISLSRSLGEQVLKEDKP------NIKEELLNIASRIKMLGIKLLMIDTE  637

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF KE+AK A G YY LP A+D  I+
Sbjct  638  KKFVSTGFGKELAKAAMGTYYQLPTATDKAIA  669



>dbj|BAA20346.1| magnesium-chelatase subunit [Synechococcus elongatus PCC 7942]
Length=677

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 164/216 (76%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE  D+R+K++ RKAGALVIF+VDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  457  QPDRKVIVEDADIRSKQLVRKAGALVIFLVDASGSMALNRMQSAKGAVIRLLTEAYENRD  516

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ AEVLLPP+RSI+ ARKRLE++PCGGG PLAHGLT AVRVG NA +SGD+
Sbjct  517  QVALIPFRGEQAEVLLPPTRSITAARKRLEKMPCGGGLPLAHGLTQAVRVGTNAAQSGDI  576

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS                 +LK+E+L++A +I    M LLVI
Sbjct  577  GQVVIVAITDGRGNIPLARSLGQPMEEGEKP------DLKEELLDIAKRIRGLSMQLLVI  630

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KFV  GF KE+A  A G+YY+LP  SD  I+A
Sbjct  631  DTERKFVGAGFGKELANAAGGQYYHLPKVSDQAIAA  666



>ref|WP_024750240.1| MULTISPECIES: magnesium chelatase [Cyanothece]
Length=672

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 168/215 (78%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  453  HPGRNVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRD  512

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+
Sbjct  513  QVALIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDI  572

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L +S           P     ++K E+L++AGKI   G+ LL+I
Sbjct  573  GQVVIVAITDGRGNIPLAKSL------GEPIPEGEKPDIKQELLDIAGKIRGLGIKLLMI  626

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTE KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  627  DTEKKFVSTGFGKELAQTAGGTYYQLPRATDQAIA  661



>gb|ACB50424.1| magnesium chelatase, ATPase subunit D [Cyanothece sp. ATCC 51142]
Length=682

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 168/215 (78%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RD
Sbjct  463  HPGRNVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRD  522

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+
Sbjct  523  QVALIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDI  582

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L +S           P     ++K E+L++AGKI   G+ LL+I
Sbjct  583  GQVVIVAITDGRGNIPLAKSL------GEPIPEGEKPDIKQELLDIAGKIRGLGIKLLMI  636

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTE KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  637  DTEKKFVSTGFGKELAQTAGGTYYQLPRATDQAIA  671



>gb|AFW67236.1| hypothetical protein ZEAMMB73_644992 [Zea mays]
Length=692

 Score =   255 bits (652),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 158/159 (99%), Gaps = 0/159 (0%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            K+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ
Sbjct  529  KTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  588

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            VSIIPFRGD AEVLLPPSRSI+MARKRLE+LPCGGGSPLAHGL+TAVRVG+NAEKSGDVG
Sbjct  589  VSIIPFRGDYAEVLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVG  648

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELK  311
            RIMIVAITDGRAN+SLKRSTDPEAAA+SDAPRPS+QELK
Sbjct  649  RIMIVAITDGRANVSLKRSTDPEAAAASDAPRPSSQELK  687



>ref|WP_040940037.1| magnesium chelatase [Prochloron didemni]
Length=664

 Score =   254 bits (650),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 167/213 (78%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKV VE+ D+R+KR+ARKAG+L++FVVDASGSMALNRM++AKGA L+LL E+Y +RDQ++
Sbjct  451  RKVIVEQGDLRSKRLARKAGSLIVFVVDASGSMALNRMESAKGAVLRLLTEAYENRDQIA  510

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VL+PP+RSIS+AR+RLERLPCGG SPLAHGLT AV VGMNA  SGD+G++
Sbjct  511  LIPFRGEKADVLIPPTRSISLARRRLERLPCGGPSPLAHGLTQAVHVGMNATMSGDIGQV  570

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
             IVAITDGR NI L RS                 ++K E+LE+AGKI    M  LV+DTE
Sbjct  571  AIVAITDGRGNIPLARSL------GETMDSAEKPDIKGELLEIAGKIRLLKMQFLVVDTE  624

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
             KF+STGF KE+A+ A GKYY+LP A+D  I+A
Sbjct  625  KKFISTGFGKELAQQAGGKYYHLPMANDRAIAA  657



>ref|WP_040945156.1| magnesium chelatase [Prochloron didemni]
Length=664

 Score =   254 bits (650),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 167/213 (78%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            RKV VE+ D+R+KR+ARKAG+L++FVVDASGSMALNRM++AKGA L+LL E+Y +RDQ++
Sbjct  451  RKVIVEQGDLRSKRLARKAGSLIVFVVDASGSMALNRMESAKGAVLRLLTEAYENRDQIA  510

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VL+PP+RSIS+AR+RLERLPCGG SPLAHGLT AV VGMNA  SGD+G++
Sbjct  511  LIPFRGEKADVLIPPTRSISLARRRLERLPCGGPSPLAHGLTQAVHVGMNATMSGDIGQV  570

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
             IVAITDGR NI L RS                 ++K E+LE+AGKI    M  LV+DTE
Sbjct  571  AIVAITDGRGNIPLARSL------GETMDSAEKPDIKGELLEIAGKIRLLKMQFLVVDTE  624

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
             KF+STGF KE+A+ A GKYY+LP A+D  I+A
Sbjct  625  KKFISTGFGKELAQQAGGKYYHLPMANDRAIAA  657



>ref|WP_030005855.1| magnesium chelatase [Synechococcus sp. NKBG042902]
Length=682

 Score =   254 bits (650),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 168/216 (78%), Gaps = 5/216 (2%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               RKV VE++D+R+KRMARKAGAL+IF+VDASGSMALNRMQ AKGA ++LL E+Y +RD
Sbjct  463  HPERKVIVEQSDLRSKRMARKAGALMIFLVDASGSMALNRMQAAKGAVMRLLTEAYENRD  522

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+++IPFRG+ AEVLLPP+RSI++AR RLE LPCGGGSPL+HGLT AV +G+NA+ SGDV
Sbjct  523  QIALIPFRGEMAEVLLPPTRSITLARNRLETLPCGGGSPLSHGLTQAVHIGVNAQMSGDV  582

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G ++IVAITDGR NI L RS                 ++K+E+L++A KI  +GM LL+I
Sbjct  583  GEVVIVAITDGRGNIPLSRS-----LGEKPEEGEEKPDIKEELLDIASKIRASGMKLLII  637

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTE KF+S+GF KE+A  A GKYY LP A+D  I+A
Sbjct  638  DTEKKFISSGFGKELAAKAGGKYYRLPKATDQAIAA  673



>ref|WP_015222191.1| protoporphyrin IX magnesium-chelatase [Cyanobacterium stanieri]
 gb|AFZ46873.1| protoporphyrin IX magnesium-chelatase [Cyanobacterium stanieri 
PCC 7202]
Length=679

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 169/213 (79%), Gaps = 6/213 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +R+V VE++D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  462  NRRVIVEQSDLRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQV  521

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP+RSI++AR RLE LPCGGGSPL+H LT AV VG+NA+ SGD+G+
Sbjct  522  ALIPFRGEQADVLLPPTRSITLARLRLETLPCGGGSPLSHALTQAVHVGVNAQMSGDIGQ  581

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR NI L RS         + P     ++K E+LE+AGKI   GM LLVIDT
Sbjct  582  VVIVAITDGRGNIPLARS------LGDEIPEGEKPDIKAELLEIAGKIRAMGMKLLVIDT  635

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            E KFVSTGF KE+A  A G YY LP A+D  I+
Sbjct  636  EKKFVSTGFGKELATTAGGTYYQLPKATDQAIA  668



>ref|WP_006517412.1| protoporphyrin IX magnesium-chelatase [Leptolyngbya sp. PCC 7375]
 gb|EKV03041.1| protoporphyrin IX magnesium-chelatase [Leptolyngbya sp. PCC 7375]
Length=682

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 166/215 (77%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE+ D+RAKR+ARKAG+L+IFVVDASGSMALNRMQ+AKGA L LL ++Y +RD
Sbjct  462  QPERKVIVEQGDIRAKRLARKAGSLIIFVVDASGSMALNRMQSAKGAVLSLLTDAYQNRD  521

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++IPFRG+ A+VLLPP+RSI+ AR+RLE +PCGGGSPLAHGL+ AVRVG NA++SGD 
Sbjct  522  QVALIPFRGEQADVLLPPTRSITSARRRLETMPCGGGSPLAHGLSQAVRVGTNAQQSGDT  581

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G ++I+AITDGR N+ L RS                 ++K E+L++AG+I   G  LL+I
Sbjct  582  GNVVIIAITDGRGNVPLARS------LGEPMEEGEKPDIKAELLDIAGRIRMTGFQLLII  635

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTE KFVSTGF KE+AK A GKYY LP A+D  I+
Sbjct  636  DTERKFVSTGFGKELAKTAGGKYYQLPKATDKAIA  670



>gb|ELS01041.1| magnesium chelatase ATPase subunit D [Xenococcus sp. PCC 7305]
Length=674

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +   RKV VE++D+R+KRMARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +R
Sbjct  455  LNPDRKVIVEQSDLRSKRMARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENR  514

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQ+++IPFRG+ A+VLLPP+RSI+MAR RLE LPCGGGSPL+HGLT AV VG+NA+ SGD
Sbjct  515  DQIALIPFRGERADVLLPPTRSITMARGRLETLPCGGGSPLSHGLTQAVNVGVNAQMSGD  574

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            +G+++IVAITDGR NI L RS                  +K+E+L++A KI   GM LL+
Sbjct  575  IGQVVIVAITDGRGNIPLSRS------LGEPPEEGVKPNIKEELLDIAAKIRALGMKLLL  628

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            IDTE++FVSTGF KE+AK A G YY+LP A+D  I+
Sbjct  629  IDTESRFVSTGFGKELAKNAGGTYYHLPKANDRAIA  664



>ref|WP_040899190.1| magnesium chelatase [Xenococcus sp. PCC 7305]
Length=684

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = -1

Query  793  IQKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSR  614
            +   RKV VE++D+R+KRMARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +R
Sbjct  465  LNPDRKVIVEQSDLRSKRMARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENR  524

Query  613  DQVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGD  434
            DQ+++IPFRG+ A+VLLPP+RSI+MAR RLE LPCGGGSPL+HGLT AV VG+NA+ SGD
Sbjct  525  DQIALIPFRGERADVLLPPTRSITMARGRLETLPCGGGSPLSHGLTQAVNVGVNAQMSGD  584

Query  433  VGRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLV  254
            +G+++IVAITDGR NI L RS                  +K+E+L++A KI   GM LL+
Sbjct  585  IGQVVIVAITDGRGNIPLSRS------LGEPPEEGVKPNIKEELLDIAAKIRALGMKLLL  638

Query  253  IDTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            IDTE++FVSTGF KE+AK A G YY+LP A+D  I+
Sbjct  639  IDTESRFVSTGFGKELAKNAGGTYYHLPKANDRAIA  674



>ref|XP_011397801.1| Magnesium-chelatase subunit ChlD, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM24913.1| Magnesium-chelatase subunit ChlD, chloroplastic [Auxenochlorella 
protothecoides]
Length=576

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  766  EKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFR  587
            ++TDMRAKRMARKAGAL++FVVDASGSMALNRM  AKGA ++LL+ESY SRDQV +IPF 
Sbjct  356  KRTDMRAKRMARKAGALLVFVVDASGSMALNRMAAAKGAVMRLLSESYASRDQVCLIPFY  415

Query  586  GDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRIMIVAI  407
            GD A+VLLPPS+SI+MA++RL+ LPCGGGSPLAHG++ AVR  + A + G+VGR+M+V I
Sbjct  416  GDQAQVLLPPSKSIAMAKRRLDSLPCGGGSPLAHGMSLAVRTALQARQRGEVGRVMLVLI  475

Query  406  TDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTENKFVS  227
            TDGRANI L RS +   A   DA +P+ ++LK+E+L +A ++  + + +L+IDTENKFVS
Sbjct  476  TDGRANIGLARSNEEPDAMGPDAVKPTTEQLKEEVLLMARRVLVSNLQMLLIDTENKFVS  535

Query  226  TGFAKEIAKIAQGKYYYLPNASDAVISA  143
            TGFA+EIAK A  KYYYLPNASD  I+A
Sbjct  536  TGFAEEIAKAAGAKYYYLPNASDKSIAA  563



>gb|AFZ55087.1| protoporphyrin IX magnesium-chelatase [Cyanobacterium aponinum 
PCC 10605]
Length=681

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 167/213 (78%), Gaps = 6/213 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +R+V VE++D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  464  NRRVIVEQSDLRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQV  523

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP+RSI++AR RLE LPCGGGSPL+H LT AV VG+NA+ SGD+G+
Sbjct  524  ALIPFRGEQADVLLPPTRSITLARTRLETLPCGGGSPLSHALTQAVHVGVNAQMSGDIGQ  583

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR NI L RS                 ++K E+L++A KI   GM LLVIDT
Sbjct  584  VVIVAITDGRGNIPLARS------LGETLEEGEKPDIKAELLDIATKIRAMGMKLLVIDT  637

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            E KFVSTGF KE+AK A G YY LP A+D  I+
Sbjct  638  EKKFVSTGFGKELAKQAGGNYYQLPKATDQAIA  670



>emb|CAA65418.1| magnesium chelatase [Synechocystis sp. PCC 6803]
Length=676

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 169/216 (78%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               R+V VE+ D+R K++ RKAGAL++F+VDASGSMALNRMQ AKGA ++LL E+Y +RD
Sbjct  457  HPDRQVIVEQGDIRGKKLVRKAGALIVFLVDASGSMALNRMQAAKGAVMQLLTEAYENRD  516

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPF+G++AEVLLPP+RSI+MA+KRLE LPCGGGSPL+HGL  AV VGMNA++SGD+
Sbjct  517  QVSLIPFQGENAEVLLPPTRSIAMAKKRLETLPCGGGSPLSHGLMQAVNVGMNAKRSGDI  576

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS         + P     ++K E+LE+A KI   GM LLVI
Sbjct  577  GQVVIVAITDGRGNIPLARSL------GDEIPEGEKPDIKAELLEIAAKIRGLGMQLLVI  630

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +TE KFVSTGF KE+A+ A GKYY LP A+D  I++
Sbjct  631  NTEKKFVSTGFGKELAQKAGGKYYQLPKATDQGIAS  666



>ref|WP_041922943.1| magnesium chelatase [Cyanobacterium aponinum]
Length=690

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 167/213 (78%), Gaps = 6/213 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +R+V VE++D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  473  NRRVIVEQSDLRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQV  532

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP+RSI++AR RLE LPCGGGSPL+H LT AV VG+NA+ SGD+G+
Sbjct  533  ALIPFRGEQADVLLPPTRSITLARTRLETLPCGGGSPLSHALTQAVHVGVNAQMSGDIGQ  592

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR NI L RS                 ++K E+L++A KI   GM LLVIDT
Sbjct  593  VVIVAITDGRGNIPLARS------LGETLEEGEKPDIKAELLDIATKIRAMGMKLLVIDT  646

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            E KFVSTGF KE+AK A G YY LP A+D  I+
Sbjct  647  EKKFVSTGFGKELAKQAGGNYYQLPKATDQAIA  679



>ref|WP_010871417.1| magnesium-chelatase subunit ChlD [Synechocystis sp. PCC 6803]
 ref|NP_440107.1| Mg chelatase subunit ChlD [Synechocystis sp. PCC 6803]
 sp|P72772.1|CHLD_SYNY3 RecName: Full=Magnesium-chelatase subunit ChlD; Short=Mg-chelatase 
subunit D; AltName: Full=Mg-protoporphyrin IX chelatase 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAA16787.1| Mg chelatase subunit; ChlD [Synechocystis sp. PCC 6803]
 dbj|BAK48959.1| Mg chelatase subunit [Synechocystis sp. PCC 6803]
 dbj|BAL27958.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL31128.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL34297.1| Mg chelatase subunit [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM50493.1| Mg chelatase subunit ChlD [Synechocystis sp. PCC 6803]
 gb|AGF50476.1| Mg chelatase subunit ChlD [Synechocystis sp. PCC 6803]
Length=676

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 169/216 (78%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               R+V VE+ D+R K++ RKAGAL++F+VDASGSMALNRMQ AKGA ++LL E+Y +RD
Sbjct  457  HPDRQVIVEQGDIRGKKLVRKAGALIVFLVDASGSMALNRMQAAKGAVMQLLTEAYENRD  516

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPF+G++AEVLLPP+RSI+MA+KRLE LPCGGGSPL+HGL  AV VGMNA++SGD+
Sbjct  517  QVSLIPFQGENAEVLLPPTRSIAMAKKRLETLPCGGGSPLSHGLMQAVNVGMNAKRSGDI  576

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS         + P     ++K E+LE+A KI   GM LLVI
Sbjct  577  GQVVIVAITDGRGNIPLARSL------GDEIPEGEKPDIKAELLEIAAKIRGLGMQLLVI  630

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +TE KFVSTGF KE+A+ A GKYY LP A+D  I++
Sbjct  631  NTEKKFVSTGFGKELAQKAGGKYYQLPKATDQGIAS  666



>ref|WP_008278652.1| magnesium-chelatase subunit ChlD [Cyanothece sp. CCY0110]
 gb|EAZ88275.1| Mg chelatase subunit; ChlD [Cyanothece sp. CCY0110]
Length=672

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 167/212 (79%), Gaps = 6/212 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV+
Sbjct  456  RNVIVEQGDIRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVA  515

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSIS+ARKRLE LPCGGGSPLAHGLT AV VGMNA+ SGD+G++
Sbjct  516  LIPFRGEQADVLLPPTRSISLARKRLETLPCGGGSPLAHGLTQAVHVGMNAKMSGDIGQV  575

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L +S           P     ++K E+L++A KI   G+ LL+IDTE
Sbjct  576  VIVAITDGRGNIPLAKSL------GEPIPEGEKPDIKQELLDIAKKIRGLGIKLLMIDTE  629

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
             KFVSTGF KE+A+ A G YY LP A+D  I+
Sbjct  630  KKFVSTGFGKELAQTAGGTYYQLPRATDQAIA  661



>ref|WP_040687697.1| magnesium chelatase [Pseudanabaena biceps]
Length=667

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 164/215 (76%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE  D+RAK++ARKAGAL IF+VDASGSMALNRMQ+AKGAAL++L +SY +RD
Sbjct  447  QPHRKVIVEDVDIRAKKLARKAGALTIFLVDASGSMALNRMQSAKGAALRMLTDSYQNRD  506

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+S+IPFRG+ A+VLLPP+RSI  AR+RL+ +PCGGGSPLAHGLT AVRV MNA +SGDV
Sbjct  507  QISLIPFRGEKADVLLPPTRSIEAARRRLDTMPCGGGSPLAHGLTQAVRVAMNARQSGDV  566

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G + IVAITDGR N+ L RS              +  ++K E++++  KI    + LLVI
Sbjct  567  GSVTIVAITDGRGNVPLARSQ------GEPIDPENKPDIKAELIDICRKIRALNLGLLVI  620

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTENKFVSTGFAKE+A    GKYY+LP A+D  I+
Sbjct  621  DTENKFVSTGFAKELAAAGGGKYYHLPKATDQAIA  655



>ref|XP_007514351.1| protoporphyrin IX magnesium chelatase subunit ChlD [Bathycoccus 
prasinos]
 emb|CCO15788.1| protoporphyrin IX magnesium chelatase subunit ChlD [Bathycoccus 
prasinos]
Length=766

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -1

Query  787  KSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQ  608
            + +KV+VEK DMRAK++ARK+GAL+IF+VDASGSMALNRM  +KGAAL +L +SY SRDQ
Sbjct  541  EKKKVYVEKGDMRAKKLARKSGALIIFLVDASGSMALNRMNASKGAALSILEDSYKSRDQ  600

Query  607  VSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVG  428
            V IIPFRGD AEVLLPPSRSISMAR RL+ +PCGGGSPLAHGL+ A R G+NA  SGDV 
Sbjct  601  VCIIPFRGDEAEVLLPPSRSISMARNRLDTMPCGGGSPLAHGLSVAARTGINAMSSGDVS  660

Query  427  RIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVID  248
            R+ +V +TDGRAN++L +S       S DAP+ S +EL+ E+ ++A  +   GMSLLVID
Sbjct  661  RVTVVCLTDGRANVALGKSMRDPEFMSPDAPKLSNEELQSEVYDMAKLMTGNGMSLLVID  720

Query  247  TENKFVSTGFAKEIAKIAQGKYYYLPNASDAVI  149
            TENKFVS+G A+E+A+   GKYYYLPN +D  I
Sbjct  721  TENKFVSSGMAEEMAQKCGGKYYYLPNGTDQEI  753



>gb|ELS33326.1| protoporphyrin IX magnesium-chelatase [Pseudanabaena biceps PCC 
7429]
Length=681

 Score =   252 bits (644),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 164/215 (76%), Gaps = 6/215 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  RKV VE  D+RAK++ARKAGAL IF+VDASGSMALNRMQ+AKGAAL++L +SY +RD
Sbjct  461  QPHRKVIVEDVDIRAKKLARKAGALTIFLVDASGSMALNRMQSAKGAALRMLTDSYQNRD  520

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            Q+S+IPFRG+ A+VLLPP+RSI  AR+RL+ +PCGGGSPLAHGLT AVRV MNA +SGDV
Sbjct  521  QISLIPFRGEKADVLLPPTRSIEAARRRLDTMPCGGGSPLAHGLTQAVRVAMNARQSGDV  580

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G + IVAITDGR N+ L RS              +  ++K E++++  KI    + LLVI
Sbjct  581  GSVTIVAITDGRGNVPLARSQ------GEPIDPENKPDIKAELIDICRKIRALNLGLLVI  634

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            DTENKFVSTGFAKE+A    GKYY+LP A+D  I+
Sbjct  635  DTENKFVSTGFAKELAAAGGGKYYHLPKATDQAIA  669



>ref|WP_039782182.1| magnesium chelatase [Acaryochloris sp. CCMEE 5410]
Length=670

 Score =   251 bits (642),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 165/216 (76%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
            Q  R+V VE+ D+R KR+ARKAGAL+IFVVDASGSMALNRM+ AKGAAL++LAE+Y  RD
Sbjct  451  QPGRRVIVEEQDIRTKRLARKAGALIIFVVDASGSMALNRMEAAKGAALQILAEAYRHRD  510

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QV++I FRG+ AEVLLPP+RSI+ AR+RLE LPCGGGSPLAH L  A+ VG NA +S DV
Sbjct  511  QVALIAFRGEQAEVLLPPTRSIAAARRRLEHLPCGGGSPLAHALAQAIHVGQNALQSKDV  570

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
             +I+I+ ITDGRANISL +S          A     Q +KDE+LE+A K+Y  G+ LL+I
Sbjct  571  NQIVIILITDGRANISLSQSL------GQPAQETEKQNIKDEVLEIATKLYSFGLQLLLI  624

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            DTENKF+STGF  E+A+ A GKYY LP AS   I+A
Sbjct  625  DTENKFISTGFLAEVAQHACGKYYQLPKASQRDIAA  660



>ref|WP_040466875.1| magnesium chelatase [Geminocystis herdmanii]
Length=687

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 166/213 (78%), Gaps = 6/213 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
            +R+V VE+ D+R+KR+ARKAGAL++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV
Sbjct  470  NRRVIVEQGDLRSKRLARKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQV  529

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP+RSI++AR RLE LPCGGGSPL+H LT AV VG+NA+ SGD+G+
Sbjct  530  ALIPFRGEQADVLLPPTRSITLARTRLETLPCGGGSPLSHALTQAVHVGVNAQMSGDIGQ  589

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR NI L RS                 ++K E+L++A KI   GM LLVIDT
Sbjct  590  VVIVAITDGRGNIPLARS------LGETLEEGEKPDIKAELLDIATKIRAMGMKLLVIDT  643

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVIS  146
            E KFVSTGF KE+AK A G YY LP A+D  I+
Sbjct  644  EKKFVSTGFGKELAKQAGGTYYQLPKATDQAIA  676



>ref|WP_006529845.1| magnesium chelatase ATPase subunit D [Gloeocapsa sp. PCC 73106]
 gb|ELR97268.1| magnesium chelatase ATPase subunit D [Gloeocapsa sp. PCC 73106]
Length=657

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 168/213 (79%), Gaps = 6/213 (3%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R+V VE  D+R+KR+ RKAG+L+IFVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQV+
Sbjct  440  RRVIVESGDIRSKRLVRKAGSLIIFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVA  499

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ A+VLLPP+RSI++A+ RLE LPCGGGSPLAHGLT AV VGMNA  SGD+G++
Sbjct  500  LIPFRGERADVLLPPTRSIALAKVRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQV  559

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS        +        ++K E+L +A KI   G+ LLVIDTE
Sbjct  560  VIVAITDGRGNIPLARSLGENLEGEAKP------DIKAELLAIATKIRTLGLKLLVIDTE  613

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
             +FVSTGFAKE+A+ A GK+Y+LP A++ +I+A
Sbjct  614  RQFVSTGFAKELAQTAGGKHYHLPKANEQMIAA  646



>ref|WP_028947660.1| magnesium chelatase [Synechocystis sp. PCC 6714]
 gb|AIE74923.1| Protoporphyrin IX Mg-chelatase subunit D [Synechocystis sp. PCC 
6714]
Length=676

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 168/216 (78%), Gaps = 6/216 (3%)
 Frame = -1

Query  790  QKSRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRD  611
               R+V VE+ D+R K++ RKAGAL++F+VDASGSMALNRMQ AKGA ++LL E+Y +RD
Sbjct  457  HPDRQVIVEQGDIRGKKLVRKAGALIVFLVDASGSMALNRMQAAKGAVMQLLTEAYENRD  516

Query  610  QVSIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDV  431
            QVS+IPF+G++AEVLLPP+RSI+MA+KRLE LPCGGGSPL+HGL  AV VG+NA+ SGD+
Sbjct  517  QVSLIPFQGENAEVLLPPTRSIAMAKKRLETLPCGGGSPLSHGLMQAVNVGINAKHSGDI  576

Query  430  GRIMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVI  251
            G+++IVAITDGR NI L RS         + P     ++K E+LE+A KI   GM LLVI
Sbjct  577  GQVVIVAITDGRGNIPLARSL------GDEIPEGEKPDIKAELLEIAAKIRGLGMQLLVI  630

Query  250  DTENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            +TE KFVSTGF KE+A+ A GKYY LP A+D  I++
Sbjct  631  NTEKKFVSTGFGKELAQKAGGKYYQLPKATDQGIAS  666



>dbj|GAL95165.1| protoporphyrin IX Mg-chelatase subunit D [Microcystis aeruginosa 
NIES-44]
Length=665

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_002799821.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI34724.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9701]
Length=665

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_012267152.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 dbj|BAG04400.1| magnesium protoporphyrin IX chelatase subunit D [Microcystis 
aeruginosa NIES-843]
Length=665

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_002761257.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCH98296.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9717]
Length=665

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_004162637.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI28046.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9809]
Length=665

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_002792527.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI22341.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9808]
Length=665

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_016516746.1| Magnesium-chelatase 38 kDa subunit [Microcystis aeruginosa]
 gb|EPF18941.1| Magnesium-chelatase 38 kDa subunit [Microcystis aeruginosa SPC777]
Length=665

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_002744710.1| magnesium chelatase ATPase subunit D [Microcystis aeruginosa]
 gb|ELS47390.1| magnesium chelatase ATPase subunit D [Microcystis aeruginosa 
DIANCHI905]
Length=665

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_008196613.1| magnesium-chelatase subunit ChlD [Microcystis sp. T1-4]
 emb|CCI30491.1| Magnesium-chelatase subunit ChlD [Microcystis sp. T1-4]
Length=665

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_002753131.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCH91758.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9432]
Length=665

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            +++VAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVVVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_015135326.1| protoporphyrin IX magnesium-chelatase [Leptolyngbya sp. PCC 7376]
 gb|AFY39583.1| protoporphyrin IX magnesium-chelatase [Leptolyngbya sp. PCC 7376]
Length=683

 Score =   248 bits (632),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 167/213 (78%), Gaps = 5/213 (2%)
 Frame = -1

Query  781  RKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVS  602
            R V VE+ D+R+KRMARKAG+L++F+VDASGSMALNRM  AKGA ++LL E+Y +RDQ++
Sbjct  467  RNVIVEQGDLRSKRMARKAGSLIVFLVDASGSMALNRMNAAKGAVMRLLTEAYENRDQIA  526

Query  601  IIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRI  422
            +IPFRG+ AEVLLPP+RSI++A+ RLE +PCGGGSPL+HGLT AV VGMNA+ SGDVG +
Sbjct  527  LIPFRGEMAEVLLPPTRSITLAKNRLETMPCGGGSPLSHGLTQAVHVGMNAKMSGDVGDV  586

Query  421  MIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDTE  242
            +IVAITDGR NI L RS              +  ++K+E+L++AGKI  +G  LL+IDTE
Sbjct  587  VIVAITDGRGNIPLARS-----LGEVPEEGEAKPDIKEELLDIAGKIRASGTKLLIIDTE  641

Query  241  NKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
             KF+S+GF KE+AK A GKYY LP A+D  I++
Sbjct  642  KKFISSGFGKELAKQAGGKYYRLPKATDQAIAS  674



>emb|CAO87035.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
Length=704

 Score =   248 bits (632),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  488  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  547

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT AV VGMNA  SGD+G+
Sbjct  548  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQAVHVGMNARLSGDIGQ  607

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  608  VVIVAITDGRSNIPLAKSLG------EPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  661

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  662  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  695



>ref|WP_004160664.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI13193.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
9806]
Length=665

 Score =   247 bits (630),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 169/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L+IFVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIIFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT  V VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQGVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_002776007.1| magnesium-chelatase subunit ChlD [Microcystis aeruginosa]
 emb|CCI06417.1| Magnesium-chelatase subunit ChlD [Microcystis aeruginosa PCC 
7941]
Length=665

 Score =   246 bits (629),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 169/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT  V VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQGVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



>ref|WP_002736428.1| magnesium chelatase ATPase subunit D [Microcystis aeruginosa]
 gb|ELP53999.1| magnesium chelatase ATPase subunit D [Microcystis aeruginosa 
TAIHU98]
Length=666

 Score =   246 bits (629),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 169/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  450  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  509

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT  V VGMNA  SGD+G+
Sbjct  510  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQGVHVGMNARLSGDIGQ  569

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  570  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  623

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  624  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  657



>ref|WP_024970736.1| magnesium chelatase [Microcystis aeruginosa]
Length=665

 Score =   246 bits (629),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 169/214 (79%), Gaps = 6/214 (3%)
 Frame = -1

Query  784  SRKVFVEKTDmrakrmarkAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV  605
             R V +E+ D+R+KR+ARKAG+L++FVVDASGSMALNRMQ+AKGA ++LL E+Y +RDQ+
Sbjct  449  ERHVIIEEGDLRSKRLARKAGSLIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQI  508

Query  604  SIIPFRGDSAEVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGR  425
            ++IPFRG+ A+VLLPP++SI++A+KRLE LPCGGGSPLAHGLT  V VGMNA  SGD+G+
Sbjct  509  ALIPFRGERADVLLPPTKSITLAKKRLETLPCGGGSPLAHGLTQGVHVGMNARLSGDIGQ  568

Query  424  IMIVAITDGRANISLKRSTDpeaaassdaprpsAQELKDEILEVAGKIYKAGMSLLVIDT  245
            ++IVAITDGR+NI L +S           P     ++K E+L++A KI   G+ LLVIDT
Sbjct  569  VVIVAITDGRSNIPLAKSL------GEPIPEGEKPDIKAELLDIAAKIRSLGIKLLVIDT  622

Query  244  ENKFVSTGFAKEIAKIAQGKYYYLPNASDAVISA  143
            E KFVSTGFAKE+A  A GKYY+LP A++  I++
Sbjct  623  EKKFVSTGFAKELALKAGGKYYHLPRATEQAIAS  656



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566999573790