BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022J04

Length=733
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002266672.1|  PREDICTED: probable aspartyl aminopeptidase ...    268   9e-83   Vitis vinifera
ref|XP_003591777.1|  Aspartyl aminopeptidase                            260   1e-82   
ref|XP_004249975.1|  PREDICTED: probable aspartyl aminopeptidase        267   2e-82   Solanum lycopersicum
ref|XP_006361458.1|  PREDICTED: probable aspartyl aminopeptidase-...    267   3e-82   Solanum tuberosum [potatoes]
ref|XP_009596186.1|  PREDICTED: probable aspartyl aminopeptidase        267   3e-82   Nicotiana tomentosiformis
ref|XP_009802964.1|  PREDICTED: probable aspartyl aminopeptidase        267   4e-82   Nicotiana sylvestris
ref|XP_003591778.1|  Aspartyl aminopeptidase                            259   9e-82   
ref|XP_007213437.1|  hypothetical protein PRUPE_ppa025466mg             262   7e-81   
ref|XP_008375605.1|  PREDICTED: probable aspartyl aminopeptidase        259   1e-80   
emb|CDO99897.1|  unnamed protein product                                263   1e-80   Coffea canephora [robusta coffee]
ref|XP_011076920.1|  PREDICTED: probable aspartyl aminopeptidase ...    260   6e-80   
gb|KJB78672.1|  hypothetical protein B456_013G012600                    261   6e-80   Gossypium raimondii
gb|KCW51474.1|  hypothetical protein EUGRSUZ_J00993                     255   1e-79   Eucalyptus grandis [rose gum]
gb|KHG01889.1|  Aspartyl aminopeptidase                                 261   1e-79   Gossypium arboreum [tree cotton]
ref|XP_011076919.1|  PREDICTED: probable aspartyl aminopeptidase ...    260   2e-79   Sesamum indicum [beniseed]
ref|XP_009336015.1|  PREDICTED: probable aspartyl aminopeptidase ...    259   2e-79   Pyrus x bretschneideri [bai li]
ref|XP_008347038.1|  PREDICTED: probable aspartyl aminopeptidase        259   2e-79   
gb|AES62027.2|  aspartyl aminopeptidase-like protein, putative          259   2e-79   Medicago truncatula
ref|XP_008232012.1|  PREDICTED: probable aspartyl aminopeptidase        259   3e-79   Prunus mume [ume]
ref|XP_010244532.1|  PREDICTED: probable aspartyl aminopeptidase ...    259   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_009336013.1|  PREDICTED: probable aspartyl aminopeptidase ...    259   3e-79   Pyrus x bretschneideri [bai li]
gb|KDO42030.1|  hypothetical protein CISIN_1g009941mg                   255   4e-79   Citrus sinensis [apfelsine]
ref|XP_007010329.1|  Zn-dependent exopeptidases superfamily prote...    258   4e-79   
ref|XP_003591776.1|  Aspartyl aminopeptidase                            259   4e-79   
ref|XP_010694702.1|  PREDICTED: probable aspartyl aminopeptidase ...    257   1e-78   
gb|KGN52197.1|  hypothetical protein Csa_5G615200                       258   1e-78   
ref|XP_004150844.1|  PREDICTED: probable aspartyl aminopeptidase-...    258   1e-78   
ref|XP_010694701.1|  PREDICTED: probable aspartyl aminopeptidase ...    258   1e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004496198.1|  PREDICTED: probable aspartyl aminopeptidase-...    258   1e-78   
gb|KDO42028.1|  hypothetical protein CISIN_1g009941mg                   256   1e-78   Citrus sinensis [apfelsine]
ref|XP_008446766.1|  PREDICTED: probable aspartyl aminopeptidase        257   2e-78   Cucumis melo [Oriental melon]
ref|XP_007143804.1|  hypothetical protein PHAVU_007G103100g             257   2e-78   Phaseolus vulgaris [French bean]
gb|KDO42027.1|  hypothetical protein CISIN_1g009941mg                   256   3e-78   Citrus sinensis [apfelsine]
ref|XP_010088778.1|  Aspartyl aminopeptidase                            256   3e-78   Morus notabilis
ref|XP_006436620.1|  hypothetical protein CICLE_v10031166mg             256   4e-78   
ref|XP_010032079.1|  PREDICTED: probable aspartyl aminopeptidase ...    256   4e-78   Eucalyptus grandis [rose gum]
ref|XP_006485213.1|  PREDICTED: probable aspartyl aminopeptidase-...    256   6e-78   Citrus sinensis [apfelsine]
ref|XP_006436621.1|  hypothetical protein CICLE_v10031166mg             256   7e-78   
ref|XP_003556268.2|  PREDICTED: probable aspartyl aminopeptidase-...    256   9e-78   Glycine max [soybeans]
gb|KHN00906.1|  Aspartyl aminopeptidase                                 255   1e-77   Glycine soja [wild soybean]
ref|XP_009356123.1|  PREDICTED: probable aspartyl aminopeptidase        253   5e-77   Pyrus x bretschneideri [bai li]
ref|XP_010907134.1|  PREDICTED: probable aspartyl aminopeptidase ...    250   9e-77   
ref|XP_002311031.2|  hypothetical protein POPTR_0008s02250g             251   1e-76   
tpg|DAA55692.1|  TPA: hypothetical protein ZEAMMB73_277076              241   1e-76   
emb|CDX70207.1|  BnaA10g25560D                                          252   2e-76   
ref|XP_010543610.1|  PREDICTED: probable aspartyl aminopeptidase        252   2e-76   Tarenaya hassleriana [spider flower]
emb|CDY44874.1|  BnaC09g50740D                                          251   3e-76   Brassica napus [oilseed rape]
ref|XP_002311016.2|  hypothetical protein POPTR_0008s02250g             251   3e-76   
ref|XP_011032849.1|  PREDICTED: probable aspartyl aminopeptidase        251   5e-76   Populus euphratica
ref|XP_006398926.1|  hypothetical protein EUTSA_v10013255mg             251   5e-76   Eutrema salsugineum [saltwater cress]
ref|XP_009122574.1|  PREDICTED: probable aspartyl aminopeptidase        250   6e-76   Brassica rapa
gb|EMT26810.1|  Aspartyl aminopeptidase                                 244   7e-76   
gb|EYU19780.1|  hypothetical protein MIMGU_mgv1a004147mg                251   7e-76   Erythranthe guttata [common monkey flower]
ref|XP_006287486.1|  hypothetical protein CARUB_v10000697mg             250   1e-75   Capsella rubella
ref|XP_010907133.1|  PREDICTED: probable aspartyl aminopeptidase ...    250   1e-75   Elaeis guineensis
ref|XP_010490993.1|  PREDICTED: probable aspartyl aminopeptidase        249   2e-75   Camelina sativa [gold-of-pleasure]
gb|KDP35783.1|  hypothetical protein JCGZ_10419                         249   3e-75   Jatropha curcas
ref|XP_003565148.1|  PREDICTED: probable aspartyl aminopeptidase        248   5e-75   Brachypodium distachyon [annual false brome]
ref|XP_002873165.1|  hypothetical protein ARALYDRAFT_487250             248   6e-75   
ref|XP_006645339.1|  PREDICTED: probable aspartyl aminopeptidase-...    248   7e-75   Oryza brachyantha
ref|NP_196091.1|  Zn-dependent exopeptidases superfamily protein        248   8e-75   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43404.1|  putative aspartyl aminopeptidase                       248   9e-75   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001045513.1|  Os01g0967900                                       247   1e-74   
ref|XP_010423546.1|  PREDICTED: probable aspartyl aminopeptidase        248   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008788174.1|  PREDICTED: probable aspartyl aminopeptidase        247   2e-74   Phoenix dactylifera
gb|KFK24913.1|  hypothetical protein AALP_AA8G041200                    246   3e-74   Arabis alpina [alpine rockcress]
ref|XP_010452373.1|  PREDICTED: probable aspartyl aminopeptidase        246   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008674488.1|  PREDICTED: probable aspartyl aminopeptidase        243   4e-74   
ref|XP_002524995.1|  Aspartyl aminopeptidase, putative                  246   4e-74   Ricinus communis
dbj|BAJ86698.1|  predicted protein                                      245   4e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC72239.1|  hypothetical protein OsI_05355                          244   5e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_004971394.1|  PREDICTED: probable aspartyl aminopeptidase-...    243   3e-73   Setaria italica
ref|XP_004971395.1|  PREDICTED: probable aspartyl aminopeptidase-...    243   3e-73   
ref|XP_002457006.1|  hypothetical protein SORBIDRAFT_03g047100          242   9e-73   Sorghum bicolor [broomcorn]
ref|XP_009390025.1|  PREDICTED: probable aspartyl aminopeptidase        242   2e-72   
gb|KHN37829.1|  Aspartyl aminopeptidase                                 241   2e-72   Glycine soja [wild soybean]
gb|EPS58587.1|  aspartyl aminopeptidase                                 235   2e-70   Genlisea aurea
ref|XP_006851486.1|  hypothetical protein AMTR_s00040p00143220          233   8e-69   
ref|XP_002975004.1|  hypothetical protein SELMODRAFT_442726             221   4e-65   
ref|XP_002977420.1|  hypothetical protein SELMODRAFT_176342             219   8e-65   
ref|XP_001420830.1|  predicted protein                                  215   7e-63   Ostreococcus lucimarinus CCE9901
gb|ABR25597.1|  aspartyl aminopeptidase                                 204   2e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_001751765.1|  predicted protein                                  213   5e-62   
ref|XP_008360788.1|  PREDICTED: probable aspartyl aminopeptidase        203   2e-61   
ref|XP_011024060.1|  PREDICTED: probable aspartyl aminopeptidase        211   4e-61   Populus euphratica
ref|XP_003082377.1|  aspartyl aminopeptidase (ISS)                      210   9e-61   
dbj|BAK02635.1|  predicted protein                                      200   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CEF99925.1|  Peptidase M18                                          210   2e-60   Ostreococcus tauri
ref|XP_008464464.1|  PREDICTED: probable aspartyl aminopeptidase ...    209   2e-60   Cucumis melo [Oriental melon]
ref|XP_011044185.1|  PREDICTED: probable aspartyl aminopeptidase        208   4e-60   Populus euphratica
ref|XP_002318119.2|  aspartyl aminopeptidase family protein             208   4e-60   
ref|XP_004138058.1|  PREDICTED: probable aspartyl aminopeptidase-...    208   4e-60   
ref|XP_004165826.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    208   5e-60   
gb|KGN63496.1|  hypothetical protein Csa_1G002160                       208   7e-60   
gb|KFK26680.1|  hypothetical protein AALP_AA8G278900                    207   1e-59   Arabis alpina [alpine rockcress]
ref|XP_002321687.1|  aspartyl aminopeptidase family protein             207   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_002511215.1|  Aspartyl aminopeptidase, putative                  206   2e-59   
ref|XP_008239439.1|  PREDICTED: probable aspartyl aminopeptidase        206   2e-59   Prunus mume [ume]
ref|XP_002963681.1|  hypothetical protein SELMODRAFT_80579              206   2e-59   
emb|CDY34036.1|  BnaC03g27790D                                          206   2e-59   Brassica napus [oilseed rape]
ref|XP_009134060.1|  PREDICTED: probable aspartyl aminopeptidase        206   2e-59   Brassica rapa
emb|CDX83160.1|  BnaA03g23460D                                          206   2e-59   
ref|NP_200824.1|  zn-dependent exopeptidases superfamily protein        206   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61631.1|  aspartyl aminopeptidase-like protein                    206   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536640.1|  PREDICTED: probable aspartyl aminopeptidase        206   3e-59   Tarenaya hassleriana [spider flower]
ref|NP_001066463.1|  Os12g0236500                                       206   3e-59   
ref|XP_002866374.1|  hypothetical protein ARALYDRAFT_332278             205   4e-59   Arabidopsis lyrata subsp. lyrata
sp|B9RAJ0.2|DNPEP_RICCO  RecName: Full=Probable aspartyl aminopep...    206   4e-59   Ricinus communis
ref|XP_002974770.1|  hypothetical protein SELMODRAFT_101663             206   5e-59   
tpg|DAA58400.1|  TPA: hypothetical protein ZEAMMB73_107325              201   5e-59   
ref|XP_007209960.1|  hypothetical protein PRUPE_ppa004869mg             205   7e-59   Prunus persica
ref|XP_006664453.1|  PREDICTED: probable aspartyl aminopeptidase-...    204   1e-58   Oryza brachyantha
gb|AFK46082.1|  unknown                                                 204   1e-58   Lotus japonicus
ref|XP_006476998.1|  PREDICTED: probable aspartyl aminopeptidase-...    204   1e-58   Citrus sinensis [apfelsine]
ref|XP_006402123.1|  hypothetical protein EUTSA_v10015798mg             203   2e-58   
ref|XP_007037930.1|  Zn-dependent exopeptidases superfamily protein     204   2e-58   
gb|EYU43065.1|  hypothetical protein MIMGU_mgv1a005789mg                203   3e-58   Erythranthe guttata [common monkey flower]
ref|XP_010674696.1|  PREDICTED: probable aspartyl aminopeptidase        203   3e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006440072.1|  hypothetical protein CICLE_v10019750mg             204   3e-58   Citrus clementina [clementine]
ref|XP_011083884.1|  PREDICTED: probable aspartyl aminopeptidase        203   3e-58   Sesamum indicum [beniseed]
gb|KHF99832.1|  Aspartyl aminopeptidase                                 202   3e-58   Gossypium arboreum [tree cotton]
ref|XP_002458215.1|  hypothetical protein SORBIDRAFT_03g029130          202   4e-58   Sorghum bicolor [broomcorn]
ref|XP_006280394.1|  hypothetical protein CARUB_v10026321mg             202   4e-58   Capsella rubella
ref|XP_003578741.1|  PREDICTED: probable aspartyl aminopeptidase        202   6e-58   Brachypodium distachyon [annual false brome]
ref|XP_009346502.1|  PREDICTED: probable aspartyl aminopeptidase        202   8e-58   Pyrus x bretschneideri [bai li]
ref|NP_001159225.1|  hypothetical protein                               200   9e-58   Zea mays [maize]
ref|XP_008374264.1|  PREDICTED: probable aspartyl aminopeptidase        202   1e-57   Malus domestica [apple tree]
ref|XP_010456062.1|  PREDICTED: probable aspartyl aminopeptidase        201   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_006826610.1|  hypothetical protein AMTR_s00138p00074300          198   1e-57   
ref|XP_009336570.1|  PREDICTED: probable aspartyl aminopeptidase        201   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_009359462.1|  PREDICTED: probable aspartyl aminopeptidase        201   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_010483659.1|  PREDICTED: probable aspartyl aminopeptidase        201   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010443807.1|  PREDICTED: probable aspartyl aminopeptidase        201   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008673044.1|  PREDICTED: hypothetical protein isoform X1         201   2e-57   Zea mays [maize]
ref|XP_003526970.1|  PREDICTED: probable aspartyl aminopeptidase-...    201   2e-57   Glycine max [soybeans]
ref|XP_007137936.1|  hypothetical protein PHAVU_009G167900g             200   3e-57   Phaseolus vulgaris [French bean]
ref|XP_008367478.1|  PREDICTED: probable aspartyl aminopeptidase        200   4e-57   
ref|XP_008392833.1|  PREDICTED: probable aspartyl aminopeptidase        200   4e-57   
ref|XP_004500663.1|  PREDICTED: probable aspartyl aminopeptidase-...    200   4e-57   Cicer arietinum [garbanzo]
ref|XP_004960722.1|  PREDICTED: probable aspartyl aminopeptidase-...    200   5e-57   Setaria italica
ref|XP_010102886.1|  Aspartyl aminopeptidase                            200   5e-57   
ref|XP_009379936.1|  PREDICTED: probable aspartyl aminopeptidase        199   7e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010026684.1|  PREDICTED: probable aspartyl aminopeptidase        199   8e-57   Eucalyptus grandis [rose gum]
ref|XP_009404266.1|  PREDICTED: probable aspartyl aminopeptidase        199   9e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001756754.1|  predicted protein                                  199   1e-56   
gb|KJB27155.1|  hypothetical protein B456_004G282900                    198   2e-56   Gossypium raimondii
gb|KJB27157.1|  hypothetical protein B456_004G282900                    198   2e-56   Gossypium raimondii
gb|KJB27156.1|  hypothetical protein B456_004G282900                    198   2e-56   Gossypium raimondii
ref|XP_003602076.1|  Aspartyl aminopeptidase                            198   2e-56   Medicago truncatula
gb|KCW83184.1|  hypothetical protein EUGRSUZ_B00132                     199   2e-56   Eucalyptus grandis [rose gum]
ref|XP_002283475.1|  PREDICTED: probable aspartyl aminopeptidase        198   3e-56   Vitis vinifera
emb|CDP05422.1|  unnamed protein product                                198   3e-56   Coffea canephora [robusta coffee]
ref|XP_006351481.1|  PREDICTED: probable aspartyl aminopeptidase-...    198   3e-56   Solanum tuberosum [potatoes]
ref|XP_011463290.1|  PREDICTED: probable aspartyl aminopeptidase        197   3e-56   Fragaria vesca subsp. vesca
ref|XP_009624334.1|  PREDICTED: probable aspartyl aminopeptidase        197   4e-56   Nicotiana tomentosiformis
ref|XP_010248918.1|  PREDICTED: probable aspartyl aminopeptidase ...    197   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009790447.1|  PREDICTED: probable aspartyl aminopeptidase        197   6e-56   Nicotiana sylvestris
ref|XP_003523136.1|  PREDICTED: probable aspartyl aminopeptidase-...    197   7e-56   Glycine max [soybeans]
ref|XP_004236341.1|  PREDICTED: probable aspartyl aminopeptidase        197   7e-56   Solanum lycopersicum
gb|EPS62030.1|  aspartyl aminopeptidase-like protein                    196   8e-56   Genlisea aurea
gb|KDP30945.1|  hypothetical protein JCGZ_11321                         197   8e-56   Jatropha curcas
ref|XP_004172613.1|  PREDICTED: probable aspartyl aminopeptidase-...    194   2e-55   
ref|XP_008807558.1|  PREDICTED: probable aspartyl aminopeptidase ...    194   5e-55   Phoenix dactylifera
ref|XP_008807556.1|  PREDICTED: probable aspartyl aminopeptidase ...    194   6e-55   
gb|ABR17053.1|  unknown                                                 194   8e-55   Picea sitchensis
ref|XP_010930126.1|  PREDICTED: probable aspartyl aminopeptidase        194   9e-55   Elaeis guineensis
gb|KCW51472.1|  hypothetical protein EUGRSUZ_J00993                     194   9e-55   Eucalyptus grandis [rose gum]
gb|KJB19571.1|  hypothetical protein B456_003G109700                    190   1e-54   Gossypium raimondii
gb|KDO42029.1|  hypothetical protein CISIN_1g009941mg                   194   2e-54   Citrus sinensis [apfelsine]
ref|XP_002507546.1|  aspartyl aminopeptidase                            193   3e-54   Micromonas commoda
gb|KJB19572.1|  hypothetical protein B456_003G109700                    190   1e-53   Gossypium raimondii
ref|XP_004138060.1|  PREDICTED: probable aspartyl aminopeptidase-...    190   3e-53   
ref|XP_004165827.1|  PREDICTED: probable aspartyl aminopeptidase-...    190   3e-53   
dbj|BAD94988.1|  aspartyl aminopeptidase                                178   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010694703.1|  PREDICTED: probable aspartyl aminopeptidase ...    189   7e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS55846.1|  Aspartyl aminopeptidase                                 191   8e-53   Triticum urartu
ref|XP_008464465.1|  PREDICTED: probable aspartyl aminopeptidase ...    189   9e-53   Cucumis melo [Oriental melon]
ref|XP_002907085.1|  aspartyl aminopeptidase, putative                  188   1e-52   Phytophthora infestans T30-4
ref|XP_001690598.1|  aspartyl aminopeptidase-like protein               188   6e-52   Chlamydomonas reinhardtii
ref|XP_004336070.1|  aspartyl aminopeptidase                            184   6e-52   Acanthamoeba castellanii str. Neff
ref|XP_008909814.1|  hypothetical protein PPTG_14635                    186   7e-52   Phytophthora parasitica INRA-310
ref|XP_009519985.1|  hypothetical protein PHYSODRAFT_539739             185   2e-51   Phytophthora sojae
ref|XP_007512692.1|  predicted protein                                  185   9e-51   Bathycoccus prasinos
ref|XP_003060266.1|  predicted protein                                  180   7e-50   Micromonas pusilla CCMP1545
gb|EMT03759.1|  Aspartyl aminopeptidase                                 185   7e-50   
ref|XP_003055398.1|  predicted protein                                  178   9e-49   Micromonas pusilla CCMP1545
ref|XP_005648131.1|  peptidase M18, aminopeptidase I                    177   3e-48   Coccomyxa subellipsoidea C-169
ref|XP_011396821.1|  Aspartyl aminopeptidase                            175   1e-47   Auxenochlorella protothecoides
emb|CEJ00699.1|  Putative Aspartyl aminopeptidase                       171   1e-47   Rhizopus microsporus
ref|XP_007514776.1|  predicted protein                                  175   2e-47   Bathycoccus prasinos
gb|ETO14766.1|  hypothetical protein RFI_22603                          164   6e-47   Reticulomyxa filosa
gb|EXX59698.1|  Ape4p                                                   172   8e-47   Rhizophagus irregularis DAOM 197198w
ref|XP_004346183.2|  aspartyl aminopeptidase                            173   8e-47   Capsaspora owczarzaki ATCC 30864
gb|KJE94975.1|  aspartyl aminopeptidase                                 172   8e-47   Capsaspora owczarzaki ATCC 30864
ref|XP_001421486.1|  predicted protein                                  173   1e-46   Ostreococcus lucimarinus CCE9901
ref|XP_002505350.1|  predicted protein                                  172   1e-46   Micromonas commoda
gb|ESA11968.1|  hypothetical protein GLOINDRAFT_335422                  172   1e-46   
emb|CEG01789.1|  Peptidase M18                                          172   2e-46   Ostreococcus tauri
emb|CCA15777.1|  aspartyl aminopeptidase putative                       170   5e-46   Albugo laibachii Nc14
emb|CEG81490.1|  Putative Aspartyl aminopeptidase                       169   9e-46   Rhizopus microsporus
emb|CCI46763.1|  unnamed protein product                                171   1e-45   Albugo candida
ref|XP_003083329.1|  aspartyl aminopeptidase (ISS)                      173   2e-45   
ref|XP_002678138.1|  predicted protein                                  167   9e-45   Naegleria gruberi strain NEG-M
ref|XP_008863481.1|  hypothetical protein H310_01914                    167   1e-44   Aphanomyces invadans
ref|XP_011457668.1|  PREDICTED: probable aspartyl aminopeptidase        158   1e-44   Fragaria vesca subsp. vesca
gb|EPB92944.1|  aspartyl aminopeptidase                                 166   2e-44   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008620058.1|  aspartyl aminopeptidase                            166   2e-44   Saprolegnia diclina VS20
dbj|GAN09714.1|  aspartyl aminopeptidase                                166   2e-44   Mucor ambiguus
gb|KDO32253.1|  hypothetical protein SPRG_02733                         166   2e-44   Saprolegnia parasitica CBS 223.65
gb|EPB84012.1|  aspartyl aminopeptidase                                 167   2e-44   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002960428.1|  hypothetical protein SELMODRAFT_164111             166   3e-44   
ref|XP_002967289.1|  hypothetical protein SELMODRAFT_86972              166   5e-44   
emb|CDS03243.1|  hypothetical protein LRAMOSA00645                      165   5e-44   Lichtheimia ramosa
ref|XP_009825683.1|  hypothetical protein H257_03355                    165   5e-44   Aphanomyces astaci
dbj|GAN06933.1|  aspartyl aminopeptidase                                166   6e-44   Mucor ambiguus
gb|EIE78284.1|  hypothetical protein RO3G_02988                         164   7e-44   Rhizopus delemar RA 99-880
ref|XP_002129082.1|  PREDICTED: aspartyl aminopeptidase-like            163   2e-43   Ciona intestinalis [sea vase]
emb|CDH60153.1|  aspartyl aminopeptidase                                163   7e-43   Lichtheimia corymbifera JMRC:FSU:9682
gb|EIE88868.1|  hypothetical protein RO3G_13579                         162   8e-43   Rhizopus delemar RA 99-880
emb|CEP14293.1|  hypothetical protein                                   162   1e-42   Parasitella parasitica
ref|XP_009025082.1|  hypothetical protein HELRODRAFT_187369             161   1e-42   Helobdella robusta
emb|CEJ04001.1|  Putative Aspartyl aminopeptidase                       161   2e-42   Rhizopus microsporus
emb|CEI95696.1|  Putative Aspartyl aminopeptidase                       161   2e-42   Rhizopus microsporus
emb|CEG69346.1|  Putative Aspartyl aminopeptidase                       161   3e-42   Rhizopus microsporus
emb|CEG81693.1|  Putative Aspartyl aminopeptidase                       160   3e-42   Rhizopus microsporus
ref|XP_007879166.1|  hypothetical protein PFL1_03458                    159   2e-41   Anthracocystis flocculosa PF-1
ref|XP_005849269.1|  hypothetical protein CHLNCDRAFT_143544             158   3e-41   Chlorella variabilis
emb|CBQ68247.1|  probable aspartyl aminopeptidase                       157   8e-41   Sporisorium reilianum SRZ2
ref|XP_004994670.1|  aspartyl aminopeptidase                            156   9e-41   Salpingoeca rosetta
ref|XP_001745410.1|  hypothetical protein                               156   1e-40   Monosiga brevicollis MX1
emb|CCF51316.1|  probable aspartyl aminopeptidase                       156   1e-40   Ustilago hordei
emb|CDI51753.1|  probable aspartyl aminopeptidase                       155   2e-40   Melanopsichium pennsylvanicum 4
ref|XP_004361073.1|  aspartyl aminopeptidase                            156   2e-40   Cavenderia fasciculata
gb|ELU07857.1|  hypothetical protein CAPTEDRAFT_158105                  155   3e-40   Capitella teleta
ref|XP_005415861.1|  PREDICTED: aspartyl aminopeptidase                 146   3e-40   
dbj|GAC99602.1|  aspartyl aminopeptidase                                155   4e-40   Pseudozyma hubeiensis SY62
ref|NP_001279935.1|  aspartyl aminopeptidase                            154   5e-40   Callorhinchus milii [Australian ghost shark]
ref|XP_011386806.1|  putative aspartyl aminopeptidase                   154   5e-40   Ustilago maydis 521
gb|AFK11572.1|  aspartyl aminopeptidase                                 154   6e-40   Callorhinchus milii [Australian ghost shark]
gb|KDN49618.1|  putative aspartyl aminopeptidase                        154   6e-40   Tilletiaria anomala UBC 951
ref|XP_002289000.1|  probable aspartyl aminopeptidase                   153   1e-39   Thalassiosira pseudonana CCMP1335
ref|XP_007883309.1|  PREDICTED: aspartyl aminopeptidase                 154   1e-39   Callorhinchus milii [Australian ghost shark]
gb|EWC43491.1|  aspartyl aminopeptidase                                 153   2e-39   Drechslerella stenobrocha 248
ref|XP_001837079.1|  aspartyl aminopeptidase                            152   2e-39   Coprinopsis cinerea okayama7#130
gb|ABQ22407.1|  aspartyl aminopeptidase-like protein                    146   2e-39   Callithrix jacchus [common marmoset]
gb|KFQ24176.1|  Aspartyl aminopeptidase                                 147   2e-39   Merops nubicus
ref|XP_008947935.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-39   Merops nubicus
ref|XP_006683342.1|  hypothetical protein BATDEDRAFT_18145              151   6e-39   Batrachochytrium dendrobatidis JAM81
ref|XP_009033025.1|  hypothetical protein AURANDRAFT_20254              151   6e-39   Aureococcus anophagefferens
ref|XP_010181866.1|  PREDICTED: aspartyl aminopeptidase                 149   8e-39   Mesitornis unicolor
ref|XP_002155387.2|  PREDICTED: aspartyl aminopeptidase-like            150   1e-38   
ref|XP_011481489.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    150   1e-38   
ref|XP_003446617.1|  PREDICTED: aspartyl aminopeptidase-like isof...    150   1e-38   Oreochromis niloticus
ref|XP_006035444.1|  PREDICTED: aspartyl aminopeptidase                 150   1e-38   
ref|XP_005452349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    150   1e-38   Oreochromis niloticus
ref|XP_002840917.1|  hypothetical protein                               150   1e-38   Tuber melanosporum Mel28
ref|XP_002592514.1|  hypothetical protein BRAFLDRAFT_69005              150   2e-38   Branchiostoma floridae
ref|XP_008323212.1|  PREDICTED: aspartyl aminopeptidase isoform X2      150   2e-38   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004563350.1|  PREDICTED: aspartyl aminopeptidase-like isof...    150   2e-38   Maylandia zebra
ref|XP_008323213.1|  PREDICTED: aspartyl aminopeptidase isoform X3      150   2e-38   
ref|XP_008323211.1|  PREDICTED: aspartyl aminopeptidase isoform X1      150   2e-38   
dbj|GAC74074.1|  histone acetyltransferase                              154   2e-38   Moesziomyces antarcticus T-34
ref|XP_004563349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    150   2e-38   Maylandia zebra
dbj|GAK61818.1|  acyltransferase                                        154   2e-38   Moesziomyces antarcticus
ref|XP_005330568.1|  PREDICTED: aspartyl aminopeptidase                 150   2e-38   Ictidomys tridecemlineatus
gb|KIK06798.1|  hypothetical protein K443DRAFT_674082                   150   2e-38   Laccaria amethystina LaAM-08-1
gb|EJK61550.1|  hypothetical protein THAOC_17943                        150   2e-38   Thalassiosira oceanica
gb|ETS64061.1|  hypothetical protein PaG_02398                          154   3e-38   Moesziomyces aphidis DSM 70725
ref|XP_007575368.1|  PREDICTED: aspartyl aminopeptidase isoform X1      149   3e-38   Poecilia formosa
gb|KFQ19689.1|  Aspartyl aminopeptidase                                 148   3e-38   Mesitornis unicolor
ref|XP_007575369.1|  PREDICTED: aspartyl aminopeptidase isoform X2      149   3e-38   Poecilia formosa
ref|XP_009553937.1|  PREDICTED: aspartyl aminopeptidase                 148   4e-38   Cuculus canorus
gb|KFO72178.1|  Aspartyl aminopeptidase                                 148   4e-38   Cuculus canorus
gb|EST06743.1|  histone acetyltransferase                               153   4e-38   Kalmanozyma brasiliensis GHG001
ref|XP_005154153.1|  PREDICTED: aspartyl aminopeptidase                 149   4e-38   Melopsittacus undulatus
ref|XP_010022905.1|  PREDICTED: aspartyl aminopeptidase                 147   4e-38   Nestor notabilis
gb|EPY30718.1|  aspartyl aminopeptidase                                 144   4e-38   Strigomonas culicis
ref|XP_011123681.1|  hypothetical protein AOL_s00083g200                149   4e-38   Arthrobotrys oligospora ATCC 24927
gb|KFQ45573.1|  Aspartyl aminopeptidase                                 147   5e-38   Nestor notabilis
ref|XP_005279931.1|  PREDICTED: aspartyl aminopeptidase                 149   5e-38   
ref|XP_006272731.1|  PREDICTED: aspartyl aminopeptidase                 149   5e-38   
gb|EJT49728.1|  aspartyl aminopeptidase                                 149   5e-38   
gb|ENH77871.1|  aspartyl aminopeptidase                                 149   6e-38   
ref|XP_009069815.1|  PREDICTED: aspartyl aminopeptidase                 147   7e-38   
ref|XP_002736578.1|  PREDICTED: aspartyl aminopeptidase-like            145   7e-38   
gb|EMC84232.1|  Aspartyl aminopeptidase                                 147   8e-38   
emb|CEJ81993.1|  Putative Aspartyl aminopeptidase                       149   8e-38   
gb|KFP77222.1|  Aspartyl aminopeptidase                                 147   8e-38   
ref|NP_001172115.1|  aspartyl aminopeptidase                            148   8e-38   
ref|XP_007068759.1|  PREDICTED: aspartyl aminopeptidase                 147   9e-38   
ref|XP_005101285.1|  PREDICTED: aspartyl aminopeptidase-like            148   9e-38   
gb|KEZ42556.1|  Aspartyl aminopeptidase                                 148   1e-37   
gb|KFV81952.1|  Aspartyl aminopeptidase                                 146   1e-37   
ref|XP_008293067.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   1e-37   
ref|XP_002712541.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   1e-37   
ref|XP_005814088.1|  PREDICTED: aspartyl aminopeptidase-like            147   1e-37   
ref|XP_008257444.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   1e-37   
dbj|GAM24522.1|  hypothetical protein SAMD00019534_076970               148   1e-37   
ref|XP_008293068.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   1e-37   
ref|XP_010405218.1|  PREDICTED: aspartyl aminopeptidase                 147   1e-37   
gb|KGL86427.1|  Aspartyl aminopeptidase                                 147   1e-37   
gb|KFO52747.1|  Aspartyl aminopeptidase                                 147   1e-37   
gb|KFQ94690.1|  Aspartyl aminopeptidase                                 147   2e-37   
ref|XP_007234617.1|  PREDICTED: aspartyl aminopeptidase                 147   2e-37   
ref|XP_005361637.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   2e-37   
emb|CCF41181.1|  aspartyl aminopeptidase                                147   2e-37   
ref|XP_005361636.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   2e-37   
ref|XP_003510642.1|  PREDICTED: aspartyl aminopeptidase                 147   2e-37   
ref|XP_007279968.1|  aspartyl aminopeptidase                            145   2e-37   
gb|ETE70732.1|  Aspartyl aminopeptidase                                 147   2e-37   
emb|CEP14325.1|  hypothetical protein                                   150   2e-37   
ref|WP_028469943.1|  aminopeptidase                                     146   2e-37   
ref|XP_005070528.1|  PREDICTED: aspartyl aminopeptidase                 147   2e-37   
gb|KFV63385.1|  Aspartyl aminopeptidase                                 147   2e-37   
dbj|GAM18899.1|  hypothetical protein SAMD00019534_020740               147   2e-37   
ref|XP_009674526.1|  PREDICTED: aspartyl aminopeptidase                 147   2e-37   
ref|XP_005498746.1|  PREDICTED: aspartyl aminopeptidase                 146   2e-37   
ref|XP_009882434.1|  PREDICTED: aspartyl aminopeptidase                 146   2e-37   
ref|XP_008626911.1|  PREDICTED: aspartyl aminopeptidase                 147   2e-37   
ref|XP_004576859.1|  PREDICTED: aspartyl aminopeptidase                 147   2e-37   
ref|XP_009460435.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
ref|XP_009086531.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
ref|XP_005049624.1|  PREDICTED: aspartyl aminopeptidase                 146   3e-37   
emb|CCE31713.1|  probable aspartyl aminopeptidase                       147   3e-37   
ref|XP_010748612.1|  PREDICTED: aspartyl aminopeptidase isoform X1      146   3e-37   
gb|KFU88502.1|  Aspartyl aminopeptidase                                 146   3e-37   
ref|XP_005610687.1|  PREDICTED: aspartyl aminopeptidase isoform X4      146   3e-37   
ref|XP_006245247.1|  PREDICTED: aspartyl aminopeptidase isoform X2      146   3e-37   
ref|XP_006906751.1|  PREDICTED: aspartyl aminopeptidase                 146   3e-37   
gb|ELK17177.1|  Aspartyl aminopeptidase                                 147   3e-37   
ref|XP_010567906.1|  PREDICTED: aspartyl aminopeptidase                 146   3e-37   
gb|KFY19397.1|  hypothetical protein V491_04461                         143   3e-37   
gb|ELR06737.1|  hypothetical protein GMDG_00354                         147   3e-37   
ref|XP_001492028.3|  PREDICTED: aspartyl aminopeptidase isoform X1      147   3e-37   
ref|XP_005610686.1|  PREDICTED: aspartyl aminopeptidase isoform X3      146   3e-37   
ref|XP_007600979.1|  aminopeptidase I zinc metalloprotease              147   3e-37   
ref|NP_001020050.1|  aspartyl aminopeptidase                            146   4e-37   
gb|AAD01212.1|  aspartyl aminopeptidase                                 146   4e-37   
ref|XP_006245246.1|  PREDICTED: aspartyl aminopeptidase isoform X1      146   4e-37   
ref|XP_009994576.1|  PREDICTED: aspartyl aminopeptidase                 146   4e-37   
gb|EFQ27027.1|  aminopeptidase I zinc metalloprotease                   146   4e-37   
ref|XP_010748613.1|  PREDICTED: aspartyl aminopeptidase isoform X2      146   4e-37   
ref|XP_005234414.1|  PREDICTED: aspartyl aminopeptidase                 146   4e-37   
ref|XP_005520045.1|  PREDICTED: aspartyl aminopeptidase                 146   4e-37   
gb|KGT71532.1|  aspartyl aminopeptidase                                 146   4e-37   
gb|KGR14305.1|  aspartyl aminopeptidase                                 146   4e-37   
gb|KHC89264.1|  aspartyl aminopeptidase                                 146   4e-37   
emb|CBY20487.1|  unnamed protein product                                146   4e-37   
ref|XP_010334577.1|  PREDICTED: aspartyl aminopeptidase isoform X4      146   4e-37   
gb|KHC84477.1|  aspartyl aminopeptidase                                 146   4e-37   
ref|XP_002417658.1|  aspartyl amino peptidase, putative                 146   4e-37   
gb|KHC41084.1|  aspartyl aminopeptidase                                 146   4e-37   
gb|KGQ90736.1|  aspartyl aminopeptidase                                 146   4e-37   
gb|KGL77727.1|  Aspartyl aminopeptidase                                 145   4e-37   
ref|XP_005610685.1|  PREDICTED: aspartyl aminopeptidase isoform X2      146   4e-37   
ref|XP_010334576.1|  PREDICTED: aspartyl aminopeptidase isoform X3      146   4e-37   
gb|KHC56043.1|  aspartyl aminopeptidase                                 146   4e-37   
gb|EEQ42153.1|  hypothetical protein CAWG_00351                         146   5e-37   
ref|XP_713998.1|  hypothetical protein CaO19.9871                       146   5e-37   
gb|KHC60383.1|  aspartyl aminopeptidase                                 146   5e-37   
ref|XP_008528206.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    146   5e-37   
ref|XP_008594228.1|  aminopeptidase I zinc metalloprotease              146   5e-37   
ref|XP_001877081.1|  aspartyl aminopeptidase                            145   5e-37   
ref|XP_006739743.1|  PREDICTED: aspartyl aminopeptidase                 146   5e-37   
gb|KGQ12368.1|  Aspartyl aminopeptidase                                 146   5e-37   
ref|XP_007956515.1|  PREDICTED: aspartyl aminopeptidase                 146   5e-37   
ref|XP_005485343.1|  PREDICTED: aspartyl aminopeptidase                 146   5e-37   
ref|XP_004402808.1|  PREDICTED: aspartyl aminopeptidase isoform 1       146   5e-37   
gb|KIL70156.1|  hypothetical protein M378DRAFT_156218                   145   5e-37   
ref|XP_010213657.1|  PREDICTED: aspartyl aminopeptidase                 145   5e-37   
ref|XP_006668022.1|  aspartyl aminopeptidase                            147   5e-37   
ref|XP_010334575.1|  PREDICTED: aspartyl aminopeptidase isoform X2      146   6e-37   
gb|ABY89804.1|  aspartyl aminopeptidase (predicted)                     145   6e-37   
ref|XP_004762907.1|  PREDICTED: aspartyl aminopeptidase isoform X6      146   6e-37   
ref|XP_003925541.1|  PREDICTED: aspartyl aminopeptidase isoform X1      146   6e-37   
ref|XP_008997791.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   6e-37   
ref|XP_004325560.1|  PREDICTED: aspartyl aminopeptidase isoform 3       145   6e-37   
ref|XP_004262732.1|  PREDICTED: aspartyl aminopeptidase isoform 2       145   6e-37   
ref|XP_004762903.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   6e-37   
ref|XP_008997792.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   6e-37   
ref|XP_004402809.1|  PREDICTED: aspartyl aminopeptidase isoform 2       145   6e-37   
gb|KFO95292.1|  Aspartyl aminopeptidase                                 145   6e-37   
ref|XP_003347186.1|  hypothetical protein SMAC_08078                    146   6e-37   
ref|XP_008495745.1|  PREDICTED: aspartyl aminopeptidase                 145   6e-37   
ref|XP_006867902.1|  PREDICTED: aspartyl aminopeptidase                 145   6e-37   
ref|XP_007086232.1|  PREDICTED: aspartyl aminopeptidase                 146   6e-37   
gb|KIO30255.1|  hypothetical protein M407DRAFT_157151                   146   6e-37   
ref|XP_004325558.1|  PREDICTED: aspartyl aminopeptidase isoform 1       146   7e-37   
ref|XP_009909456.1|  PREDICTED: aspartyl aminopeptidase                 146   7e-37   
ref|XP_008688803.1|  PREDICTED: aspartyl aminopeptidase                 146   7e-37   
gb|KFA55851.1|  hypothetical protein S40293_01900                       146   7e-37   
ref|NP_001085525.1|  aspartyl aminopeptidase                            145   7e-37   
ref|XP_004762902.1|  PREDICTED: aspartyl aminopeptidase isoform X1      146   7e-37   
gb|KFZ06387.1|  hypothetical protein V501_07458                         146   7e-37   
gb|KEY64841.1|  hypothetical protein S7711_08849                        145   7e-37   
gb|KIY46623.1|  peptidase M18, aminopeptidase I                         145   7e-37   
dbj|BAC30079.1|  unnamed protein product                                145   7e-37   
gb|AAH04854.2|  DNPEP protein                                           144   7e-37   
ref|NP_001104301.1|  aspartyl aminopeptidase isoform a                  145   7e-37   
ref|XP_004262731.1|  PREDICTED: aspartyl aminopeptidase isoform 1       145   7e-37   
ref|NP_058574.3|  aspartyl aminopeptidase isoform b                     145   7e-37   
ref|XP_005443029.1|  PREDICTED: aspartyl aminopeptidase                 145   7e-37   
dbj|BAE32800.1|  unnamed protein product                                145   7e-37   
gb|KDN65494.1|  putative aminopeptidase I zinc metalloprotease          145   7e-37   
ref|XP_005202875.1|  PREDICTED: aspartyl aminopeptidase isoform X5      145   7e-37   
ref|XP_004325559.1|  PREDICTED: aspartyl aminopeptidase isoform 2       145   7e-37   
ref|XP_003729436.1|  PREDICTED: aspartyl aminopeptidase-like            146   8e-37   
emb|CCC13957.1|  unnamed protein product                                146   8e-37   
ref|XP_005640751.1|  PREDICTED: aspartyl aminopeptidase isoform X4      145   8e-37   
ref|XP_002192610.2|  PREDICTED: aspartyl aminopeptidase                 146   8e-37   
gb|KFA70034.1|  hypothetical protein S40285_02036                       146   8e-37   
gb|ELR60782.1|  Aspartyl aminopeptidase                                 145   8e-37   
gb|AAX07699.1|  aspartyl aminopeptidase-like protein                    145   8e-37   
ref|NP_001012937.1|  aspartyl aminopeptidase                            145   8e-37   
ref|XP_008578710.1|  PREDICTED: aspartyl aminopeptidase                 145   8e-37   
ref|XP_009041924.1|  hypothetical protein AURANDRAFT_34091              145   8e-37   
ref|XP_008823997.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   8e-37   
ref|XP_005956749.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   8e-37   
ref|XP_006935665.1|  PREDICTED: aspartyl aminopeptidase isoform X3      145   8e-37   
ref|XP_008823998.1|  PREDICTED: aspartyl aminopeptidase isoform X3      145   8e-37   
ref|NP_001039417.1|  aspartyl aminopeptidase                            145   8e-37   
gb|ACA64864.1|  aspartyl aminopeptidase (predicted)                     145   8e-37   
ref|XP_008823992.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   8e-37   
ref|XP_010859551.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   9e-37   
ref|XP_005676645.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   9e-37   
gb|KDR83853.1|  hypothetical protein GALMADRAFT_236273                  145   9e-37   
ref|XP_006935664.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   9e-37   
ref|XP_007445869.1|  PREDICTED: aspartyl aminopeptidase                 145   9e-37   
ref|NP_001088602.1|  uncharacterized protein LOC495491                  145   9e-37   
gb|EDL00397.1|  aspartyl aminopeptidase, isoform CRA_b                  145   9e-37   
pdb|3VAR|A  Chain A, Crystal Structure Of Dnpep, Znzn Form              145   9e-37   
ref|XP_957246.2|  aspartyl aminopeptidase                               145   9e-37   
ref|XP_005676646.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   9e-37   
ref|XP_005640749.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   9e-37   
ref|XP_004674317.1|  PREDICTED: aspartyl aminopeptidase                 145   9e-37   
ref|XP_004005000.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    145   9e-37   
ref|XP_005640748.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   9e-37   
ref|XP_007519740.1|  PREDICTED: aspartyl aminopeptidase                 145   9e-37   
ref|XP_009062504.1|  hypothetical protein LOTGIDRAFT_220342             145   1e-36   
ref|XP_003966622.1|  PREDICTED: aspartyl aminopeptidase-like            145   1e-36   
ref|XP_008057077.1|  PREDICTED: aspartyl aminopeptidase                 145   1e-36   
ref|XP_010890470.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   1e-36   
ref|NP_001016026.1|  aspartyl aminopeptidase                            145   1e-36   
ref|XP_010890471.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   1e-36   
ref|XP_007122487.1|  PREDICTED: aspartyl aminopeptidase                 145   1e-36   
ref|XP_005202874.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   1e-36   
ref|XP_009850908.1|  aspartyl aminopeptidase                            145   1e-36   
gb|KID79523.1|  aspartyl aminopeptidase                                 145   1e-36   
ref|XP_006935663.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   1e-36   
ref|XP_003713775.1|  aspartyl aminopeptidase                            145   1e-36   
gb|EPY40683.1|  aspartyl aminopeptidase                                 142   1e-36   
ref|XP_004701683.1|  PREDICTED: aspartyl aminopeptidase isoform X2      144   1e-36   
ref|XP_005956748.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   1e-36   
dbj|BAA13937.1|  unnamed protein product                                144   1e-36   
ref|XP_010800626.1|  PREDICTED: aspartyl aminopeptidase isoform X4      145   1e-36   
ref|XP_010800625.1|  PREDICTED: aspartyl aminopeptidase isoform X3      145   1e-36   
ref|XP_004467839.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    145   1e-36   
ref|XP_006960518.1|  aspartyl aminopeptidase                            145   1e-36   
ref|XP_007329540.1|  hypothetical protein AGABI1DRAFT_113568            144   2e-36   
ref|XP_006460010.1|  hypothetical protein AGABI2DRAFT_116970            145   2e-36   
gb|ACE77655.1|  aspartyl aminopeptidase (predicted)                     144   2e-36   
ref|XP_004701682.1|  PREDICTED: aspartyl aminopeptidase isoform X1      144   2e-36   
ref|XP_009217911.1|  aspartyl aminopeptidase                            145   2e-36   
gb|EPY33263.1|  aminopeptidase                                          144   2e-36   
ref|XP_009236416.1|  PREDICTED: aspartyl aminopeptidase isoform X4      144   2e-36   
ref|XP_005395586.1|  PREDICTED: aspartyl aminopeptidase isoform X2      144   2e-36   
ref|XP_005395588.1|  PREDICTED: aspartyl aminopeptidase isoform X4      144   2e-36   
ref|XP_008970260.1|  PREDICTED: aspartyl aminopeptidase isoform X3      144   2e-36   
ref|XP_005395587.1|  PREDICTED: aspartyl aminopeptidase isoform X3      144   2e-36   
ref|XP_006972211.1|  PREDICTED: aspartyl aminopeptidase isoform X2      144   2e-36   
ref|XP_007799299.1|  putative aspartyl aminopeptidase protein           144   2e-36   
ref|XP_005246489.2|  PREDICTED: aspartyl aminopeptidase isoform X4      144   2e-36   
gb|KFG81622.1|  aspartyl aminopeptidase                                 144   2e-36   
gb|EPY23074.1|  aminopeptidase                                          144   2e-36   
gb|AAX27684.2|  SJCHGC06075 protein                                     143   2e-36   
ref|XP_006972210.1|  PREDICTED: aspartyl aminopeptidase isoform X1      144   2e-36   
ref|XP_004662959.1|  PREDICTED: aspartyl aminopeptidase                 144   2e-36   
gb|KIK30586.1|  hypothetical protein PISMIDRAFT_301057                  144   2e-36   
ref|XP_005574439.1|  PREDICTED: aspartyl aminopeptidase isoform X5      143   2e-36   
ref|XP_003038056.1|  hypothetical protein SCHCODRAFT_72102              144   2e-36   
ref|XP_007823244.1|  peptidase M18-like protein                         144   2e-36   
ref|XP_005395585.1|  PREDICTED: aspartyl aminopeptidase isoform X1      144   2e-36   
ref|XP_009236412.1|  PREDICTED: aspartyl aminopeptidase isoform X1      144   3e-36   
ref|NP_001125438.1|  aspartyl aminopeptidase                            144   3e-36   
ref|XP_011108047.1|  hypothetical protein H072_2059                     144   3e-36   
gb|AAY15050.1|  unknown                                                 144   3e-36   
ref|XP_008970257.1|  PREDICTED: aspartyl aminopeptidase isoform X2      144   3e-36   
gb|KFG61351.1|  aspartyl aminopeptidase                                 136   3e-36   
dbj|BAA92014.1|  unnamed protein product                                144   3e-36   
ref|NP_036232.2|  aspartyl aminopeptidase                               144   3e-36   
ref|XP_001163232.1|  PREDICTED: aspartyl aminopeptidase isoform X1      144   3e-36   
ref|NP_594745.1|  aspartyl aminopeptidase Aap1                          144   3e-36   
ref|XP_004427652.1|  PREDICTED: aspartyl aminopeptidase                 144   3e-36   
gb|KFY79508.1|  hypothetical protein V499_01520                         144   3e-36   
ref|XP_001424295.1|  hypothetical protein                               144   3e-36   
gb|EAW70730.1|  aspartyl aminopeptidase, isoform CRA_c                  144   3e-36   
ref|XP_005246487.2|  PREDICTED: aspartyl aminopeptidase isoform X2      144   3e-36   
sp|Q9ULA0.1|DNPEP_HUMAN  RecName: Full=Aspartyl aminopeptidase          144   3e-36   
gb|KII95242.1|  hypothetical protein PLICRDRAFT_48205                   144   3e-36   
ref|XP_005710409.1|  unnamed protein product                            144   3e-36   



>ref|XP_002266672.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Vitis 
vinifera]
 ref|XP_010658775.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Vitis 
vinifera]
 ref|XP_010658776.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Vitis 
vinifera]
 ref|XP_010658777.1| PREDICTED: probable aspartyl aminopeptidase isoform X4 [Vitis 
vinifera]
 emb|CBI35256.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   268 bits (686),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+T+FLFKEV RIHNLPTQ+
Sbjct  405  ADMAHGVHPNFMDKHEEHHRPELQKGLVIKHNANQRYATSGITAFLFKEVGRIHNLPTQE  464

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAYKHFKAFYQT
Sbjct  465  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYKHFKAFYQT  524

Query  372  FSSVDRKLNVD  340
            FSSVDRKLNVD
Sbjct  525  FSSVDRKLNVD  535



>ref|XP_003591777.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=287

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TS LFKEV +IHNLPTQ+
Sbjct  156  ADMAHGVHPNFADKHEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQE  215

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ 
Sbjct  216  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQN  275

Query  372  FSSVDRKLNVD  340
            FSS+D+ L VD
Sbjct  276  FSSIDKMLTVD  286



>ref|XP_004249975.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=535

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TSFLFKEVAR+H+LPTQD
Sbjct  405  ADMAHGVHPNFVDKHEEHHRPELQKGLVIKHNANQRYATSGITSFLFKEVARLHSLPTQD  464

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILA+GVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFYQ+
Sbjct  465  FVVRNDMGCGSTIGPILAAGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYQS  524

Query  372  FSSVDRKLNVD  340
            FSS+DRKLNVD
Sbjct  525  FSSIDRKLNVD  535



>ref|XP_006361458.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=535

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TSFLFKEVAR+H+LPTQD
Sbjct  405  ADMAHGVHPNFIDKHEEHHRPELQKGLVIKHNANQRYATSGITSFLFKEVARLHSLPTQD  464

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILA+GVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFYQ+
Sbjct  465  FVVRNDMGCGSTIGPILAAGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYQS  524

Query  372  FSSVDRKLNVD  340
            FSS+DRKLNVD
Sbjct  525  FSSIDRKLNVD  535



>ref|XP_009596186.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=541

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSGVTSFLFKEVAR+H+LPTQD
Sbjct  411  ADMAHGVHPNFVDKHEEHHRPELQKGLVIKHNANQRYATSGVTSFLFKEVARLHSLPTQD  470

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT
Sbjct  471  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  530

Query  372  FSSVDRKLNVD  340
            FSS+DRKL VD
Sbjct  531  FSSIDRKLIVD  541



>ref|XP_009802964.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=542

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSGVTSFLFKEVAR+H+LPTQD
Sbjct  412  ADMAHGVHPNFVDKHEEHHRPELQKGLVIKHNANQRYATSGVTSFLFKEVARLHSLPTQD  471

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT
Sbjct  472  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  531

Query  372  FSSVDRKLNVD  340
            FSS+DRKL VD
Sbjct  532  FSSIDRKLIVD  542



>ref|XP_003591778.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=332

 Score =   259 bits (663),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TS LFKEV +IHNLPTQ+
Sbjct  201  ADMAHGVHPNFADKHEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQE  260

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ 
Sbjct  261  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQN  320

Query  372  FSSVDRKLNVD  340
            FSS+D+ L VD
Sbjct  321  FSSIDKMLTVD  331



>ref|XP_007213437.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
 gb|EMJ14636.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
Length=474

 Score =   262 bits (669),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSFLFKE+ +IHNLPTQ+
Sbjct  343  ADMAHGVHPNFMDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFLFKEIGKIHNLPTQE  402

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYKHFKAFYQ 
Sbjct  403  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKHFKAFYQA  462

Query  372  FSSVDRKLNVD  340
            FSS+D+KLNVD
Sbjct  463  FSSIDKKLNVD  473



>ref|XP_008375605.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=407

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+
Sbjct  276  ADMAHGVHPNFXDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQE  335

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQT
Sbjct  336  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQT  395

Query  372  FSSVDRKLNVD  340
            FSS+DRKL+VD
Sbjct  396  FSSIDRKLDVD  406



>emb|CDO99897.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSGVT+FLFKEVA+++NLPTQ+
Sbjct  415  ADMAHGVHPNFMDKHEEHHRPELQKGLVIKHNANQRYATSGVTAFLFKEVAKMNNLPTQE  474

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED+D AYKHF+AFYQT
Sbjct  475  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDVDFAYKHFRAFYQT  534

Query  372  FSSVDRKLNVD  340
            FSS+DRKLNVD
Sbjct  535  FSSIDRKLNVD  545



>ref|XP_011076920.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Sesamum 
indicum]
Length=493

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP LQKGLVIKHNA+QRYATSGVTSFLFKEVA+IHNLP Q+
Sbjct  362  ADMAHGVHPNFMDKHEENHRPVLQKGLVIKHNANQRYATSGVTSFLFKEVAKIHNLPIQE  421

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFY+T
Sbjct  422  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYKT  481

Query  372  FSSVDRKLNVD  340
            FSS+D+KLNVD
Sbjct  482  FSSIDKKLNVD  492



>gb|KJB78672.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
 gb|KJB78673.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
Length=521

 Score =   261 bits (666),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE+ KGLVIKHNA+QRYATSGVT+FLFKEVA++HNLPTQ+
Sbjct  391  ADMAHGVHPNFMDKHEEHHRPEMHKGLVIKHNANQRYATSGVTAFLFKEVAKMHNLPTQE  450

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAYKHFKAFYQT
Sbjct  451  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYKHFKAFYQT  510

Query  372  FSSVDRKLNVD  340
            FSS+DRKL VD
Sbjct  511  FSSIDRKLIVD  521



>gb|KCW51474.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=360

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNFTDKHEEHHRPE+QKGLVIKHNA+QRYATSG+T+FLFKEV +IHNLPTQ+
Sbjct  229  ADMAHGVHPNFTDKHEEHHRPEMQKGLVIKHNANQRYATSGITAFLFKEVGKIHNLPTQE  288

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAY+HFKAFYQ+
Sbjct  289  FAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYQHFKAFYQS  348

Query  372  FSSVDRKLNVD  340
            FS VD KL +D
Sbjct  349  FSHVDSKLTID  359



>gb|KHG01889.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=549

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE+ KGLVIKHNA+QRYATSGVT+FLFKEVA++HNLPTQ+
Sbjct  419  ADMAHGVHPNFMDKHEEHHRPEMHKGLVIKHNANQRYATSGVTAFLFKEVAKMHNLPTQE  478

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAYKHFKAFYQT
Sbjct  479  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYKHFKAFYQT  538

Query  372  FSSVDRKLNVD  340
            FSS+DRKL VD
Sbjct  539  FSSIDRKLIVD  549



>ref|XP_011076919.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Sesamum 
indicum]
Length=539

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP LQKGLVIKHNA+QRYATSGVTSFLFKEVA+IHNLP Q+
Sbjct  408  ADMAHGVHPNFMDKHEENHRPVLQKGLVIKHNANQRYATSGVTSFLFKEVAKIHNLPIQE  467

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFY+T
Sbjct  468  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYKT  527

Query  372  FSSVDRKLNVD  340
            FSS+D+KLNVD
Sbjct  528  FSSIDKKLNVD  538



>ref|XP_009336015.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336016.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+
Sbjct  398  ADMAHGVHPNFMDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQE  457

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQT
Sbjct  458  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQT  517

Query  372  FSSVDRKLNVD  340
            FSS+DRKL+VD
Sbjct  518  FSSIDRKLDVD  528



>ref|XP_008347038.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=529

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+
Sbjct  398  ADMAHGVHPNFIDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQE  457

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQT
Sbjct  458  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQT  517

Query  372  FSSVDRKLNVD  340
            FSS+DRKL+VD
Sbjct  518  FSSIDRKLDVD  528



>gb|AES62027.2| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=526

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TS LFKEV +IHNLPTQ+
Sbjct  395  ADMAHGVHPNFADKHEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQE  454

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ 
Sbjct  455  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQN  514

Query  372  FSSVDRKLNVD  340
            FSS+D+ L VD
Sbjct  515  FSSIDKMLTVD  525



>ref|XP_008232012.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=530

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSFLFKE+ +IHNLPTQ+
Sbjct  399  ADMAHGVHPNFMDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFLFKEIGKIHNLPTQE  458

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYKHFKAFYQ 
Sbjct  459  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKHFKAFYQD  518

Query  372  FSSVDRKLNVD  340
            FSS+D+KL+VD
Sbjct  519  FSSIDKKLDVD  529



>ref|XP_010244532.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DK+EEHHRPELQKGLVIKHNA+QRYATSGVT+FLFKE+A IHN+P Q+
Sbjct  389  ADMAHGVHPNFMDKYEEHHRPELQKGLVIKHNANQRYATSGVTAFLFKEIANIHNIPVQE  448

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFY+T
Sbjct  449  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYKT  508

Query  372  FSSVDRKLNVD  340
            FS +DRKLNVD
Sbjct  509  FSGIDRKLNVD  519



>ref|XP_009336013.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336014.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+
Sbjct  398  ADMAHGVHPNFMDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQE  457

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQT
Sbjct  458  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQT  517

Query  372  FSSVDRKLNVD  340
            FSS+DRKL+VD
Sbjct  518  FSSIDRKLDVD  528



>gb|KDO42030.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=410

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+
Sbjct  279  ADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQE  338

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++
Sbjct  339  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYES  398

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  399  FSSIDKKLIVD  409



>ref|XP_007010329.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY19139.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE++KGLVIKHNA+QRYATSGVT+FLFKEV +IHNLPTQD
Sbjct  390  ADMAHGVHPNFMDKHEEHHRPEMRKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPTQD  449

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGK+DIDIAYKHFKAFYQ 
Sbjct  450  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKDDIDIAYKHFKAFYQI  509

Query  372  FSSVDRKLNVD  340
            FSS+DRKL VD
Sbjct  510  FSSIDRKLIVD  520



>ref|XP_003591776.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=550

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TS LFKEV +IHNLPTQ+
Sbjct  419  ADMAHGVHPNFADKHEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQE  478

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ 
Sbjct  479  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQN  538

Query  372  FSSVDRKLNVD  340
            FSS+D+ L VD
Sbjct  539  FSSIDKMLTVD  549



>ref|XP_010694702.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=507

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP++QKGLVIKHNA+QRYATSGVT+FLFKEVA+IHNLPTQ+
Sbjct  377  ADMAHGVHPNFMDKHEENHRPQMQKGLVIKHNANQRYATSGVTAFLFKEVAKIHNLPTQE  436

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV+NDMGCGSTIGPILA+GVGIRTVDCGI+QLSMHSVREICGKEDIDIAYKHFKAFY++
Sbjct  437  FVVKNDMGCGSTIGPILAAGVGIRTVDCGISQLSMHSVREICGKEDIDIAYKHFKAFYES  496

Query  372  FSSVDRKLNVD  340
            FSS+DRKL+VD
Sbjct  497  FSSIDRKLSVD  507



>gb|KGN52197.1| hypothetical protein Csa_5G615200 [Cucumis sativus]
Length=527

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNFTDKHEEHHRPE+QKG+VIKHNA+QRYATSGVT+FLF+EV RIHNLPTQD
Sbjct  396  ADMAHGVHPNFTDKHEEHHRPEMQKGIVIKHNANQRYATSGVTAFLFREVGRIHNLPTQD  455

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHS+REICGKEDID AYK+FKAFY+T
Sbjct  456  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSIREICGKEDIDTAYKYFKAFYKT  515

Query  372  FSSVDRKLNVD  340
            FSS+DRKL VD
Sbjct  516  FSSIDRKLKVD  526



>ref|XP_004150844.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=527

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNFTDKHEEHHRPE+QKG+VIKHNA+QRYATSGVT+FLF+EV RIHNLPTQD
Sbjct  396  ADMAHGVHPNFTDKHEEHHRPEMQKGIVIKHNANQRYATSGVTAFLFREVGRIHNLPTQD  455

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHS+REICGKEDID AYK+FKAFY+T
Sbjct  456  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSIREICGKEDIDTAYKYFKAFYKT  515

Query  372  FSSVDRKLNVD  340
            FSS+DRKL VD
Sbjct  516  FSSIDRKLKVD  526



>ref|XP_010694701.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP++QKGLVIKHNA+QRYATSGVT+FLFKEVA+IHNLPTQ+
Sbjct  399  ADMAHGVHPNFMDKHEENHRPQMQKGLVIKHNANQRYATSGVTAFLFKEVAKIHNLPTQE  458

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV+NDMGCGSTIGPILA+GVGIRTVDCGI+QLSMHSVREICGKEDIDIAYKHFKAFY++
Sbjct  459  FVVKNDMGCGSTIGPILAAGVGIRTVDCGISQLSMHSVREICGKEDIDIAYKHFKAFYES  518

Query  372  FSSVDRKLNVD  340
            FSS+DRKL+VD
Sbjct  519  FSSIDRKLSVD  529



>ref|XP_004496198.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=534

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF+DKHEEHHRPELQKGLVIKHNA+QRYAT+G+TSFLFKEV +IHNLPTQ+
Sbjct  403  ADMAHGVHPNFSDKHEEHHRPELQKGLVIKHNANQRYATTGITSFLFKEVGKIHNLPTQE  462

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHS+REICGKEDIDIAYK+FKAFYQ 
Sbjct  463  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSIREICGKEDIDIAYKYFKAFYQN  522

Query  372  FSSVDRKLNVD  340
            FSS+D+ L VD
Sbjct  523  FSSIDKMLTVD  533



>gb|KDO42028.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=469

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+
Sbjct  338  ADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQE  397

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++
Sbjct  398  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYES  457

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  458  FSSIDKKLIVD  468



>ref|XP_008446766.1| PREDICTED: probable aspartyl aminopeptidase [Cucumis melo]
Length=527

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNFTDKHEEHHRPE+QKG+VIK+NA+QRYATSGVT+FLF+EV RIHNLPTQD
Sbjct  396  ADMAHGVHPNFTDKHEEHHRPEMQKGIVIKYNANQRYATSGVTAFLFREVGRIHNLPTQD  455

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHS+REICGKED+D AYK+FKAFY+T
Sbjct  456  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSIREICGKEDVDTAYKYFKAFYKT  515

Query  372  FSSVDRKLNVD  340
            FSS+DRKL VD
Sbjct  516  FSSIDRKLKVD  526



>ref|XP_007143804.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
 gb|ESW15798.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
Length=527

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE HRPELQKGLVIKHNA+QRYATSG+TSFLFKEV +IHNLPTQD
Sbjct  396  ADMAHGVHPNFMDKHEELHRPELQKGLVIKHNANQRYATSGITSFLFKEVGKIHNLPTQD  455

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+RE+CGKEDIDIAYKHFKAFYQ+
Sbjct  456  FAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREMCGKEDIDIAYKHFKAFYQS  515

Query  372  FSSVDRKLNVD  340
            FSSVD+ L VD
Sbjct  516  FSSVDKMLTVD  526



>gb|KDO42027.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=496

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+
Sbjct  365  ADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQE  424

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++
Sbjct  425  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYES  484

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  485  FSSIDKKLIVD  495



>ref|XP_010088778.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB36961.1| Aspartyl aminopeptidase [Morus notabilis]
Length=532

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF D+HEEHHRP +QKGLVIKHNA+QRYATSGVTSFLFKEV RIHNLPTQ+
Sbjct  401  ADMAHGVHPNFVDRHEEHHRPVMQKGLVIKHNANQRYATSGVTSFLFKEVGRIHNLPTQE  460

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICGKEDIDIAY+HFKAFY+T
Sbjct  461  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGKEDIDIAYQHFKAFYKT  520

Query  372  FSSVDRKLNVD  340
            FSSVD KL++D
Sbjct  521  FSSVDMKLSID  531



>ref|XP_006436620.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49860.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=516

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+
Sbjct  385  ADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQE  444

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++
Sbjct  445  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYES  504

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  505  FSSIDKKLIVD  515



>ref|XP_010032079.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032080.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Eucalyptus 
grandis]
 ref|XP_010032081.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Eucalyptus 
grandis]
 gb|KCW51471.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=522

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNFTDKHEEHHRPE+QKGLVIKHNA+QRYATSG+T+FLFKEV +IHNLPTQ+
Sbjct  391  ADMAHGVHPNFTDKHEEHHRPEMQKGLVIKHNANQRYATSGITAFLFKEVGKIHNLPTQE  450

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAY+HFKAFYQ+
Sbjct  451  FAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYQHFKAFYQS  510

Query  372  FSSVDRKLNVD  340
            FS VD KL +D
Sbjct  511  FSHVDSKLTID  521



>ref|XP_006485213.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485214.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Citrus 
sinensis]
 gb|KDO42026.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=522

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+
Sbjct  391  ADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQE  450

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++
Sbjct  451  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYES  510

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  511  FSSIDKKLIVD  521



>ref|XP_006436621.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49861.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=542

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+
Sbjct  411  ADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQE  470

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++
Sbjct  471  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYES  530

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  531  FSSIDKKLIVD  541



>ref|XP_003556268.2| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=539

 Score =   256 bits (653),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE HRPELQKGLVIKHNA+QRYATSG+TSFLFKEV +IHNLPTQ+
Sbjct  408  ADMAHGVHPNFMDKHEELHRPELQKGLVIKHNANQRYATSGITSFLFKEVGKIHNLPTQE  467

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ 
Sbjct  468  FAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQN  527

Query  372  FSSVDRKLNVD  340
            FSSVD+ L VD
Sbjct  528  FSSVDKMLTVD  538



>gb|KHN00906.1| Aspartyl aminopeptidase [Glycine soja]
Length=518

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE HRPELQKGLVIKHNA+QRYATSG+TSFLFKEV +IHNLPTQ+
Sbjct  387  ADMAHGVHPNFMDKHEELHRPELQKGLVIKHNANQRYATSGITSFLFKEVGKIHNLPTQE  446

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ 
Sbjct  447  FAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQN  506

Query  372  FSSVDRKLNVD  340
            FSSVD+ L VD
Sbjct  507  FSSVDKMLTVD  517



>ref|XP_009356123.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=531

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRP++QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+
Sbjct  400  ADMAHGVHPNFMDKHEEHHRPQMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQE  459

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAY +FKAFYQT
Sbjct  460  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYNYFKAFYQT  519

Query  372  FSSVDRKLNVD  340
            FSS+D++L+VD
Sbjct  520  FSSIDKELDVD  530



>ref|XP_010907134.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Elaeis 
guineensis]
Length=448

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHG+HPNF+DK+EEHHRPELQKGLVIKHN++QRYATS VT+FLFKEVA IHNLP Q+
Sbjct  317  ADMAHGLHPNFSDKYEEHHRPELQKGLVIKHNSNQRYATSAVTAFLFKEVANIHNLPVQE  376

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICGKED+DIAYKHF AF+Q+
Sbjct  377  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGKEDVDIAYKHFMAFFQS  436

Query  372  FSSVDRKLNVD  340
            FS +DRKL+VD
Sbjct  437  FSDIDRKLSVD  447



>ref|XP_002311031.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88398.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=496

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF +KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKEV +IHNLP+Q+
Sbjct  366  ADMAHGVHPNFMEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPSQE  425

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREIC KED+DIAYK+FKAFYQ 
Sbjct  426  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICAKEDVDIAYKYFKAFYQN  485

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  486  FSSIDKKLEVD  496



>tpg|DAA55692.1| TPA: hypothetical protein ZEAMMB73_277076 [Zea mays]
Length=187

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+
Sbjct  56   ADMAHALHPNYAEKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQE  115

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++ 
Sbjct  116  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFEM  175

Query  372  FSSVDRKLNVD  340
            FS +DRKLNVD
Sbjct  176  FSDIDRKLNVD  186



>emb|CDX70207.1| BnaA10g25560D [Brassica napus]
Length=528

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP QD
Sbjct  397  ADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQD  456

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++
Sbjct  457  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRS  516

Query  372  FSSVDRKLNVD  340
            FSSVDRKL VD
Sbjct  517  FSSVDRKLTVD  527



>ref|XP_010543610.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=533

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHG+HPNF++KHEEHHRP++ KGLVIKHNA+QRYATSG+TS LFKEVA++HNLPTQ+
Sbjct  403  ADMAHGIHPNFSEKHEEHHRPQMHKGLVIKHNANQRYATSGITSLLFKEVAKLHNLPTQE  462

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++
Sbjct  463  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYES  522

Query  372  FSSVDRKLNVD  340
            FS++DRKL VD
Sbjct  523  FSTIDRKLTVD  533



>emb|CDY44874.1| BnaC09g50740D [Brassica napus]
Length=517

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H LP QD
Sbjct  386  ADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHGLPIQD  445

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++
Sbjct  446  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRS  505

Query  372  FSSVDRKLNVD  340
            FSSVDRKL VD
Sbjct  506  FSSVDRKLTVD  516



>ref|XP_002311016.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88383.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=526

 Score =   251 bits (641),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF +KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKEV +IHNLP+Q+
Sbjct  396  ADMAHGVHPNFMEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPSQE  455

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREIC KED+DIAYK+FKAFYQ 
Sbjct  456  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICAKEDVDIAYKYFKAFYQN  515

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  516  FSSIDKKLEVD  526



>ref|XP_011032849.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=526

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF +KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKEV +IHNLP+Q+
Sbjct  396  ADMAHGVHPNFMEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPSQE  455

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREIC KED+DIAYK+FKAFYQ 
Sbjct  456  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICAKEDVDIAYKYFKAFYQN  515

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  516  FSSIDKKLEVD  526



>ref|XP_006398926.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
 gb|ESQ40379.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
Length=523

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP++ KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+
Sbjct  392  ADMAHGVHPNFADKHEENHRPQIHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQE  451

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAYKHFKAFYQ+
Sbjct  452  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYKHFKAFYQS  511

Query  372  FSSVDRKLNVD  340
            FSSVDRKL VD
Sbjct  512  FSSVDRKLIVD  522



>ref|XP_009122574.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=527

 Score =   250 bits (639),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP++ KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP QD
Sbjct  396  ADMAHGVHPNFADKHEENHRPQIHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQD  455

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++
Sbjct  456  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRS  515

Query  372  FSSVDRKLNVD  340
            FSSVDRKL VD
Sbjct  516  FSSVDRKLTVD  526



>gb|EMT26810.1| Aspartyl aminopeptidase [Aegilops tauschii]
Length=332

 Score =   244 bits (624),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+
Sbjct  201  ADMAHALHPNYPDKHEEYHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQE  260

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKEDID  YKHFKAF++ 
Sbjct  261  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDIDTTYKHFKAFFEM  320

Query  372  FSSVDRKLNVD  340
            FS +D+KLNVD
Sbjct  321  FSDIDQKLNVD  331



>gb|EYU19780.1| hypothetical protein MIMGU_mgv1a004147mg [Erythranthe guttata]
Length=542

 Score =   251 bits (640),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP LQKGLVIKHNA+QRYATSG+TSFLFKEVA++HNLP Q+
Sbjct  411  ADMAHGVHPNFIDKHEENHRPLLQKGLVIKHNANQRYATSGITSFLFKEVAKLHNLPIQE  470

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILA+GVGIRTVDCGI QLSMHSVREICGKEDIDIAYKHF AFY+T
Sbjct  471  FVVRNDMGCGSTIGPILAAGVGIRTVDCGIPQLSMHSVREICGKEDIDIAYKHFMAFYRT  530

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  531  FSSIDKKLRVD  541



>ref|XP_006287486.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
 gb|EOA20384.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
Length=529

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSGVTSFLFKEVA++H+LP Q+
Sbjct  398  ADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGVTSFLFKEVAKLHDLPIQE  457

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG+GIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++
Sbjct  458  FVVRNDMGCGSTIGPILASGIGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYES  517

Query  372  FSSVDRKLNVD  340
            FSSVDRKL VD
Sbjct  518  FSSVDRKLMVD  528



>ref|XP_010907133.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Elaeis 
guineensis]
Length=528

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHG+HPNF+DK+EEHHRPELQKGLVIKHN++QRYATS VT+FLFKEVA IHNLP Q+
Sbjct  397  ADMAHGLHPNFSDKYEEHHRPELQKGLVIKHNSNQRYATSAVTAFLFKEVANIHNLPVQE  456

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICGKED+DIAYKHF AF+Q+
Sbjct  457  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGKEDVDIAYKHFMAFFQS  516

Query  372  FSSVDRKLNVD  340
            FS +DRKL+VD
Sbjct  517  FSDIDRKLSVD  527



>ref|XP_010490993.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+
Sbjct  399  ADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQE  458

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICG +DIDIAY+HFKAFYQ+
Sbjct  459  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGTDDIDIAYRHFKAFYQS  518

Query  372  FSSVDRKLNVD  340
            FSSVDRKL VD
Sbjct  519  FSSVDRKLVVD  529



>gb|KDP35783.1| hypothetical protein JCGZ_10419 [Jatropha curcas]
Length=526

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE++KGLVIKHNA+QRYAT+G+T+FLFKEV +I +LPTQ+
Sbjct  396  ADMAHGVHPNFMDKHEEHHRPEMKKGLVIKHNANQRYATNGITAFLFKEVGKILSLPTQE  455

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+C KEDIDIAYKHFKAFY+ 
Sbjct  456  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCAKEDIDIAYKHFKAFYEN  515

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  516  FSSIDKKLQVD  526



>ref|XP_003565148.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=520

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEEHHRPELQ+GLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+
Sbjct  389  ADMAHALHPNYPDKHEEHHRPELQRGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQE  448

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKEDID AYKHFKAF++ 
Sbjct  449  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDIDTAYKHFKAFFEM  508

Query  372  FSSVDRKLNVD  340
            FS +D+KLNVD
Sbjct  509  FSDIDQKLNVD  519



>ref|XP_002873165.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49424.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+
Sbjct  394  ADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQE  453

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++
Sbjct  454  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRS  513

Query  372  FSSVDRKLNVD  340
            FSSVD+KL VD
Sbjct  514  FSSVDKKLVVD  524



>ref|XP_006645339.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=525

 Score =   248 bits (632),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEEHHRPELQKGLVIKHNA+QRYATS VT+FLFKE+AR+HNLP Q+
Sbjct  394  ADMAHALHPNYPDKHEEHHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARLHNLPVQE  453

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  YKHFKAF++ 
Sbjct  454  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYKHFKAFFEM  513

Query  372  FSSVDRKLNVD  340
            FS +DRKLNVD
Sbjct  514  FSDIDRKLNVD  524



>ref|NP_196091.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 emb|CAB86013.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
 dbj|BAB08975.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AED90774.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   248 bits (632),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+
Sbjct  395  ADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQE  454

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++
Sbjct  455  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRS  514

Query  372  FSSVDRKLNVD  340
            FSSVD+KL VD
Sbjct  515  FSSVDKKLVVD  525



>dbj|BAC43404.1| putative aspartyl aminopeptidase [Arabidopsis thaliana]
Length=526

 Score =   248 bits (632),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+
Sbjct  395  ADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQE  454

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++
Sbjct  455  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRS  514

Query  372  FSSVDRKLNVD  340
            FSSVD+KL VD
Sbjct  515  FSSVDKKLVVD  525



>ref|NP_001045513.1| Os01g0967900 [Oryza sativa Japonica Group]
 dbj|BAB85315.1| putative aspartyl aminopeptidase [Oryza sativa Japonica Group]
 dbj|BAF07427.1| Os01g0967900 [Oryza sativa Japonica Group]
 gb|EEE56077.1| hypothetical protein OsJ_04900 [Oryza sativa Japonica Group]
Length=525

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEEHHRPELQKGLVIKHNA+QRYATS VT+FLFKE+AR+HNLP Q+
Sbjct  395  ADMAHALHPNYPDKHEEHHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARLHNLPVQE  454

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  YKHFKAF++ 
Sbjct  455  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYKHFKAFFEM  514

Query  372  FSSVDRKLNVD  340
            FS +DRKLNVD
Sbjct  515  FSDIDRKLNVD  525



>ref|XP_010423546.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=536

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+
Sbjct  405  ADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQE  464

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICG +DIDIAY+HFKAFY++
Sbjct  465  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGTDDIDIAYRHFKAFYRS  524

Query  372  FSSVDRKLNVD  340
            FSSVDRKL VD
Sbjct  525  FSSVDRKLVVD  535



>ref|XP_008788174.1| PREDICTED: probable aspartyl aminopeptidase [Phoenix dactylifera]
Length=533

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHG+HPNF+DK+EEHHRPELQKGLV+KHNA+QRYATS VT+FLFKEVA IHNLP Q+
Sbjct  402  ADMAHGLHPNFSDKYEEHHRPELQKGLVVKHNANQRYATSAVTAFLFKEVANIHNLPVQE  461

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+DIAYKHF AF+Q+
Sbjct  462  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREVCGKEDVDIAYKHFLAFFQS  521

Query  372  FSSVDRKLNVD  340
            FS +D KL+VD
Sbjct  522  FSDIDGKLSVD  532



>gb|KFK24913.1| hypothetical protein AALP_AA8G041200 [Arabis alpina]
Length=523

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF +KHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+
Sbjct  392  ADMAHGVHPNFAEKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPVQE  451

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++
Sbjct  452  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRS  511

Query  372  FSSVDRKLNVD  340
            FSSVDRKL +D
Sbjct  512  FSSVDRKLVMD  522



>ref|XP_010452373.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP+L KGLV+KHNA+QRYATSG+TSFLFKEVA++H+LP Q+
Sbjct  399  ADMAHGVHPNFADKHEENHRPQLHKGLVVKHNANQRYATSGITSFLFKEVAKLHDLPIQE  458

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICG  DIDIAY+HFKAFY++
Sbjct  459  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGTNDIDIAYRHFKAFYRS  518

Query  372  FSSVDRKLNVD  340
            FSSVDRKL VD
Sbjct  519  FSSVDRKLVVD  529



>ref|XP_008674488.1| PREDICTED: probable aspartyl aminopeptidase [Zea mays]
Length=433

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+
Sbjct  302  ADMAHALHPNYAEKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQE  361

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++ 
Sbjct  362  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFEM  421

Query  372  FSSVDRKLNVD  340
            FS +DRKLNVD
Sbjct  422  FSDIDRKLNVD  432



>ref|XP_002524995.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF37402.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=526

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYAT+G+T+FLFKEV  I  LPTQ+
Sbjct  396  ADMAHGVHPNFVDKHEEHHRPEMQKGLVIKHNANQRYATNGITAFLFKEVGNILKLPTQE  455

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRT+DCGI QLSMHSVRE+C KED+D AYKHFKAFYQ 
Sbjct  456  FVVRNDMGCGSTIGPILASGVGIRTIDCGIPQLSMHSVREVCAKEDVDTAYKHFKAFYQN  515

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  516  FSSIDKKLQVD  526



>dbj|BAJ86698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+
Sbjct  382  ADMAHALHPNYPDKHEEYHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQE  441

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKEDID  YKHFKAF++ 
Sbjct  442  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDIDTTYKHFKAFFEM  501

Query  372  FSSVDRKLNVD  340
            FS +D+KLNVD
Sbjct  502  FSDIDQKLNVD  512



>gb|EEC72239.1| hypothetical protein OsI_05355 [Oryza sativa Indica Group]
Length=493

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEEHHRPELQKGLVIKHNA+QRYATS VT+FLFKE+AR HNLP Q+
Sbjct  363  ADMAHALHPNYPDKHEEHHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARHHNLPVQE  422

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++ 
Sbjct  423  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFEM  482

Query  372  FSSVDRKLNVD  340
            FS +DRKLNVD
Sbjct  483  FSDIDRKLNVD  493



>ref|XP_004971394.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Setaria 
italica]
Length=525

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+
Sbjct  394  ADMAHALHPNYPDKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQE  453

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHS+RE+CGKED+D  Y+HFKAF++ 
Sbjct  454  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSIREMCGKEDVDTTYRHFKAFFEM  513

Query  372  FSSVDRKLNVD  340
            FS +DRKLNVD
Sbjct  514  FSDIDRKLNVD  524



>ref|XP_004971395.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Setaria 
italica]
Length=523

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+
Sbjct  392  ADMAHALHPNYPDKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQE  451

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHS+RE+CGKED+D  Y+HFKAF++ 
Sbjct  452  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSIREMCGKEDVDTTYRHFKAFFEM  511

Query  372  FSSVDRKLNVD  340
            FS +DRKLNVD
Sbjct  512  FSDIDRKLNVD  522



>ref|XP_002457006.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
 gb|EES02126.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
Length=524

 Score =   242 bits (618),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+
Sbjct  393  ADMAHALHPNYAEKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQE  452

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++ 
Sbjct  453  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFEM  512

Query  372  FSSVDRKLNVD  340
            FS +DRKLNVD
Sbjct  513  FSDIDRKLNVD  523



>ref|XP_009390025.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHG+HPNF DK+EEHHRP LQKG+VIKHNA+QRYATS +T+FLFKEVA +HNLP Q+
Sbjct  405  ADMAHGLHPNFPDKYEEHHRPALQKGVVIKHNANQRYATSSLTAFLFKEVANVHNLPVQE  464

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICGK+DIDIAYKHF AF+Q+
Sbjct  465  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGKDDIDIAYKHFMAFFQS  524

Query  372  FSSVDRKLNVD  340
            FS +D+KL+VD
Sbjct  525  FSDIDKKLSVD  535



>gb|KHN37829.1| Aspartyl aminopeptidase [Glycine soja]
Length=500

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE HRP+LQ+ LVIKHNA+QRYATSG+T FLFKE  +IHNLPTQ+
Sbjct  369  ADMAHGVHPNFMDKHEELHRPKLQRVLVIKHNANQRYATSGITPFLFKEAGKIHNLPTQE  428

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRN MGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REIC KEDIDIAYKHFKAFYQ+
Sbjct  429  FAVRNGMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICAKEDIDIAYKHFKAFYQS  488

Query  372  FSSVDRKLNVD  340
            FSSVD+ L VD
Sbjct  489  FSSVDKMLTVD  499



>gb|EPS58587.1| aspartyl aminopeptidase, partial [Genlisea aurea]
Length=468

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF+DKH+E+HRP LQKGLVIKHNA+QRYATSGVT FL KEVAR H+LP Q+
Sbjct  337  ADMAHGVHPNFSDKHDENHRPVLQKGLVIKHNANQRYATSGVTGFLLKEVARSHDLPVQE  396

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG+GIRTVDCGI QLSMHSVREICGKED++ AY+ FKAFY+T
Sbjct  397  FVVRNDMGCGSTIGPILASGMGIRTVDCGIPQLSMHSVREICGKEDVESAYRLFKAFYRT  456

Query  372  FSSVDRKLNVD  340
            FS +D KL VD
Sbjct  457  FSGIDEKLTVD  467



>ref|XP_006851486.1| hypothetical protein AMTR_s00040p00143220 [Amborella trichopoda]
 gb|ERN13067.1| hypothetical protein AMTR_s00040p00143220 [Amborella trichopoda]
Length=546

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHG+HPNF +KHE+ HRP LQKG+VIKHNA+QRYAT+ VT+FLFKE+A   NLPTQ+
Sbjct  414  ADMAHGIHPNFPEKHEDQHRPVLQKGIVIKHNANQRYATNSVTAFLFKEIASACNLPTQE  473

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICG+ED+D AYKHFKAF++ 
Sbjct  474  FVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGREDVDTAYKHFKAFFEM  533

Query  372  FSSVDRKLNVD  340
            FSS+D+KL +D
Sbjct  534  FSSIDKKLCID  544



>ref|XP_002975004.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
 gb|EFJ23789.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
Length=477

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+++KHEE+H+P+L +GLVIKHNA+QRYAT+ VT+FLFKEVAR+  + TQ+
Sbjct  346  ADMAHALHPNYSEKHEENHQPKLHEGLVIKHNANQRYATNSVTAFLFKEVARLAGIQTQN  405

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F+VRNDMGCGSTIGPILASG+GIRTVDCG+ QLSMHS+RE+CG +DID AYKHFKAFY+T
Sbjct  406  FIVRNDMGCGSTIGPILASGIGIRTVDCGMPQLSMHSIREMCGTQDIDTAYKHFKAFYRT  465

Query  372  FSSVDRKLNVD  340
            F+S+D++++VD
Sbjct  466  FTSIDQQVSVD  476



>ref|XP_002977420.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
 gb|EFJ21424.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
Length=445

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+++KHEE+H+P+L +GLVIKHNA+QRYAT+ V++FLFKEVAR+  + TQ+
Sbjct  314  ADMAHALHPNYSEKHEENHQPKLHEGLVIKHNANQRYATNSVSAFLFKEVARLAGIQTQN  373

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F+VRNDMGCGSTIGPILASG+GIRTVDCG+ QLSMHS+RE+CG +DID AYKHFKAFY+T
Sbjct  374  FIVRNDMGCGSTIGPILASGIGIRTVDCGMPQLSMHSIREMCGTQDIDTAYKHFKAFYRT  433

Query  372  FSSVDRKLNVD  340
            F+S+D++++VD
Sbjct  434  FTSIDQQVSVD  444



>ref|XP_001420830.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99123.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=465

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P++ KG+V+KHNA+QRYAT+ VTS+LF+E A++ N+PTQD
Sbjct  334  ADMAHALHPNYMDKHEDNHQPKMHKGMVVKHNANQRYATTAVTSYLFRECAKMENVPTQD  393

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPI+A+GVGIRTVD GI QLSMHSVRE+CG EDIDI +KHF AFY+ 
Sbjct  394  FVVRNDMGCGSTIGPIIAAGVGIRTVDVGIPQLSMHSVREMCGTEDIDICFKHFTAFYKN  453

Query  372  FSSVDRKLNVD  340
            FS VD  + VD
Sbjct  454  FSKVDETVTVD  464



>gb|ABR25597.1| aspartyl aminopeptidase [Oryza sativa Indica Group]
Length=149

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H+LP QD
Sbjct  18   ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHHLPIQD  77

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ 
Sbjct  78   FVVRNDMGCGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDIKHSYEHFKAYFEE  137

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VDC
Sbjct  138  FTELDSKVKVDC  149



>ref|XP_001751765.1| predicted protein [Physcomitrella patens]
 gb|EDQ83200.1| predicted protein, partial [Physcomitrella patens]
Length=471

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 119/131 (91%), Gaps = 1/131 (1%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ D+HEE+H+P+L +GLVIK+NA+QRYAT+ VT+FLFKEVA++  +PTQ+
Sbjct  341  ADMAHALHPNYADRHEENHQPKLHEGLVIKYNANQRYATNTVTAFLFKEVAKVAGVPTQN  400

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG+GIRTVD G+ QLSMHSVRE+CG ED+D++Y+HFKAFY+ 
Sbjct  401  FVVRNDMGCGSTIGPILASGIGIRTVDVGMPQLSMHSVREMCGTEDVDLSYRHFKAFYEL  460

Query  372  FSSVDRKLNVD  340
            F+++D KL VD
Sbjct  461  FTTID-KLTVD  470



>ref|XP_008360788.1| PREDICTED: probable aspartyl aminopeptidase, partial [Malus domestica]
Length=206

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP QD
Sbjct  75   ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQD  134

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  135  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  194

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VD 
Sbjct  195  FTHLDAKIKVDA  206



>ref|XP_011024060.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=489

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P L  GLVIKHNA+QRYAT+ +TSFLF+E+A  HNLPTQD
Sbjct  358  ADMAHALHPNYMDKHEENHQPRLHGGLVIKHNANQRYATNAITSFLFREIATKHNLPTQD  417

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  418  FVVRNDMGCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQD  477

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  478  FSHLDAKITVD  488



>ref|XP_003082377.1| aspartyl aminopeptidase (ISS) [Ostreococcus tauri]
Length=486

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P++ KG+V+KHNA+QRYAT+ VT +LF+E A++ N+PTQD
Sbjct  356  ADMAHALHPNYMDKHEENHQPKMHKGMVVKHNANQRYATTAVTGYLFRECAKMENVPTQD  415

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPI+A+GVGIRTVD GI QLSMHSVRE+CG EDIDI  +HF AFY  
Sbjct  416  FVVRNDMGCGSTIGPIVAAGVGIRTVDVGIPQLSMHSVREMCGVEDIDICLRHFTAFYDN  475

Query  372  FSSVDRKLNVD  340
            F+ VD  + VD
Sbjct  476  FAKVDSTVTVD  486



>dbj|BAK02635.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=185

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHEE+H+P+L  GLVIKHNA+QRYAT+ +T+F+F+E+A  H LP QD
Sbjct  54   ADMAHALHPNYMEKHEENHQPKLHGGLVIKHNANQRYATNAMTAFIFREIAERHQLPIQD  113

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ 
Sbjct  114  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDISHSYEHFKAYFEE  173

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VDC
Sbjct  174  FTELDNKVKVDC  185



>emb|CEF99925.1| Peptidase M18 [Ostreococcus tauri]
Length=549

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P++ KG+V+KHNA+QRYAT+ VT +LF+E A++ N+PTQD
Sbjct  419  ADMAHALHPNYMDKHEENHQPKMHKGMVVKHNANQRYATTAVTGYLFRECAKMENVPTQD  478

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPI+A+GVGIRTVD GI QLSMHSVRE+CG EDIDI  +HF AFY  
Sbjct  479  FVVRNDMGCGSTIGPIVAAGVGIRTVDVGIPQLSMHSVREMCGVEDIDICLRHFTAFYDN  538

Query  372  FSSVDRKLNVD  340
            F+ VD  + VD
Sbjct  539  FAKVDSTVTVD  549



>ref|XP_008464464.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Cucumis 
melo]
Length=482

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  351  ADMAHALHPNYMDKHEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQD  410

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+ 
Sbjct  411  FVVRNDMGCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCATDDVNHSYEHFKAYYEE  470

Query  372  FSSVDRKLNVD  340
            FSS+D KL VD
Sbjct  471  FSSLDEKLTVD  481



>ref|XP_011044185.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=486

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSFLF+E+A  HNLPTQD
Sbjct  355  ADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFLFREIATKHNLPTQD  414

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  415  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  474

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  475  FSDLDAKITVD  485



>ref|XP_002318119.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEE96339.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=486

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSFLF+E+A  HNLPTQD
Sbjct  355  ADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFLFREIATKHNLPTQD  414

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  415  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  474

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  475  FSDLDAKITVD  485



>ref|XP_004138058.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=485

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  354  ADMAHALHPNYMDKHEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQD  413

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+ 
Sbjct  414  FVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCATDDVNYSYEHFKAYYEE  473

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  474  FSSLDQKLTVD  484



>ref|XP_004165826.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartyl aminopeptidase-like 
[Cucumis sativus]
Length=485

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  354  ADMAHALHPNYMDKHEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQD  413

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+ 
Sbjct  414  FVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCATDDVNYSYEHFKAYYEE  473

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  474  FSSLDQKLTVD  484



>gb|KGN63496.1| hypothetical protein Csa_1G002160 [Cucumis sativus]
Length=512

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  381  ADMAHALHPNYMDKHEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQD  440

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+ 
Sbjct  441  FVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCATDDVNYSYEHFKAYYEE  500

Query  372  FSSVDRKLNVD  340
            FSS+D+KL VD
Sbjct  501  FSSLDQKLTVD  511



>gb|KFK26680.1| hypothetical protein AALP_AA8G278900 [Arabis alpina]
Length=477

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  346  ADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQD  405

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  406  FVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQE  465

Query  372  FSSVDRKLNVD  340
            F+ +D KL+VD
Sbjct  466  FTVLDTKLSVD  476



>ref|XP_002321687.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEF05814.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=489

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ +TSFLF+E+A  H+LPTQD
Sbjct  358  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAITSFLFREIATKHDLPTQD  417

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  418  FVVRNDMGCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCSVDDVKYSYEHFKAFFQD  477

Query  372  FSSVDRKLNVD  340
             S +D K+ VD
Sbjct  478  ISHLDAKITVD  488



>ref|XP_002511215.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF51817.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=441

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P +  GLVIKHNA+QRYAT+ VTSFLFKE+A  HNLP QD
Sbjct  310  ADMAHALHPNYADKHEENHQPRMHGGLVIKHNANQRYATNSVTSFLFKEIASKHNLPVQD  369

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ 
Sbjct  370  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFED  429

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  430  FSHLDSKITVD  440



>ref|XP_008239439.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=490

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTS +F+E+AR HNLP QD
Sbjct  359  ADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSLIFREIARNHNLPVQD  418

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  419  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQE  478

Query  372  FSSVDRKLNVDC  337
            FS +D K+ VD 
Sbjct  479  FSHLDEKIKVDA  490



>ref|XP_002963681.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
 gb|EFJ35552.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
Length=475

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P++ KGLV+K+NA+QRYAT+ VTSF+FKE+AR  +LPTQD
Sbjct  345  ADMAHCLHPNYMDKHEENHQPKMHKGLVVKYNANQRYATNAVTSFIFKEIARRQDLPTQD  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+CG +D+  +Y+HFK F++ 
Sbjct  405  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCGVDDVGYSYRHFKLFFED  464

Query  372  FSSVDRKLNVD  340
            FS++D+ +NVD
Sbjct  465  FSALDQHVNVD  475



>emb|CDY34036.1| BnaC03g27790D [Brassica napus]
Length=478

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  347  ADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQD  406

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  407  FVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQE  466

Query  372  FSSVDRKLNVD  340
            F+ +D KL VD
Sbjct  467  FTHLDAKLTVD  477



>ref|XP_009134060.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=478

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  347  ADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQD  406

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  407  FVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQE  466

Query  372  FSSVDRKLNVD  340
            F+ +D KL VD
Sbjct  467  FTHLDAKLTVD  477



>emb|CDX83160.1| BnaA03g23460D [Brassica napus]
Length=478

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  347  ADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQD  406

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  407  FVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQE  466

Query  372  FSSVDRKLNVD  340
            F+ +D KL VD
Sbjct  467  FTHLDAKLTVD  477



>ref|NP_200824.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 dbj|BAA97497.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AAK73942.1| AT5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AAM91365.1| At5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AED97287.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=477

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  346  ADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQD  405

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  406  FVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQE  465

Query  372  FSSVDRKLNVD  340
            F+ +D KL +D
Sbjct  466  FTHLDAKLTID  476



>gb|AAM61631.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
Length=477

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  346  ADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQD  405

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  406  FVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQE  465

Query  372  FSSVDRKLNVD  340
            F+ +D KL +D
Sbjct  466  FTHLDAKLTID  476



>ref|XP_010536640.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=489

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P++  GLVIK NA+QRYAT+ VTSF+FKE+A  HNLP QD
Sbjct  358  ADMAHALHPNYMDKHEENHQPKMHGGLVIKTNANQRYATNAVTSFIFKEIAEKHNLPVQD  417

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  418  FVVRNDMGCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQE  477

Query  372  FSSVDRKLNVD  340
            F+ +D KL +D
Sbjct  478  FAHLDSKLTID  488



>ref|NP_001066463.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|ABA96906.1| Aspartyl aminopeptidase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29482.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|EAY82691.1| hypothetical protein OsI_37907 [Oryza sativa Indica Group]
 gb|EAZ20072.1| hypothetical protein OsJ_35672 [Oryza sativa Japonica Group]
Length=478

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H+LP QD
Sbjct  347  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHHLPIQD  406

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ 
Sbjct  407  FVVRNDMGCGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDIKHSYEHFKAYFEE  466

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VDC
Sbjct  467  FTELDSKVKVDC  478



>ref|XP_002866374.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42633.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  346  ADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQD  405

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q 
Sbjct  406  FVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQE  465

Query  372  FSSVDRKLNVD  340
            F+ +D KL VD
Sbjct  466  FTHLDAKLTVD  476



>sp|B9RAJ0.2|DNPEP_RICCO RecName: Full=Probable aspartyl aminopeptidase [Ricinus communis]
Length=491

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P +  GLVIKHNA+QRYAT+ VTSFLFKE+A  HNLP QD
Sbjct  360  ADMAHALHPNYADKHEENHQPRMHGGLVIKHNANQRYATNSVTSFLFKEIASKHNLPVQD  419

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ 
Sbjct  420  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFED  479

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  480  FSHLDSKITVD  490



>ref|XP_002974770.1| hypothetical protein SELMODRAFT_101663 [Selaginella moellendorffii]
 gb|EFJ24290.1| hypothetical protein SELMODRAFT_101663 [Selaginella moellendorffii]
Length=498

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P++ KGLV+K+NA+QRYAT+ VTSF+FKE+AR  +LPTQD
Sbjct  368  ADMAHCLHPNYMDKHEENHQPKMHKGLVVKYNANQRYATNAVTSFIFKEIARRQDLPTQD  427

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+CG +D+  +Y+HFK F++ 
Sbjct  428  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCGVDDVGYSYRHFKLFFED  487

Query  372  FSSVDRKLNVD  340
            FS++D+ +NVD
Sbjct  488  FSALDQHVNVD  498



>tpg|DAA58400.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=321

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP QD
Sbjct  190  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQD  249

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ 
Sbjct  250  FVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAADDISYSYEHFKAYFEE  309

Query  372  FSSVDRKLNVD  340
            F+ +D K+ VD
Sbjct  310  FTELDGKVKVD  320



>ref|XP_007209960.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
 gb|EMJ11159.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
Length=488

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTS +F+E+AR HNLP QD
Sbjct  357  ADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSLIFREIARNHNLPVQD  416

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  417  FAVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVQYSYEHFKAFFQE  476

Query  372  FSSVDRKLNVDC  337
            FS +D K+ VD 
Sbjct  477  FSHLDEKIKVDA  488



>ref|XP_006664453.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=474

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H+LP QD
Sbjct  343  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAENHHLPVQD  402

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKA+++ 
Sbjct  403  FVVRNDMGCGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDVSHSYEHFKAYFEE  462

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VDC
Sbjct  463  FTELDSKVRVDC  474



>gb|AFK46082.1| unknown [Lotus japonicus]
Length=479

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  348  ADMAHALHPNYMDKHEENHQPKLHAGLVIKNNANQRYATNAVTSFIFREIASKHNLPVQD  407

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASG+GIRTVD G  QLSMHS+RE+C  +D++ +YKHFKAF+Q 
Sbjct  408  FVVRNDMACGSTIGPILASGMGIRTVDVGAPQLSMHSIREMCAIDDVNYSYKHFKAFFQE  467

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  468  FSHLDAKIVVD  478



>ref|XP_006476998.1| PREDICTED: probable aspartyl aminopeptidase-like [Citrus sinensis]
Length=483

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSF+F+EVA  HNLP QD
Sbjct  352  ADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFVFREVASKHNLPVQD  411

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  412  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  471

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  472  FSELDAKIKVD  482



>ref|XP_006402123.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
 gb|ESQ43576.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
Length=465

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  334  ADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAVKHNLPVQD  393

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ 
Sbjct  394  FVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFRE  453

Query  372  FSSVDRKLNVD  340
            F+ +D KL VD
Sbjct  454  FTHLDAKLAVD  464



>ref|XP_007037930.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
 gb|EOY22431.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
Length=520

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  389  ADMAHAVHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMQHNLPVQD  448

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  449  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  508

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  509  FSHLDTKITVD  519



>gb|EYU43065.1| hypothetical protein MIMGU_mgv1a005789mg [Erythranthe guttata]
Length=470

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSFLF+E+A  HNLP QD
Sbjct  339  ADMAHALHPNYMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFLFREIAAKHNLPVQD  398

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR+DM CGSTIGPI+ASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  399  FVVRSDMLCGSTIGPIIASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  458

Query  372  FSSVDRKLNVD  340
            FS++D KL VD
Sbjct  459  FSNLDAKLTVD  469



>ref|XP_010674696.1| PREDICTED: probable aspartyl aminopeptidase [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+FKE+A  HNLP Q+
Sbjct  356  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFKEIALKHNLPVQE  415

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAFY  
Sbjct  416  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVMHSYMHFKAFYME  475

Query  372  FSSVDRKLNVDC  337
            FS +D KL VD 
Sbjct  476  FSDLDSKLTVDA  487



>ref|XP_006440072.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
 gb|ESR53312.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
Length=515

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSF+F+EVA  HNLP QD
Sbjct  384  ADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFVFREVASKHNLPVQD  443

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  444  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  503

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  504  FSELDAKIKVD  514



>ref|XP_011083884.1| PREDICTED: probable aspartyl aminopeptidase [Sesamum indicum]
Length=480

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSFLF+E+A  H LP QD
Sbjct  349  ADMAHALHPNYMDKHEENHQPKMHSGLVIKHNANQRYATNAVTSFLFREIAAKHKLPVQD  408

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV+RNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  409  FVIRNDMLCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYQHFKAFFQE  468

Query  372  FSSVDRKLNVD  340
            FS +D KL VD
Sbjct  469  FSHLDAKLAVD  479



>gb|KHF99832.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=463

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTS +F+E+A  HNLP QD
Sbjct  332  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSLIFREIAMKHNLPIQD  391

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRT+D G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  392  FVVRNDMPCGSTIGPILASGVGIRTIDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  451

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  452  FSQLDAKITVD  462



>ref|XP_002458215.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
 gb|EES03335.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
Length=475

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP QD
Sbjct  344  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPVQD  403

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  AY+HFKA+Y+ 
Sbjct  404  FVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDISHAYEHFKAYYEE  463

Query  372  FSSVDRKLNVD  340
            F+ +D K+ VD
Sbjct  464  FTELDSKVKVD  474



>ref|XP_006280394.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
 gb|EOA13292.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
Length=478

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKH+E+H+P++  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP QD
Sbjct  347  ADMAHALHPNFMDKHDENHQPKMHGGLVIKHNANQRYATNALTSFVFREIAEKHNLPVQD  406

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKAF+Q 
Sbjct  407  FVVRNDMACGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVEHSYEHFKAFFQE  466

Query  372  FSSVDRKLNVD  340
            F+ +D KL VD
Sbjct  467  FTHLDAKLTVD  477



>ref|XP_003578741.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=475

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP QD
Sbjct  345  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAEKHQLPIQD  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  AY+HFKA+++ 
Sbjct  405  FVVRNDMGCGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCATDDVKHAYEHFKAYFEE  464

Query  372  FSSVDRKLNVD  340
            F+ +D K+ +D
Sbjct  465  FTELDSKIIID  475



>ref|XP_009346502.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP QD
Sbjct  355  ADMAHALHPNYMDKHEQNHQPKLHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQD  414

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  415  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQE  474

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VD 
Sbjct  475  FTHLDAKIKVDA  486



>ref|NP_001159225.1| hypothetical protein [Zea mays]
 gb|ACN25500.1| unknown [Zea mays]
 tpg|DAA58399.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=407

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP QD
Sbjct  276  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQD  335

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ 
Sbjct  336  FVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAADDISYSYEHFKAYFEE  395

Query  372  FSSVDRKLNVD  340
            F+ +D K+ VD
Sbjct  396  FTELDGKVKVD  406



>ref|XP_008374264.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP QD
Sbjct  355  ADMAHALHPNYMDKHEQNHQPKLHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQD  414

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  415  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  474

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VD 
Sbjct  475  FTRLDSKIKVDA  486



>ref|XP_010456062.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=475

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKH+E+H+P++  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP QD
Sbjct  344  ADMAHALHPNFMDKHDENHQPKMHGGLVIKHNANQRYATNALTSFIFREIAEKHNLPVQD  403

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q 
Sbjct  404  FVVRNDMACGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQE  463

Query  372  FSSVDRKLNVD  340
            F+ +D KL VD
Sbjct  464  FTHLDAKLTVD  474



>ref|XP_006826610.1| hypothetical protein AMTR_s00138p00074300 [Amborella trichopoda]
 gb|ERM93847.1| hypothetical protein AMTR_s00138p00074300 [Amborella trichopoda]
Length=344

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P L  GLVIKHNA+QRYA++ VTSF+F+E+A+ H LP Q+
Sbjct  213  ADMAHALHPNYMDKHEENHQPRLHGGLVIKHNANQRYASNSVTSFIFREIAKQHKLPVQE  272

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+  
Sbjct  273  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCSVDDVKHSYEHFKAFFHE  332

Query  372  FSSVDRKLNVD  340
            F+ +D K++VD
Sbjct  333  FAQLDAKISVD  343



>ref|XP_009336570.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ +T+ +F+E+AR H+LP QD
Sbjct  355  ADMAHALHPNYMDKHEQNHQPKLHGGLVIKHNANQRYATNAITALIFREIARNHSLPVQD  414

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  415  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQE  474

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VD 
Sbjct  475  FTHLDAKIKVDA  486



>ref|XP_009359462.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ +T+ +F+E+AR H+LP QD
Sbjct  355  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAITALIFREIARNHSLPVQD  414

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  415  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVRHSYEHFKAFFQE  474

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VD 
Sbjct  475  FTHLDAKIKVDA  486



>ref|XP_010483659.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKH+E+H+P++  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP QD
Sbjct  347  ADMAHALHPNFMDKHDENHQPKMHGGLVIKHNANQRYATNALTSFVFREIAEKHNLPVQD  406

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q 
Sbjct  407  FVVRNDMACGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQE  466

Query  372  FSSVDRKLNVD  340
            F+ +D KL VD
Sbjct  467  FTHLDAKLTVD  477



>ref|XP_010443807.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKH+E+H+P++  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP QD
Sbjct  347  ADMAHALHPNFMDKHDENHQPKMHGGLVIKHNANQRYATNALTSFVFREIAEKHNLPVQD  406

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q 
Sbjct  407  FVVRNDMACGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQE  466

Query  372  FSSVDRKLNVD  340
            F+ +D KL VD
Sbjct  467  FTHLDAKLTVD  477



>ref|XP_008673044.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN26704.1| unknown [Zea mays]
 gb|ACN27911.1| unknown [Zea mays]
 tpg|DAA58398.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=475

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP QD
Sbjct  344  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQD  403

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ 
Sbjct  404  FVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAADDISYSYEHFKAYFEE  463

Query  372  FSSVDRKLNVD  340
            F+ +D K+ VD
Sbjct  464  FTELDGKVKVD  474



>ref|XP_003526970.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE +H+P+L  GLVIK NASQRYAT+ VTSF+F+E+A  H LP QD
Sbjct  356  ADMAHALHPNYMDKHEANHQPKLHGGLVIKTNASQRYATNVVTSFIFREIASKHKLPVQD  415

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+REIC  +D+  +Y+HFKAFYQ 
Sbjct  416  FVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREICAVDDVKYSYEHFKAFYQE  475

Query  372  FSSVDRKLNVD  340
            FS VD K+ VD
Sbjct  476  FSHVDGKMVVD  486



>ref|XP_007137936.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
 gb|ESW09930.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
Length=481

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHE +H+P+L  GLVIK+NA+QRYAT+ VTSFLF+E+A  HNLP QD
Sbjct  350  ADMAHALHPNYMEKHEANHQPKLHGGLVIKNNANQRYATNIVTSFLFREIASKHNLPVQD  409

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAFYQ 
Sbjct  410  FVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREVCAVDDVKYSYEHFKAFYQE  469

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  470  FSHLDGKMVVD  480



>ref|XP_008367478.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP QD
Sbjct  355  ADMAHALHPNYMDKHEENHQPKXHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQD  414

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  415  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  474

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VD 
Sbjct  475  FTHLDAKIKVDA  486



>ref|XP_008392833.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP QD
Sbjct  355  ADMAHALHPNYMDKHEENHQPKXHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQD  414

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  415  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  474

Query  372  FSSVDRKLNVDC  337
            F+ +D K+ VD 
Sbjct  475  FTHLDAKIKVDA  486



>ref|XP_004500663.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=482

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIK NA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  351  ADMAHALHPNYMDKHEENHQPKLHGGLVIKQNANQRYATNAVTSFIFREIASKHNLPVQD  410

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  411  FVVRNDTACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQE  470

Query  372  FSSVDRKLNVD  340
            FS +D  L VD
Sbjct  471  FSHLDANLVVD  481



>ref|XP_004960722.1| PREDICTED: probable aspartyl aminopeptidase-like [Setaria italica]
Length=475

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP QD
Sbjct  344  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPVQD  403

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ 
Sbjct  404  FVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDISHSYEHFKAYFEE  463

Query  372  FSSVDRKLNVD  340
            F+ +D K+ VD
Sbjct  464  FTELDSKVKVD  474



>ref|XP_010102886.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB94323.1| Aspartyl aminopeptidase [Morus notabilis]
Length=507

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIK NA+QRYAT+ VTSFLF+E+A  H +PTQD
Sbjct  377  ADMAHALHPNYMDKHEENHQPKLHGGLVIKSNANQRYATNSVTSFLFREIASKHKIPTQD  436

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  AY+HFKA++Q 
Sbjct  437  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVRHAYQHFKAYFQE  496

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  497  FSHLDSKIIVD  507



>ref|XP_009379936.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   199 bits (507),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A +HNLP QD
Sbjct  345  ADMAHALHPNFMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAEMHNLPFQD  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +Y+HFKA++  
Sbjct  405  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSYEHFKAYFNE  464

Query  372  FSSVDRKLNVD  340
            F+ +++KL VD
Sbjct  465  FTKLEKKLVVD  475



>ref|XP_010026684.1| PREDICTED: probable aspartyl aminopeptidase [Eucalyptus grandis]
 gb|KCW83183.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=473

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A+ H+LP QD
Sbjct  342  ADMAHALHPNYMEKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAQKHDLPIQD  401

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA++Q 
Sbjct  402  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVNHSYEHFKAYFQE  461

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  462  FSYLDAKIAVD  472



>ref|XP_009404266.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPNF DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A +HNLP QD
Sbjct  345  ADMAHALHPNFMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAEMHNLPIQD  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND+ CGS+IGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +Y+H KA++  
Sbjct  405  FVVRNDIPCGSSIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSYEHLKAYFDE  464

Query  372  FSSVDRKLNVDC  337
            F+ +D KL VDC
Sbjct  465  FTELDNKLIVDC  476



>ref|XP_001756754.1| predicted protein [Physcomitrella patens]
 gb|EDQ78351.1| predicted protein [Physcomitrella patens]
Length=467

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHEE+H+P++ +GLVIK NA+QRYAT+ +TSF+F+E+A++ NLPTQ+
Sbjct  335  ADMAHCLHPNYPEKHEENHQPKMHRGLVIKDNANQRYATNAITSFIFREIAKLRNLPTQN  394

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND+ CGSTIGPILASG+GIRTVD G  QLSMHS+RE+CG +D+  +Y HFKAF++ 
Sbjct  395  FVVRNDVACGSTIGPILASGIGIRTVDVGAPQLSMHSIREMCGVDDVGYSYNHFKAFFED  454

Query  372  FSSVDRKLNVD  340
            FS++D +L VD
Sbjct  455  FSALDAQLAVD  465



>gb|KJB27155.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=463

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  332  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMKHNLPIQD  391

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ 
Sbjct  392  FVVRNDTPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFKE  451

Query  372  FSSVDRKLNVD  340
            FS +D K+  D
Sbjct  452  FSQLDTKITGD  462



>gb|KJB27157.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=464

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  333  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMKHNLPIQD  392

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ 
Sbjct  393  FVVRNDTPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFKE  452

Query  372  FSSVDRKLNVD  340
            FS +D K+  D
Sbjct  453  FSQLDTKITGD  463



>gb|KJB27156.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=461

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  330  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMKHNLPIQD  389

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ 
Sbjct  390  FVVRNDTPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFKE  449

Query  372  FSSVDRKLNVD  340
            FS +D K+  D
Sbjct  450  FSQLDTKITGD  460



>ref|XP_003602076.1| Aspartyl aminopeptidase [Medicago truncatula]
 gb|AES72327.1| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=482

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ D+HEE+H+P+L  GLVIK NA+QRYAT+ VTSF+F+E+A  HNLP QD
Sbjct  351  ADMAHALHPNYMDRHEENHQPKLHGGLVIKQNANQRYATNAVTSFIFREIASKHNLPVQD  410

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASG+GIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ 
Sbjct  411  FVVRNDMACGSTIGPILASGIGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFKE  470

Query  372  FSSVDRKLNVD  340
            FS +D  + VD
Sbjct  471  FSHLDANIVVD  481



>gb|KCW83184.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=508

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A+ H+LP QD
Sbjct  377  ADMAHALHPNYMEKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAQKHDLPIQD  436

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA++Q 
Sbjct  437  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVNHSYEHFKAYFQE  496

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  497  FSYLDAKIAVD  507



>ref|XP_002283475.1| PREDICTED: probable aspartyl aminopeptidase [Vitis vinifera]
 emb|CBI15632.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKH+E+H+P+L  GLVIKHNA+QRYAT+ VTSF+FKE+A  HNLP QD
Sbjct  354  ADMAHALHPNYMDKHDENHQPKLHGGLVIKHNANQRYATNAVTSFIFKEIAAKHNLPVQD  413

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+   +D+  +Y+HF+A++Q 
Sbjct  414  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMSAVDDVKHSYEHFRAYFQE  473

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  474  FSCLDAKITVD  484



>emb|CDP05422.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  H LP QD
Sbjct  351  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAARHKLPIQD  410

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASG+GIRTVD G  QLSMHS+RE+C  +D+  +Y+HFK+F++ 
Sbjct  411  FVVRNDMPCGSTIGPILASGLGIRTVDVGAPQLSMHSIREMCAVDDVRHSYEHFKSFFEE  470

Query  372  FSSVDRKLNVDC  337
            FS +D K+ VD 
Sbjct  471  FSYLDTKITVDA  482



>ref|XP_006351481.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=483

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ +TSF+F+E+A  HN+P QD
Sbjct  352  ADMAHALHPNYPDKHEENHQPKFHGGLVIKHNANQRYATNAITSFVFREIASKHNIPLQD  411

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV+RNDM CGSTIGPILASGVGIRTVD G  Q SMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  412  FVIRNDMPCGSTIGPILASGVGIRTVDVGAPQWSMHSIREMCAVDDVKHSYEHFKAFFQD  471

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  472  FSQLDGKIAVD  482



>ref|XP_011463290.1| PREDICTED: probable aspartyl aminopeptidase, partial [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTS +F+E+A  H+LP Q+
Sbjct  324  ADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSLIFREIAMNHSLPVQE  383

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKA+YQ 
Sbjct  384  FVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAYYQE  443

Query  372  FSSVDRKLNVD  340
            F+ +D K+ VD
Sbjct  444  FTHMDAKIKVD  454



>ref|XP_009624334.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=479

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ VTSF+F+E+A  HN+P QD
Sbjct  348  ADMAHALHPNYPDKHEENHQPKFHGGLVIKHNANQRYATNAVTSFIFREIAAKHNIPIQD  407

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV+RNDM CGSTIGPILASG+GIRTVD G  Q SMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  408  FVIRNDMPCGSTIGPILASGIGIRTVDVGAPQWSMHSIREMCAVDDVKHSYQHFKAFFQD  467

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  468  FSLLDGKIAVD  478



>ref|XP_010248918.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=490

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  H LP QD
Sbjct  359  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAEKHGLPIQD  418

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFK++++ 
Sbjct  419  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKSYFRE  478

Query  372  FSSVDRKLNVD  340
            F+ +D K++VD
Sbjct  479  FTQLDAKISVD  489



>ref|XP_009790447.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=479

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ VTSF+F+E+A  HN+P QD
Sbjct  348  ADMAHALHPNYPDKHEENHQPKFHGGLVIKHNANQRYATNAVTSFIFREIAAKHNIPIQD  407

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV+RNDM CGSTIGPILASG+GIRTVD G  Q SMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  408  FVIRNDMPCGSTIGPILASGIGIRTVDVGAPQWSMHSIREMCAVDDVKHSYEHFKAFFQD  467

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  468  FSHLDGKIAVD  478



>ref|XP_003523136.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHE +H+P+L  GLVIK NA+QRYAT+ VTSF+F+E+A  H LP QD
Sbjct  356  ADMAHALHPNYMEKHEANHQPKLHGGLVIKTNANQRYATNVVTSFIFREIASKHKLPVQD  415

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPILASG+GIRTVD G  QLSMHS+REIC  +D+  +Y+HFKAFY+ 
Sbjct  416  FVVRNDMGCGSTIGPILASGIGIRTVDVGAPQLSMHSIREICAVDDVKHSYEHFKAFYEE  475

Query  372  FSSVDRKLNVD  340
            FS VD K+ VD
Sbjct  476  FSHVDGKMVVD  486



>ref|XP_004236341.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=482

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ +TSF+F+E+A  HN+P QD
Sbjct  351  ADMAHALHPNYPDKHEENHQPKFHGGLVIKHNANQRYATNAITSFVFREIAAKHNIPLQD  410

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV+RNDM CGSTIGPILASGVGIRTVD G  Q SMHS+RE+C  +D+  +Y HFKAF+Q 
Sbjct  411  FVIRNDMPCGSTIGPILASGVGIRTVDVGAPQWSMHSIREMCAVDDVKHSYDHFKAFFQD  470

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  471  FSQLDGKIAVD  481



>gb|EPS62030.1| aspartyl aminopeptidase-like protein, partial [Genlisea aurea]
Length=475

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L +GLVIKHNA+QRYAT+ V+SFLF+E+A  + LP Q+
Sbjct  345  ADMAHALHPNYMDKHEENHQPKLHEGLVIKHNANQRYATNAVSSFLFREIAARNGLPVQE  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV+RND+ CGSTIGPILASG GIRTVD G  QLSMHSVRE+CG +D+  +Y HFKAF+  
Sbjct  405  FVIRNDLACGSTIGPILASGAGIRTVDVGAPQLSMHSVREMCGVDDVKHSYDHFKAFFLQ  464

Query  372  FSSVDRKLNVD  340
            FS++D+ L VD
Sbjct  465  FSALDQNLAVD  475



>gb|KDP30945.1| hypothetical protein JCGZ_11321 [Jatropha curcas]
Length=483

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P++  GLVIKHNA+QRYAT+ VT+FLF+E+A  H +P QD
Sbjct  352  ADMAHALHPNYMDKHEDNHQPKMHGGLVIKHNANQRYATNSVTAFLFREIASKHKIPIQD  411

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPI+ASG+GIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q 
Sbjct  412  FVVRNDMPCGSTIGPIIASGIGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQE  471

Query  372  FSSVDRKLNVD  340
            FS +D K+ VD
Sbjct  472  FSHLDAKITVD  482



>ref|XP_004172613.1| PREDICTED: probable aspartyl aminopeptidase-like, partial [Cucumis 
sativus]
Length=397

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNFTDKHEEHHRPE+QKG+VIKHNA+QRYATSGVT+FLF+EV RIHNLPTQD
Sbjct  302  ADMAHGVHPNFTDKHEEHHRPEMQKGIVIKHNANQRYATSGVTAFLFREVGRIHNLPTQD  361

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  445
            FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMH
Sbjct  362  FVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMH  397



>ref|XP_008807558.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Phoenix 
dactylifera]
Length=476

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ ++SF+F+E+A  HN+P QD
Sbjct  345  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAISSFIFREIAERHNIPIQD  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +++HFKA++  
Sbjct  405  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSFEHFKAYFDE  464

Query  372  FSSVDRKLNVD  340
            F+ +D K+ VD
Sbjct  465  FTQLDAKITVD  475



>ref|XP_008807556.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807557.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
Length=487

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ ++SF+F+E+A  HN+P QD
Sbjct  356  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAISSFIFREIAERHNIPIQD  415

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +++HFKA++  
Sbjct  416  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSFEHFKAYFDE  475

Query  372  FSSVDRKLNVD  340
            F+ +D K+ VD
Sbjct  476  FTQLDAKITVD  486



>gb|ABR17053.1| unknown [Picea sitchensis]
Length=502

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE++H+P++ KGLVIK NA+QRYAT+ VTSF+F+E+ + + LPTQ+
Sbjct  371  ADMAHSLHPNYMDKHEQNHQPQMHKGLVIKFNANQRYATNAVTSFIFREIGKKNKLPTQE  430

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGST+GPILASGVGIRTVD G  QLSMHS+RE+CG +D+  ++ HFKAF++ 
Sbjct  431  FVVRNDMPCGSTVGPILASGVGIRTVDVGAPQLSMHSIREMCGVDDVVYSHLHFKAFFED  490

Query  372  FSSVDRKLNVDC  337
            ++  D+++ VDC
Sbjct  491  YAEFDKQIKVDC  502



>ref|XP_010930126.1| PREDICTED: probable aspartyl aminopeptidase [Elaeis guineensis]
Length=476

 Score =   194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP QD
Sbjct  345  ADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAITSFIFREIAERHNLPIQD  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +++HFKA++  
Sbjct  405  FVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSFEHFKAYFDE  464

Query  372  FSSVDRKLNVD  340
            F+ +D  + VD
Sbjct  465  FTQLDANIIVD  475



>gb|KCW51472.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=489

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNFTDKHEEHHRPE+QKGLVIKHNA+QRYATSG+T+FLFKEV +IHNLPTQ+
Sbjct  391  ADMAHGVHPNFTDKHEEHHRPEMQKGLVIKHNANQRYATSGITAFLFKEVGKIHNLPTQE  450

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  445
            F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH
Sbjct  451  FAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  486



>gb|KJB19571.1| hypothetical protein B456_003G109700 [Gossypium raimondii]
Length=337

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE H+ +L  GLVIKHNA+QRYAT+ VTSF+F E+A  HNLP QD
Sbjct  206  ADMAHALHPNYMDKHEESHQSKLHGGLVIKHNANQRYATNAVTSFIFWEIAVKHNLPIQD  265

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILA GVGIRTVD G  QLSMH +RE+C  +D+  + +HFKAF+  
Sbjct  266  FVVRNDMPCGSTIGPILAGGVGIRTVDIGAPQLSMHGIREMCAVDDVKHSNEHFKAFFHE  325

Query  372  FSSVDRKLNVD  340
            FS +D K++VD
Sbjct  326  FSQLDTKISVD  336



>gb|KDO42029.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=510

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+
Sbjct  391  ADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQE  450

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  445
            FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH
Sbjct  451  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  486



>ref|XP_002507546.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
 gb|ACO68804.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
Length=500

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE +H P+L  GLVIKHNA+QRYAT+ VT+ LF+E A    +PTQ+
Sbjct  368  ADMAHALHPNYADKHESNHAPKLHAGLVIKHNANQRYATNAVTATLFRECASKSGIPTQE  427

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPIL++ +GIRTVD G+ QLSMHSVRE+CG EDIDI Y+HFK+F++ 
Sbjct  428  FVVRNDMGCGSTIGPILSANLGIRTVDVGVPQLSMHSVREMCGTEDIDICYRHFKSFFEN  487

Query  372  FSSVDRKLN  346
            F++V    N
Sbjct  488  FAAVSSDCN  496



>gb|KJB19572.1| hypothetical protein B456_003G109700 [Gossypium raimondii]
Length=450

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHEE H+ +L  GLVIKHNA+QRYAT+ VTSF+F E+A  HNLP QD
Sbjct  319  ADMAHALHPNYMDKHEESHQSKLHGGLVIKHNANQRYATNAVTSFIFWEIAVKHNLPIQD  378

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CGSTIGPILA GVGIRTVD G  QLSMH +RE+C  +D+  + +HFKAF+  
Sbjct  379  FVVRNDMPCGSTIGPILAGGVGIRTVDIGAPQLSMHGIREMCAVDDVKHSNEHFKAFFHE  438

Query  372  FSSVDRKLNVD  340
            FS +D K++VD
Sbjct  439  FSQLDTKISVD  449



>ref|XP_004138060.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=481

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +K+EE+HRP+   GLVIK+NAS +YAT+ VT+ LF+E+A  HNLP Q+
Sbjct  351  ADMAHALHPNYMEKYEENHRPKFHGGLVIKNNASNKYATNAVTAALFRELAIKHNLPVQE  410

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CG+TIGPILASG+GIRTVD G  QLSMHS RE+CG +D+D +Y+HFKA+++ 
Sbjct  411  FVVRNDMACGTTIGPILASGLGIRTVDVGAPQLSMHSAREVCGTDDVDYSYQHFKAYFEE  470

Query  372  FSSVD  358
            FSS+D
Sbjct  471  FSSLD  475



>ref|XP_004165827.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
 gb|KGN63497.1| hypothetical protein Csa_1G002660 [Cucumis sativus]
Length=481

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +K+EE+HRP+   GLVIK+NAS +YAT+ VT+ LF+E+A  HNLP Q+
Sbjct  351  ADMAHALHPNYMEKYEENHRPKFHGGLVIKNNASNKYATNAVTAALFRELAIKHNLPVQE  410

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CG+TIGPILASG+GIRTVD G  QLSMHS RE+CG +D+D +Y+HFKA+++ 
Sbjct  411  FVVRNDMACGTTIGPILASGLGIRTVDVGAPQLSMHSAREVCGTDDVDYSYQHFKAYFEE  470

Query  372  FSSVD  358
            FSS+D
Sbjct  471  FSSLD  475



>dbj|BAD94988.1| aspartyl aminopeptidase [Arabidopsis thaliana]
Length=96

 Score =   178 bits (451),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -2

Query  624  YATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  445
            YATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH
Sbjct  1    YATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  60

Query  444  SVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  340
            SVREICG +DIDIAY+HFKAFY++FSSVD+KL VD
Sbjct  61   SVREICGTDDIDIAYRHFKAFYRSFSSVDKKLVVD  95



>ref|XP_010694703.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=505

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRP++QKGLVIKHNA+QRYATSGVT+FLFKEVA+IHNLPTQ+
Sbjct  399  ADMAHGVHPNFMDKHEENHRPQMQKGLVIKHNANQRYATSGVTAFLFKEVAKIHNLPTQE  458

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  445
            FVV+NDMGCGSTIGPILA+GVGIRTVDCGI+QLSMH
Sbjct  459  FVVKNDMGCGSTIGPILAAGVGIRTVDCGISQLSMH  494



>gb|EMS55846.1| Aspartyl aminopeptidase [Triticum urartu]
Length=618

 Score =   191 bits (485),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 111/145 (77%), Gaps = 13/145 (9%)
 Frame = -2

Query  732  ADMAHGVHPNFT-------------DKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLF  592
            ADMAH +HPN+              +KHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F
Sbjct  474  ADMAHALHPNYMVIIVFLDQFMGSQEKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIF  533

Query  591  KEVARIHNLPTQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDI  412
            +E+A  H LP QDFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+
Sbjct  534  QEIAERHQLPIQDFVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDV  593

Query  411  DIAYKHFKAFYQTFSSVDRKLNVDC  337
            + +Y+H KA+++ F+ +D K+ VDC
Sbjct  594  NYSYEHLKAYFEEFTELDNKVKVDC  618



>ref|XP_008464465.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Cucumis 
melo]
Length=481

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +K+EE+HRP+   GLVIK+NA+ +YAT+ VT+ LF+E+A  HNLP Q+
Sbjct  351  ADMAHALHPNYMEKYEENHRPKFHGGLVIKNNANNKYATNAVTAALFRELAIKHNLPVQE  410

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDM CG+TIGPILASG+GIRTVD G  QLSMHS RE+CG +D+D +Y+HFKA+++ 
Sbjct  411  FVVRNDMACGTTIGPILASGLGIRTVDVGAPQLSMHSAREVCGTDDVDYSYQHFKAYFEE  470

Query  372  FSSVD  358
            FSS+D
Sbjct  471  FSSLD  475



>ref|XP_002907085.1| aspartyl aminopeptidase, putative [Phytophthora infestans T30-4]
 gb|EEY63649.1| aspartyl aminopeptidase, putative [Phytophthora infestans T30-4]
Length=462

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPN++D+HE++HRP L  G VIKHNA++RYATSG +SFL KE+AR HN+  Q+
Sbjct  332  ADMAHGVHPNYSDRHEQNHRPALHAGPVIKHNANERYATSGTSSFLMKELARRHNVDIQE  391

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG ED+      F AFY  
Sbjct  392  FVVRQDTGCGSTIGPILSTNTGIRTIDVGLAQLSMHSIREMCGTEDLVKTLDWFTAFYSE  451

Query  372  FSSVDRKLNVD  340
            FSS+D+ L  D
Sbjct  452  FSSLDKCLKTD  462



>ref|XP_001690598.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
 gb|EDP05857.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
Length=565

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN++DKH+  H+P +  GLV+KHN +QRYAT+ V++ LF+EVAR H LP Q+
Sbjct  415  ADMAHALHPNYSDKHDPDHQPRMHGGLVLKHNNNQRYATNAVSAALFREVARRHGLPVQE  474

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRNDM CGSTIGPILAS +G RTVD GIAQLSMHS+RE CG +D+ IAY HF AF++ 
Sbjct  475  FSVRNDMPCGSTIGPILASNLGCRTVDVGIAQLSMHSIREQCGADDVAIAYDHFLAFFKE  534

Query  372  FSSVDRKLNVD  340
            FS++D  L+VD
Sbjct  535  FSALDASLDVD  545



>ref|XP_004336070.1| aspartyl aminopeptidase [Acanthamoeba castellanii str. Neff]
 gb|ELR14057.1| aspartyl aminopeptidase [Acanthamoeba castellanii str. Neff]
Length=372

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ +KHEE+H+P +QKG+ IK+NA+QRYAT+ +T+FL KE+AR H +P Q+
Sbjct  242  ADMAHAVHPNYPEKHEENHQPMMQKGVAIKYNANQRYATTSITAFLLKELARRHGVPMQE  301

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGPIL++G GIRT+D G+ QLSMHS+RE+CG +D+  A    KAFY  
Sbjct  302  FVVRNDSPCGSTIGPILSAGCGIRTIDIGLPQLSMHSIREMCGADDVSHAVNLLKAFYSD  361

Query  372  FSSVDRKLNVD  340
            FS +D  L VD
Sbjct  362  FSKLDESLVVD  372



>ref|XP_008909814.1| hypothetical protein PPTG_14635 [Phytophthora parasitica INRA-310]
 gb|ETI40343.1| hypothetical protein F443_14241 [Phytophthora parasitica P1569]
 gb|ETK80443.1| hypothetical protein L915_13884 [Phytophthora parasitica]
 gb|ETL33871.1| hypothetical protein L916_13780 [Phytophthora parasitica]
 gb|ETL87142.1| hypothetical protein L917_13587 [Phytophthora parasitica]
 gb|ETM40342.1| hypothetical protein L914_13693 [Phytophthora parasitica]
 gb|ETN04877.1| hypothetical protein PPTG_14635 [Phytophthora parasitica INRA-310]
 gb|ETO69064.1| hypothetical protein F444_14258 [Phytophthora parasitica P1976]
 gb|ETP10176.1| hypothetical protein F441_14138 [Phytophthora parasitica CJ01A1]
 gb|ETP38275.1| hypothetical protein F442_14083 [Phytophthora parasitica P10297]
Length=462

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPN++D+HE++HRP L  G VIKHNA++RYATSG + FL KE+AR HN+  Q+
Sbjct  332  ADMAHGVHPNYSDRHEQNHRPALHAGPVIKHNANERYATSGTSCFLMKELARRHNVDIQE  391

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG ED+      F AFY  
Sbjct  392  FVVRQDTGCGSTIGPILSTNTGIRTIDVGLAQLSMHSIREMCGTEDLVKTMDWFTAFYSE  451

Query  372  FSSVDRKLNVD  340
            FSS+D+ L  D
Sbjct  452  FSSLDKCLKTD  462



>ref|XP_009519985.1| hypothetical protein PHYSODRAFT_539739 [Phytophthora sojae]
 gb|EGZ24697.1| hypothetical protein PHYSODRAFT_539739 [Phytophthora sojae]
Length=462

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPN+++KHE++HRP L  G VIK+NA++RYATSG ++FL KE+AR HN+  Q+
Sbjct  332  ADMAHGVHPNYSEKHEQNHRPALHAGPVIKYNANERYATSGTSAFLMKELARRHNVDIQE  391

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG ED+  +   F AFY  
Sbjct  392  FVVRQDTGCGSTIGPILSTNTGIRTIDVGLAQLSMHSIREMCGTEDLVKSLDWFTAFYSE  451

Query  372  FSSVDRKLNVD  340
            FSS+D+ L  D
Sbjct  452  FSSLDKCLKTD  462



>ref|XP_007512692.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17292.1| predicted protein [Bathycoccus prasinos]
Length=615

 Score =   185 bits (470),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+T+KHEE H+P   KG+V+KHNA+QRYAT+ +T+++F+E A++  +PTQ+
Sbjct  484  ADMAHAIHPNYTEKHEEQHQPLFHKGVVVKHNANQRYATTALTAYMFRECAKLSGIPTQE  543

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV+NDMGCGSTIGPI+++  GIRTVD G+ QLSMHSVRE+ G ED+DI +KHF AFY+ 
Sbjct  544  FVVKNDMGCGSTIGPIVSAQTGIRTVDVGVPQLSMHSVREMMGTEDVDICHKHFLAFYEN  603

Query  372  FSSVD  358
             + VD
Sbjct  604  IAKVD  608



>ref|XP_003060266.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55035.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=444

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DKHE  H+P+   G+V+KHNA+QRYAT  V+S+LFKE+     LP Q+
Sbjct  314  ADMAHAVHPNYADKHEPGHKPKFGAGVVVKHNANQRYATDAVSSYLFKEIGERAGLPVQE  373

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR+D+GCGSTIGP L++  GIRTVD G AQLSMHSVRE+CG +D++ A KHF A Y+ 
Sbjct  374  FVVRSDLGCGSTIGPTLSTNTGIRTVDVGAAQLSMHSVREMCGAKDVEHAVKHFTAVYEG  433

Query  372  FSSVDRKLNVD  340
            F+++D  L VD
Sbjct  434  FTALDATLMVD  444



>gb|EMT03759.1| Aspartyl aminopeptidase [Aegilops tauschii]
Length=893

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 109/143 (76%), Gaps = 13/143 (9%)
 Frame = -2

Query  732  ADMAHGVHPNFT-------------DKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLF  592
            ADMAH +HPN+              +KHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F
Sbjct  537  ADMAHALHPNYMVIVVFLDQFMGSQEKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIF  596

Query  591  KEVARIHNLPTQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDI  412
            +E+A  H LP QDFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+
Sbjct  597  REIAERHQLPIQDFVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDV  656

Query  411  DIAYKHFKAFYQTFSSVDRKLNV  343
            + +Y+H KA+++ F+ +D K+ +
Sbjct  657  NYSYEHLKAYFEEFTELDNKVKI  679



>ref|XP_003055398.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60650.1| predicted protein [Micromonas pusilla CCMP1545]
Length=476

 Score =   178 bits (451),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE +H P++  G+V+KHNA+QRYAT+  T+ LF+E A    +PTQD
Sbjct  345  ADMAHALHPNYMDKHESNHSPKMHAGVVVKHNANQRYATTATTATLFRECAAKEGIPTQD  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRNDMGCGSTIGPIL++ +G+RTVD G+ QLSMHSVRE+CG EDID+ ++HF+AF+  
Sbjct  405  FVVRNDMGCGSTIGPILSTNLGVRTVDVGVPQLSMHSVREMCGTEDIDVCFRHFRAFFDH  464

Query  372  FSSVD  358
            F+ +D
Sbjct  465  FAEID  469



>ref|XP_005648131.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
 gb|EIE23587.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
Length=482

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKHE  H+P+  KGLV+KHN  QRYAT+ V++ LF+E+A+   +PTQ+
Sbjct  332  ADMAHALHPNYADKHEPDHKPQFHKGLVLKHNVHQRYATNAVSATLFRELAKRRGIPTQE  391

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VR+DM CGSTIGPILASG+G RTVD G  QLSMHS+RE+C  +D+   Y HF AF++ 
Sbjct  392  FCVRSDMACGSTIGPILASGLGCRTVDVGAPQLSMHSIREMCAVDDMSHTYNHFCAFFKD  451

Query  372  FSSVDRKLNVD  340
            FS++D  ++VD
Sbjct  452  FSALDASIDVD  462



>ref|XP_011396821.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
 gb|KFM23943.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
Length=469

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ D+H+  H P L  G+V+KHNA+QRYAT+ V++ LF+EV R   +PT D
Sbjct  334  ADMAHALHPNYPDRHDAAHAPRLGDGIVLKHNANQRYATTAVSATLFREVCRQAGVPTAD  393

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VR+DMGCGSTIGPILASG+G+RTVD G+ QLSMHS+RE+C   D+   Y+ F AFYQT
Sbjct  394  FAVRSDMGCGSTIGPILASGLGLRTVDVGLPQLSMHSIREMCAVADVGHGYRAFLAFYQT  453

Query  372  FSSVDRKL  349
             S++D  L
Sbjct  454  VSALDAAL  461



>emb|CEJ00699.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=300

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+++KHEE+HRPE+ KG VIK NA+QRYAT+ VTS + KE+A+ HN+P Q+
Sbjct  170  ADMAHAIHPNYSEKHEENHRPEMHKGTVIKVNANQRYATTAVTSLVLKELAKKHNIPIQE  229

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       + FYQ 
Sbjct  230  FVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIRETGGTDDVKHGIDLLRVFYQE  289

Query  372  FSSVDRKLNVD  340
            F  +++KL VD
Sbjct  290  FFVLEQKLIVD  300



>ref|XP_007514776.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15016.1| predicted protein [Bathycoccus prasinos]
Length=522

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DKHE  H+P+   G+VIKHNA+QRY+T  +TSF+FKE+     + +Q+
Sbjct  353  ADMAHAVHPNYADKHEPGHKPKFGDGVVIKHNANQRYSTDAITSFIFKEIGERRKIKSQE  412

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR+D+GCGSTIGPIL++  GIRTVD G+ QLSMHS+RE+CG ED  +  +HFKA Y+ 
Sbjct  413  FVVRSDLGCGSTIGPILSTRSGIRTVDVGMPQLSMHSIREMCGTEDTRLCVEHFKAVYED  472

Query  372  FSSVDRKLNVD  340
            F  +D K+ VD
Sbjct  473  FFEMDEKMIVD  483



>gb|ETO14766.1| hypothetical protein RFI_22603 [Reticulomyxa filosa]
Length=160

 Score =   164 bits (416),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 94/131 (72%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAH +HPN+++KHE  H P + KGLV+K+N +QRYATS  TSF   E+AR  N+P Q 
Sbjct  30   SDMAHALHPNYSEKHESLHGPLIHKGLVVKYNCNQRYATSMATSFHLTELARKLNIPLQK  89

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGPILA+  GIR VD GI QLSMHS+RE+CG +D+  A   F AFY+ 
Sbjct  90   FVVRNDSPCGSTIGPILATACGIRAVDVGIPQLSMHSIREVCGVKDVVSATNLFTAFYEN  149

Query  372  FSSVDRKLNVD  340
            F  +D    VD
Sbjct  150  FVKLDATFKVD  160



>gb|EXX59698.1| Ape4p [Rhizophagus irregularis DAOM 197198w]
Length=466

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ +KHEE+HRP++ +G+VIK NA+QRYAT+ VTS + ++VA+ + +P QD
Sbjct  336  ADMAHAVHPNYCEKHEENHRPQMNQGVVIKTNANQRYATTSVTSLILRQVAKKYKVPLQD  395

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP++++ +G+RT+D G  QLSMHS+RE  G +D+D A K  KAF++ 
Sbjct  396  FVVRNDSPCGSTIGPMISANLGLRTLDIGNPQLSMHSIRETAGTKDVDHAIKLIKAFFED  455

Query  372  FSSVDRKLNVD  340
            F+ +DR + VD
Sbjct  456  FAEIDRNITVD  466



>ref|XP_004346183.2| aspartyl aminopeptidase [Capsaspora owczarzaki ATCC 30864]
Length=478

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN++DKHEE+HRP +  G VIK NA+QRYAT+ V+  + +E+AR HN+P Q+
Sbjct  348  ADMAHAVHPNYSDKHEENHRPVIHGGPVIKSNANQRYATNSVSGTVIREIARKHNIPVQE  407

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGPI+A  +G+RT+D G  QLSMHS+RE CG +D+  A +  KAF++ 
Sbjct  408  FVVRNDSACGSTIGPIVAGNLGMRTIDIGNPQLSMHSIRETCGVDDVTYAVQLIKAFFED  467

Query  372  FSSVDRKLNVD  340
            F ++D +L+VD
Sbjct  468  FPAMDARLDVD  478



>gb|KJE94975.1| aspartyl aminopeptidase [Capsaspora owczarzaki ATCC 30864]
Length=474

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN++DKHEE+HRP +  G VIK NA+QRYAT+ V+  + +E+AR HN+P Q+
Sbjct  344  ADMAHAVHPNYSDKHEENHRPVIHGGPVIKSNANQRYATNSVSGTVIREIARKHNIPVQE  403

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGPI+A  +G+RT+D G  QLSMHS+RE CG +D+  A +  KAF++ 
Sbjct  404  FVVRNDSACGSTIGPIVAGNLGMRTIDIGNPQLSMHSIRETCGVDDVTYAVQLIKAFFED  463

Query  372  FSSVDRKLNVD  340
            F ++D +L+VD
Sbjct  464  FPAMDARLDVD  474



>ref|XP_001421486.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99779.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=512

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAH +HPN+ D+HE  H P++  GLVIKHNA+QRYAT  VT+F+F+E+     +P Q+
Sbjct  345  SDMAHALHPNYADRHEPAHAPKMHGGLVIKHNANQRYATDAVTAFMFREIGERAGVPVQE  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR+D GCGSTIGPI ++  GIRTVD G AQLSMHS+RE+CG +DID A KH  A Y  
Sbjct  405  FVVRSDTGCGSTIGPIFSTRTGIRTVDVGAAQLSMHSIREVCGADDIDHAVKHLTAVYLH  464

Query  372  FSSVDRKLNVD  340
            F  +DR L VD
Sbjct  465  FIDLDRTLIVD  475



>ref|XP_002505350.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66608.1| predicted protein [Micromonas sp. RCC299]
Length=495

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DKHE  HRP    G+VIKHNA+QRYAT  VT++LF+E+     +P Q+
Sbjct  354  ADMAHAVHPNYADKHEPGHRPRFGDGVVIKHNANQRYATDAVTAWLFRELGERAGVPVQE  413

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR+D+GCGSTIGPIL++  GIRTVD G  QLSMHSVRE+CG +D+  +  HF A Y+ 
Sbjct  414  FVVRSDLGCGSTIGPILSTRTGIRTVDVGAPQLSMHSVREMCGCDDVKHSVAHFTAVYEG  473

Query  372  FSSVDRKLNVD  340
            F+ +D  L VD
Sbjct  474  FTKLDETLMVD  484



>gb|ESA11968.1| hypothetical protein GLOINDRAFT_335422 [Rhizophagus irregularis 
DAOM 181602]
Length=496

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ +KHEE+HRP++ +G+VIK NA+QRYAT+ VTS + ++VA+ + +P QD
Sbjct  366  ADMAHAVHPNYCEKHEENHRPQMNQGVVIKTNANQRYATTSVTSLILRQVAKKYKVPLQD  425

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP++++ +G+RT+D G  QLSMHS+RE  G +D+D A K  KAF++ 
Sbjct  426  FVVRNDSPCGSTIGPMISANLGLRTLDIGNPQLSMHSIRETAGTKDVDHAIKLIKAFFED  485

Query  372  FSSVDRKLNVD  340
            F+ +DR + VD
Sbjct  486  FAEIDRNITVD  496



>emb|CEG01789.1| Peptidase M18 [Ostreococcus tauri]
Length=499

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAH +HPN+TD+HE  H P+L  GLVIKHNA+QRYAT  VT+F+F+E+     +P Q+
Sbjct  334  SDMAHALHPNYTDRHEPAHTPKLHGGLVIKHNANQRYATDAVTAFMFRELGERVGVPVQE  393

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV++DMGCGSTIGPI ++  GIRTVD G AQLSMHS+RE+CG +D++ A KHF + +  
Sbjct  394  FVVKSDMGCGSTIGPIFSTRTGIRTVDVGAAQLSMHSIREVCGTDDVEHAIKHFTSTFMN  453

Query  372  FSSVDRKLNVD  340
            F  +DR   VD
Sbjct  454  FLDLDRTFIVD  464



>emb|CCA15777.1| aspartyl aminopeptidase putative [Albugo laibachii Nc14]
Length=459

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPN++ KHEE+HRP L  G VIK+NA+QRY+TS  ++FL KE+AR H +  Q+
Sbjct  331  ADMAHGVHPNYSQKHEENHRPALHAGPVIKYNANQRYSTSSESAFLMKELARRHKIKFQE  390

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR D  CGSTIGPI+A+  G+ T+D G+AQLSMHS+RE+CG +D+++    FKAF+  
Sbjct  391  FVVRQDTACGSTIGPIMATNTGMSTIDVGLAQLSMHSIREMCGTDDLELGLTWFKAFFSE  450

Query  372  FSSVDRKLN  346
            F+++  +L+
Sbjct  451  FTALKSRLS  459



>emb|CEG81490.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=468

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+++KHEE+HRPE+ KG VIK NA+QRYAT+ VTS + KE+A+ HN+P Q+
Sbjct  338  ADMAHAIHPNYSEKHEENHRPEMHKGTVIKVNANQRYATTAVTSLVLKELAKKHNIPIQE  397

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       + FYQ 
Sbjct  398  FVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIRETGGTDDVKHGIDLLRVFYQE  457

Query  372  FSSVDRKLNVD  340
            F  +++KL VD
Sbjct  458  FFVLEQKLIVD  468



>emb|CCI46763.1| unnamed protein product [Albugo candida]
Length=663

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPN++ KHE +HRP L  G VIK+NA+QRYAT+  ++FL KE+AR H +  Q+
Sbjct  535  ADMAHGVHPNYSQKHEHNHRPALHAGPVIKYNANQRYATTSESAFLMKELARRHGVKLQE  594

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR D GCGSTIGPI+++  G+RT+D G+AQLSMHS+RE+CG +D+++    FKAF+  
Sbjct  595  FVVRQDTGCGSTIGPIMSTNTGMRTIDVGLAQLSMHSIREMCGTDDLELGLTWFKAFFSE  654

Query  372  FSSVDRKLN  346
            F++++  L+
Sbjct  655  FTNLNSYLS  663



>ref|XP_003083329.1| aspartyl aminopeptidase (ISS), partial [Ostreococcus tauri]
Length=1045

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAH +HPN+TD+HE  H P+L  GLVIKHNA+QRYAT  VT+F+F+E+     +P Q+
Sbjct  334  SDMAHALHPNYTDRHEPAHTPKLHGGLVIKHNANQRYATDAVTAFMFRELGERVGVPVQE  393

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV++DMGCGSTIGPI ++  GIRTVD G AQLSMHS+RE+CG +D++ A KHF + +  
Sbjct  394  FVVKSDMGCGSTIGPIFSTRTGIRTVDVGAAQLSMHSIREVCGTDDVEHAIKHFTSTFMN  453

Query  372  FSSVDRKLNVD  340
            F  +DR   VD
Sbjct  454  FLDLDRTFIVD  464



>ref|XP_002678138.1| predicted protein [Naegleria gruberi]
 gb|EFC45394.1| predicted protein [Naegleria gruberi]
Length=476

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 96/130 (74%), Gaps = 0/130 (0%)
 Frame = -2

Query  729  DMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDF  550
            DMAH VHPN+++KH+  HRP++ +GLVIK NA+QRYAT+G TSFLF E+A+ HN+P Q F
Sbjct  346  DMAHAVHPNYSEKHQAKHRPQIHQGLVIKTNANQRYATNGHTSFLFGELAKRHNIPIQQF  405

Query  549  VVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTF  370
            VVRND  CGSTIGPI +S   IRT+D GI QLSMHS+RE CG  DI      F  ++  F
Sbjct  406  VVRNDSACGSTIGPITSSNTSIRTIDVGIPQLSMHSIREQCGCVDIKSTIDLFTEYFNEF  465

Query  369  SSVDRKLNVD  340
            S +D  L++D
Sbjct  466  SEIDSTLHID  475



>ref|XP_008863481.1| hypothetical protein H310_01914 [Aphanomyces invadans]
 gb|ETW07388.1| hypothetical protein H310_01914 [Aphanomyces invadans]
Length=463

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN++ +HE++ + ++ +G  IK+NA+QRYAT+  TSFL KE+ R HNL  Q 
Sbjct  333  ADMAHAVHPNYSARHEQNSKLQMGQGAAIKYNANQRYATTAETSFLLKEIGRRHNLNVQS  392

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV R D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG  DI+ + + FKAF+  
Sbjct  393  FVTRQDCGCGSTIGPILSTHTGIRTIDVGVAQLSMHSIREMCGVTDIETSVELFKAFFND  452

Query  372  FSSVDRKLNVD  340
            FS+VD  +  D
Sbjct  453  FSTVDGFVKTD  463



>ref|XP_011457668.1| PREDICTED: probable aspartyl aminopeptidase [Fragaria vesca subsp. 
vesca]
Length=147

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 81/96 (84%), Gaps = 13/96 (14%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPNF DKHEE+HRPE+QKGLVIKHNA+QRYATSGVTSFL             +
Sbjct  56   ADMAHGVHPNFMDKHEEYHRPEMQKGLVIKHNANQRYATSGVTSFL-------------E  102

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  445
            FVVRNDMGCGSTIGPILASG GIRTVDCGIAQLSMH
Sbjct  103  FVVRNDMGCGSTIGPILASGAGIRTVDCGIAQLSMH  138



>gb|EPB92944.1| aspartyl aminopeptidase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=475

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH ++PN+ DKHEE+HRPE+ KG VIK NA+QRYAT+ +TS + KE+A+ H +P Q+
Sbjct  345  ADMAHAINPNYADKHEENHRPEMHKGTVIKVNANQRYATTAITSLVLKELAKKHQIPIQE  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       +AFY+ 
Sbjct  405  FVVRNDSSCGSTIGPMLSAKLGLRTVDIGNPQLSMHSIRETGGTDDVKHGIDLLRAFYEE  464

Query  372  FSSVDRKLNVD  340
            F+ +++K  VD
Sbjct  465  FAVLEQKFIVD  475



>ref|XP_008620058.1| aspartyl aminopeptidase [Saprolegnia diclina VS20]
 gb|EQC26479.1| aspartyl aminopeptidase [Saprolegnia diclina VS20]
Length=470

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPN+++KHE + R ++  G VIK+NA++RYATSG T+ L KE+ R H L  QD
Sbjct  336  ADMAHGVHPNYSEKHEVNSRIQMHSGPVIKYNANERYATSGETALLIKELGRRHGLDIQD  395

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV R D GCGSTIGPILA+  GIRTVD G+AQ SMHS+RE CG  D+++A + F AFY  
Sbjct  396  FVSRQDCGCGSTIGPILATSTGIRTVDMGLAQFSMHSIREQCGTVDLELAIELFSAFYND  455

Query  372  FSSVDRKLNVD  340
            F  +D  +  D
Sbjct  456  FVEIDGSIATD  466



>dbj|GAN09714.1| aspartyl aminopeptidase [Mucor ambiguus]
Length=470

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH ++PN+ DKHEE+HRPE+ KG VIK NA+QRYAT+ +TS + KE+A+ H +P Q+
Sbjct  340  ADMAHAINPNYADKHEENHRPEMHKGTVIKINANQRYATTAITSLVLKELAKKHQIPIQE  399

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       +AFY+ 
Sbjct  400  FVVRNDSSCGSTIGPMLSAKLGLRTVDIGNPQLSMHSIRETGGTDDVKHGIDLLRAFYEE  459

Query  372  FSSVDRKLNVD  340
            F+ +++K  VD
Sbjct  460  FAVLEQKFIVD  470



>gb|KDO32253.1| hypothetical protein SPRG_02733 [Saprolegnia parasitica CBS 223.65]
Length=470

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPN+++KHE + R ++  G VIK+NA++RYATSG T+ L KE+ R H L  QD
Sbjct  336  ADMAHGVHPNYSEKHEVNSRIQMHSGPVIKYNANERYATSGETALLIKELGRRHGLDIQD  395

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV R D GCGSTIGPILA+  GIRTVD G+AQ SMHS+RE CG  D+++A + F AFY  
Sbjct  396  FVSRQDCGCGSTIGPILATSTGIRTVDMGLAQFSMHSIREQCGTVDLELAIELFSAFYND  455

Query  372  FSSVDRKLNVD  340
            F  +D  +  D
Sbjct  456  FVEIDGSIATD  466



>gb|EPB84012.1| aspartyl aminopeptidase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=524

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+T+K+EE+HRP++ KG VIK NA+QRYAT+  TS + KE+AR   +P Q+
Sbjct  394  ADMAHAVHPNYTEKYEENHRPQMHKGTVIKINANQRYATTAPTSLILKEIARQKEIPIQE  453

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RT+D G  QLSMHS+REI G +D+       KAF+Q 
Sbjct  454  FVVRNDSSCGSTIGPMLSAKLGLRTIDVGNPQLSMHSIREIGGVDDVKNGTDLLKAFFQL  513

Query  372  FSSVDRKLNVD  340
            F  VD ++ VD
Sbjct  514  FPYVDSRVTVD  524



>ref|XP_002960428.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
 gb|EFJ37967.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
Length=516

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN  +   EH++P+L  GLVIKHN +Q  AT  +++FLFKEVA+ + +PTQ+
Sbjct  385  ADMAHALHPNNAENDVEHNQPKLHDGLVIKHNVTQNNATDAISAFLFKEVAKRNCIPTQN  444

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            + V +D+GC STI  +LA+G GIR VDCG+ QL+MHSVRE+CG EDID A++HF+AF+Q 
Sbjct  445  YSVVSDVGCCSTIDSVLAAGYGIRLVDCGLPQLAMHSVREMCGTEDIDAAFRHFRAFFQE  504

Query  372  FSSVDRKLNVD  340
             +S+D +L VD
Sbjct  505  IASLDDQLRVD  515



>ref|XP_002967289.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
 gb|EFJ31888.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
Length=519

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN  +   EH++P+L  GLVIKHN +Q  AT  +++FLFKEVA+ + +PTQ+
Sbjct  388  ADMAHALHPNNAENDVEHNQPKLHDGLVIKHNLTQNNATDAISAFLFKEVAKRNCIPTQN  447

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            + V +D+GC STI  +LA+G GIR VDCG+ QL+MHSVRE+CG EDID A++HF+AF+Q 
Sbjct  448  YSVVSDVGCCSTIDSVLAAGYGIRLVDCGLPQLAMHSVREMCGTEDIDAAFRHFRAFFQE  507

Query  372  FSSVDRKLNVD  340
             +S+D +L VD
Sbjct  508  IASLDDQLRVD  518



>emb|CDS03243.1| hypothetical protein LRAMOSA00645 [Absidia idahoensis var. thermophila]
Length=468

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+++KHE +HRP + KG VIK NA+QRYAT+ VTS + KE+A+ HN+P Q+
Sbjct  338  ADMAHAIHPNYSEKHESNHRPHMHKGTVIKINANQRYATTAVTSLVLKELAKKHNIPIQE  397

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE+ G +D+       K FY+ 
Sbjct  398  FVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREVGGTDDVKHGIDLLKVFYEE  457

Query  372  FSSVDRKLNVD  340
            F+ ++ ++ VD
Sbjct  458  FAELEARIVVD  468



>ref|XP_009825683.1| hypothetical protein H257_03355 [Aphanomyces astaci]
 gb|ETV83991.1| hypothetical protein H257_03355 [Aphanomyces astaci]
Length=459

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+  +HE++ + ++ +G  IK+NA+QRYAT+G TSFL KE+ R HNL  Q 
Sbjct  329  ADMAHAVHPNYAARHEQNSKLQMGQGPAIKYNANQRYATTGETSFLLKEIGRRHNLDVQS  388

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV R D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG  D++ +   FKAFY  
Sbjct  389  FVSRQDCGCGSTIGPILSTHTGIRTIDVGVAQLSMHSIREMCGVSDVEKSVALFKAFYND  448

Query  372  FSSVDRKLNVD  340
            F++VD  +  D
Sbjct  449  FTTVDGFVKTD  459



>dbj|GAN06933.1| aspartyl aminopeptidase [Mucor ambiguus]
Length=528

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+T+K+EE+HRP++ +G VIK NA+QRYAT+  TS + KE+AR   +P Q+
Sbjct  398  ADMAHAVHPNYTEKYEENHRPQMHQGTVIKINANQRYATTAPTSLILKEIARQKEIPIQE  457

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RT+D G  QLSMHS+REI G +D+       KAF+Q 
Sbjct  458  FVVRNDSSCGSTIGPMLSAKLGLRTIDVGNPQLSMHSIREIGGVDDVKNGTDLLKAFFQL  517

Query  372  FSSVDRKLNVD  340
            F  VD ++ VD
Sbjct  518  FPYVDSRVTVD  528



>gb|EIE78284.1| hypothetical protein RO3G_02988 [Rhizopus delemar RA 99-880]
Length=469

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHEE+HRP++ KG VIK NA+QRYAT+ VTS + KE+A+ H +P Q+
Sbjct  339  ADMAHAIHPNYAEKHEENHRPQMHKGTVIKVNANQRYATTAVTSLVLKELAKKHKIPIQE  398

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       + FY+ 
Sbjct  399  FVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIRETGGTDDVKHGIDLLRVFYEE  458

Query  372  FSSVDRKLNVD  340
            F+ +++K  VD
Sbjct  459  FAELEQKFIVD  469



>ref|XP_002129082.1| PREDICTED: aspartyl aminopeptidase-like [Ciona intestinalis]
Length=449

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPN+ +KHE H RP L  G VIK N +QRYAT+ +T+ + +E A+I  +PTQD
Sbjct  319  ADMAHGVHPNYPEKHESHMRPTLHGGPVIKTNNNQRYATTAITATIVRESAKIAGVPTQD  378

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
             +VRND GCGSTIGPILA+ +GIRTVD G AQLSMHS RE+CG    +   K + AF+Q 
Sbjct  379  VMVRNDAGCGSTIGPILATRLGIRTVDVGAAQLSMHSCREVCGVLAPEQCLKLYVAFFQN  438

Query  372  FSSVDRKLNVD  340
            F  +D  ++V+
Sbjct  439  FPKIDENISVE  449



>emb|CDH60153.1| aspartyl aminopeptidase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=542

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ +KHE +HRP + KG VIK NA+QRYAT+ VTS + KE+A+ H++P Q+
Sbjct  412  ADMAHAIHPNYPEKHESNHRPHMHKGTVIKINANQRYATTAVTSLVLKELAKKHSIPIQE  471

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE+ G +D+       K FY+ 
Sbjct  472  FVVRNDSSCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREVGGTDDVKHGIDLLKVFYEE  531

Query  372  FSSVDRKLNVD  340
            F+ ++ ++ VD
Sbjct  532  FAELEARIVVD  542



>gb|EIE88868.1| hypothetical protein RO3G_13579 [Rhizopus delemar RA 99-880]
Length=476

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DK+EE+HRP++ KG VIK NA+QRYAT+  TS + +E+AR  N+P Q+
Sbjct  346  ADMAHAVHPNYADKYEENHRPQMHKGTVIKINANQRYATTAPTSLILREIARQKNIPIQE  405

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       K+F++ 
Sbjct  406  FVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIRETGGVDDVKHGIDLLKSFFEL  465

Query  372  FSSVDRKLNVD  340
            F  +D K+ VD
Sbjct  466  FPHIDAKVIVD  476



>emb|CEP14293.1| hypothetical protein [Parasitella parasitica]
Length=475

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH ++PN+ DKHEE+HRPE+ KG VIK NA+QRYAT+ VTS + KE+A+ H +P Q+
Sbjct  340  ADMAHAINPNYPDKHEENHRPEMHKGTVIKVNANQRYATTAVTSLVLKELAKKHQIPIQE  399

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFK-----  388
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G ED+       +     
Sbjct  400  FVVRNDSSCGSTIGPMLSAKLGLRTVDIGNPQLSMHSIRETGGTEDVKHGIDLLRVGLIY  459

Query  387  AFYQTFSSVDRKLNVD  340
            AFY+ F+ +++K  VD
Sbjct  460  AFYEEFAVLEQKFIVD  475



>ref|XP_009025082.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
 gb|ESN96961.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
Length=468

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPNF++KHEEHHRP L KG+V+K NA+Q+YA++ +TS + +E+A   ++P QD
Sbjct  338  ADMAHAVHPNFSEKHEEHHRPFLNKGVVLKFNANQKYASTAITSSIMREIAHEASIPIQD  397

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FV+RNDM CGSTIGPIL++ +GI T+D G  QLSMHS+RE+C    + +A   FKA+++ 
Sbjct  398  FVMRNDMACGSTIGPILSTRLGIPTLDLGSPQLSMHSIREMCSTSSVHLAISLFKAYFEN  457

Query  372  FSSV  361
            +S +
Sbjct  458  YSKM  461



>emb|CEJ04001.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ +K+EE+HRP++ KG VIK NA+Q+YAT+  TS + +EVAR  ++P Q+
Sbjct  366  ADMAHAVHPNYAEKYEENHRPQMHKGTVIKINANQKYATTAATSLILREVARQRSIPIQE  425

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++ 
Sbjct  426  FVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGINLLKSFFEL  485

Query  372  FSSVDRKLNVD  340
            F  +D K+ +D
Sbjct  486  FPDIDAKVFID  496



>emb|CEI95696.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ +K+EE+HRP++ KG VIK NA+Q+YAT+  TS + +E+AR  ++P Q+
Sbjct  366  ADMAHAVHPNYAEKYEENHRPQMHKGTVIKINANQKYATTAATSLILREIARQRSIPIQE  425

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++ 
Sbjct  426  FVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGINLLKSFFEL  485

Query  372  FSSVDRKLNVD  340
            F  +D K+ +D
Sbjct  486  FPDIDAKVFID  496



>emb|CEG69346.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ +K+EE+HRP++ KG VIK NA+Q+YAT+  TS + +E+AR  ++P Q+
Sbjct  366  ADMAHAVHPNYAEKYEENHRPQMHKGTVIKINANQKYATTAATSLILREIARQRSIPIQE  425

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++ 
Sbjct  426  FVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGINLLKSFFEL  485

Query  372  FSSVDRKLNVD  340
            F  +D K+ +D
Sbjct  486  FPDIDAKVFID  496



>emb|CEG81693.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ +K+EE+HRP++ KG VIK NA+Q+YAT+  TS + +E+AR  ++P Q+
Sbjct  366  ADMAHAVHPNYAEKYEENHRPQMHKGTVIKINANQKYATTAATSLILREIARQRSIPIQE  425

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++ 
Sbjct  426  FVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGIDLLKSFFEL  485

Query  372  FSSVDRKLNVD  340
            F  +D K+ +D
Sbjct  486  FPDIDAKVFID  496



>ref|XP_007879166.1| hypothetical protein PFL1_03458 [Pseudozyma flocculosa PF-1]
 gb|EPQ29171.1| hypothetical protein PFL1_03458 [Pseudozyma flocculosa PF-1]
Length=516

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 97/131 (74%), Gaps = 1/131 (1%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAHG HPN+   +EE+HRP+L  G VIK N  QRYAT+G T+FL + +A++ ++P Q 
Sbjct  387  SDMAHGFHPNYPSYYEENHRPKLNGGPVIKTNVKQRYATTGPTAFLIRRIAKLADVPLQS  446

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV+N+M CGSTIGP+L S +GIRTVD G  QLSMHS+RE CG  D+++  + F+ F+++
Sbjct  447  FVVKNNMPCGSTIGPML-SKLGIRTVDLGNPQLSMHSIRETCGSRDVELKIRLFQHFFES  505

Query  372  FSSVDRKLNVD  340
            F  VD +L  D
Sbjct  506  FEKVDAQLTTD  516



>ref|XP_005849269.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
 gb|EFN57167.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
Length=497

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN+ DKH+    P L  GLV+KHN +QRYAT+ +++ LF+EV R   +PT +
Sbjct  345  ADMAHALHPNYADKHDPDLAPRLGSGLVLKHNVNQRYATTSISATLFREVCRRAGVPTAE  404

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREI--CGKEDIDIAYKHFKAFY  379
            F VR+DM CGSTIGPILASG+G+RTVD G+ QL+MHS+RE+  C   D     + F AF+
Sbjct  405  FAVRSDMACGSTIGPILASGLGVRTVDIGVPQLAMHSIRELQMCTVSDAAHGLRAFTAFF  464

Query  378  QTFSSVDRKLNVD  340
            QT S +DR ++ D
Sbjct  465  QTISELDRTVDPD  477



>emb|CBQ68247.1| probable aspartyl aminopeptidase [Sporisorium reilianum SRZ2]
Length=502

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 98/131 (75%), Gaps = 1/131 (1%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAHG HPN+   +EE+HRP++ +G VIK N  QRYAT+G T+FL + +A+  ++P Q 
Sbjct  373  SDMAHGFHPNYPSYYEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAHVPLQS  432

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D+D   + FK F+ +
Sbjct  433  FVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVDYKIELFKHFFDS  491

Query  372  FSSVDRKLNVD  340
            F +VD +L +D
Sbjct  492  FETVDAQLVID  502



>ref|XP_004994670.1| aspartyl aminopeptidase [Salpingoeca rosetta]
 gb|EGD72847.1| aspartyl aminopeptidase [Salpingoeca rosetta]
Length=469

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAH +HPN+ +KHE +H+P +  G VIK N +QRYAT+ VT+ + + VA I ++P QD
Sbjct  339  SDMAHAIHPNYPEKHEANHQPMMNAGPVIKFNTNQRYATNAVTALILRRVAEIADVPLQD  398

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
             +VRND  CGSTIGPIL++G+GIRT+D G AQL+MHS+RE+ G  DI  A   FK FY  
Sbjct  399  VMVRNDSACGSTIGPILSAGLGIRTIDIGNAQLAMHSIREMGGSHDIAYAVTLFKTFYCK  458

Query  372  FSSVDRKLNVD  340
            F+ VD  + V+
Sbjct  459  FAEVDASVTVE  469



>ref|XP_001745410.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89988.1| predicted protein [Monosiga brevicollis MX1]
Length=467

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VH N  +KHE  HRP++ +G+VIK NA+QRYAT+ VT+ + + +A+   +P QD
Sbjct  331  ADMAHAVHMNRGEKHEGLHRPKMNQGVVIKFNANQRYATNAVTASILRLLAKKAGVPLQD  390

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVR DMGCGSTIGPILASG+GIRT+D G  QL+MHS+RE+ G +D+  A   FK F++ 
Sbjct  391  FVVRQDMGCGSTIGPILASGLGIRTIDVGNPQLAMHSIREMGGVKDVAYAIDLFKTFFKR  450

Query  372  FSSVDRKLNVDC  337
            F  +D  ++VD 
Sbjct  451  FPQLDGSVHVDA  462



>emb|CCF51316.1| probable aspartyl aminopeptidase [Ustilago hordei]
Length=504

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAHG HPN+   +EE+HRP++ +G VIK N  QRYAT+G T+FL + +A+   +P Q 
Sbjct  375  SDMAHGFHPNYPSYYEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQS  434

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ +
Sbjct  435  FVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFDS  493

Query  372  FSSVDRKLNVD  340
            F  VD +L +D
Sbjct  494  FEQVDAQLTID  504



>emb|CDI51753.1| probable aspartyl aminopeptidase [Melanopsichium pennsylvanicum 
4]
Length=506

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAHG HPN+   +EE+HRP+L +G VIK N  QRYAT+G T+FL + +A+   +P Q 
Sbjct  377  SDMAHGFHPNYPSFYEENHRPKLNQGPVIKTNVKQRYATTGPTAFLVRRIAQRAQVPLQS  436

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ +
Sbjct  437  FVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFDS  495

Query  372  FSSVDRKLNVD  340
            F  VD +L +D
Sbjct  496  FEQVDAQLIID  506



>ref|XP_004361073.1| aspartyl aminopeptidase [Dictyostelium fasciculatum]
 gb|EGG23222.1| aspartyl aminopeptidase [Dictyostelium fasciculatum]
Length=572

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH +HPN++  HE  HRP+L KG VIK+NA+ RYAT+G TSF   E+A+ + +P Q+
Sbjct  440  ADMAHAIHPNYSGHHEPLHRPQLNKGPVIKYNANLRYATTGPTSFTILELAKRNGIPVQE  499

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F+V+ND  CGSTIGPI++   GIRTVD G  QLSMHS+RE CG  DI   ++  + F++ 
Sbjct  500  FLVKNDSPCGSTIGPIISGSYGIRTVDIGNPQLSMHSIRETCGVVDITYGFQLIQKFFEQ  559

Query  372  FSSVDRKLNVD  340
            FS +D+ + VD
Sbjct  560  FSILDKSIKVD  570



>gb|ELU07857.1| hypothetical protein CAPTEDRAFT_158105 [Capitella teleta]
Length=468

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 97/128 (76%), Gaps = 4/128 (3%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAHGVHPN++ KHE+ HRP L KG+VIK NA+QRYAT+ +T+ + +EVA    +P QD
Sbjct  339  ADMAHGVHPNYSSKHEDQHRPALHKGVVIKFNANQRYATTSITTAILREVAARATVPIQD  398

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG----KEDIDIAYKHFKA  385
            FVVRND  CGSTIGPI+++G+G+ T+D G AQLSMHS+RE+C     K+ +D+    F+ 
Sbjct  399  FVVRNDSPCGSTIGPIMSAGLGMPTIDIGCAQLSMHSIREMCDISSVKQSVDLFTTFFEI  458

Query  384  FYQTFSSV  361
            + + F+S+
Sbjct  459  YPEVFASM  466



>ref|XP_005415861.1| PREDICTED: aspartyl aminopeptidase [Geospiza fortis]
Length=134

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DKHEE+HRP   KG VIK N++QRYA++ VT  + +++A    +P Q+
Sbjct  4    ADMAHAVHPNYVDKHEENHRPAFHKGPVIKVNSNQRYASTAVTEAVIRDIAARVGVPLQE  63

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F+VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+C    +  +   FK F++ 
Sbjct  64   FMVRNDTPCGTTIGPILASRLGLRVLDIGCPQLAMHSIREMCCTSGVLQSITLFKGFFEL  123

Query  372  FSSVDRKLNVD  340
              +V   L VD
Sbjct  124  LPTVSSSLVVD  134



>dbj|GAC99602.1| aspartyl aminopeptidase [Pseudozyma hubeiensis SY62]
Length=502

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAHG HPN+   +EE+HRP++ +G VIK N  QRYAT+G T+FL + +A+   +P Q 
Sbjct  373  SDMAHGFHPNYPSFYEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQS  432

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ +
Sbjct  433  FVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFDS  491

Query  372  FSSVDRKLNVD  340
            F  VD +L +D
Sbjct  492  FEQVDAQLVID  502



>ref|NP_001279935.1| aspartyl aminopeptidase [Callorhinchus milii]
 gb|AFM91016.1| aspartyl aminopeptidase [Callorhinchus milii]
Length=471

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAH VHPN++DKHEE+HRP + KG VIK N++Q+YA++ VT  + +E+AR  N+P Q+
Sbjct  341  SDMAHAVHPNYSDKHEENHRPLMNKGPVIKFNSNQKYASNAVTVSVMREIARRVNIPLQE  400

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
             +VRND  CGSTIGPILA+G+G+R VD G AQL+MHS+RE+C    +  +   +K FY  
Sbjct  401  VMVRNDSTCGSTIGPILAAGLGLRVVDMGCAQLAMHSIREMCCTSSVLQSVTLYKGFYDH  460

Query  372  FSSVDRKLNVD  340
            + +++  L VD
Sbjct  461  YPTINSSLVVD  471



>ref|XP_011386806.1| putative aspartyl aminopeptidase [Ustilago maydis 521]
 gb|KIS72420.1| putative aspartyl aminopeptidase [Ustilago maydis 521]
Length=505

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 96/131 (73%), Gaps = 1/131 (1%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAHG HPN+   +EE+HRP++ +G VIK N  QRYAT+G T+FL + +A+   +P Q 
Sbjct  376  SDMAHGFHPNYPSFYEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQS  435

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ +
Sbjct  436  FVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFDS  494

Query  372  FSSVDRKLNVD  340
            F  +D +L +D
Sbjct  495  FEQIDAQLVID  505



>gb|AFK11572.1| aspartyl aminopeptidase [Callorhinchus milii]
Length=471

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAH VHPN++DKHEE+HRP + KG VIK N++Q+YA++ VT  + +E+AR  N+P Q+
Sbjct  341  SDMAHAVHPNYSDKHEENHRPLMNKGPVIKFNSNQKYASNAVTVSVMREIARRVNIPLQE  400

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
             +VRND  CGSTIGPILA+G+G+R VD G AQL+MHS+RE+C    +  +   +K FY  
Sbjct  401  VMVRNDSTCGSTIGPILAAGLGLRVVDMGCAQLAMHSIREMCCTSSVLQSVTLYKGFYDH  460

Query  372  FSSVDRKLNVD  340
            + +++  L VD
Sbjct  461  YPTINSSLVVD  471



>gb|KDN49618.1| putative aspartyl aminopeptidase [Tilletiaria anomala UBC 951]
Length=497

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAH  HPN+   +E  HRP+L  G VIK NA QRYA++  T+FL + +A+I N+P Q+
Sbjct  368  SDMAHAFHPNYPSSYENDHRPKLNGGPVIKTNAKQRYASTAPTTFLLRRLAKIANVPLQE  427

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRNDM CGSTIGP++ S  GIRTVD G  QL+MHS+RE CG  D +   + F+AF++ 
Sbjct  428  FEVRNDMPCGSTIGPMM-SKTGIRTVDIGNPQLAMHSIRETCGSADPEYKIRLFEAFFEH  486

Query  372  FSSVDRKLNVD  340
            F +VD++L VD
Sbjct  487  FETVDKELKVD  497



>ref|XP_002289000.1| probable aspartyl aminopeptidase [Thalassiosira pseudonana CCMP1335]
 gb|EED94436.1| probable aspartyl aminopeptidase, partial [Thalassiosira pseudonana 
CCMP1335]
Length=464

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 93/129 (72%), Gaps = 2/129 (2%)
 Frame = -2

Query  729  DMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARI--HNLPTQ  556
            DMAH VHPN+ +KHE +H P +  G+VIK N +QRYAT+GVT F+ +EVAR    N+P Q
Sbjct  334  DMAHAVHPNYANKHERNHGPRMNAGVVIKTNQNQRYATNGVTGFIAREVARKTEKNIPLQ  393

Query  555  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  376
            +FVVR+D  CG+TIGPIL++  GIRTVD G+ QLSMHS RE+ G  D+   Y  FK+F+ 
Sbjct  394  EFVVRSDCPCGTTIGPILSANTGIRTVDLGMPQLSMHSCREVMGIADLTNGYNLFKSFFD  453

Query  375  TFSSVDRKL  349
             F+ +D  L
Sbjct  454  NFNEIDECL  462



>ref|XP_007883309.1| PREDICTED: aspartyl aminopeptidase [Callorhinchus milii]
Length=574

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAH VHPN++DKHEE+HRP + KG VIK N++Q+YA++ VT  + +E+AR  N+P Q+
Sbjct  444  SDMAHAVHPNYSDKHEENHRPLMNKGPVIKFNSNQKYASNAVTVSVMREIARRVNIPLQE  503

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
             +VRND  CGSTIGPILA+G+G+R VD G AQL+MHS+RE+C    +  +   +K FY  
Sbjct  504  VMVRNDSTCGSTIGPILAAGLGLRVVDMGCAQLAMHSIREMCCTSSVLQSVTLYKGFYDH  563

Query  372  FSSVDRKLNVD  340
            + +++  L VD
Sbjct  564  YPTINSSLVVD  574



>gb|EWC43491.1| aspartyl aminopeptidase [Drechslerella stenobrocha 248]
Length=501

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 96/130 (74%), Gaps = 0/130 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+  K+E HHRPE+ KG VIK NA+ RYAT+     L +E AR+  +P Q 
Sbjct  372  ADMAHSVHPNYPAKYESHHRPEMNKGTVIKINANARYATNSPGIVLVQECARVAGVPLQL  431

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            FVVRND  CGSTIGP+L++ +G+RT+D G AQLSMHS+RE  G +D++ A K FKAF+Q 
Sbjct  432  FVVRNDSSCGSTIGPMLSAQMGMRTLDLGNAQLSMHSIRETGGAQDVEHAIKLFKAFFQR  491

Query  372  FSSVDRKLNV  343
            +++++  + V
Sbjct  492  YTALEPTIFV  501



>ref|XP_001837079.1| aspartyl aminopeptidase [Coprinopsis cinerea okayama7#130]
 gb|EAU84696.1| aspartyl aminopeptidase [Coprinopsis cinerea okayama7#130]
Length=475

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADM H +HPN+T KHEE HRP +  G+VIK NA QRYAT  V+SF+ K++A       Q+
Sbjct  346  ADMGHAIHPNYTSKHEEKHRPYMNGGIVIKTNAKQRYATDAVSSFIVKQLAERRGGKVQE  405

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F VRNDM CGST+GP+L S +G+RTVD G   LSMHS+RE  G  D+  A   F AF++ 
Sbjct  406  FEVRNDMPCGSTVGPML-SKLGVRTVDVGNPMLSMHSIRETAGSHDVQSAIDLFHAFFEG  464

Query  372  FSSVDRKLNVD  340
            FS +D+ LNVD
Sbjct  465  FSKLDQGLNVD  475



>gb|ABQ22407.1| aspartyl aminopeptidase-like protein [Callithrix jacchus]
Length=206

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DKHEE+HRP   KG VIK N+ QRYA++ V+  L +EVA   N+P QD
Sbjct  76   ADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVNVPLQD  135

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
             +VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+     +      FK F++ 
Sbjct  136  LMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFEL  195

Query  372  FSSVDRKLNVD  340
            F S+   L VD
Sbjct  196  FPSLSHNLLVD  206



>gb|KFQ24176.1| Aspartyl aminopeptidase, partial [Merops nubicus]
Length=227

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DKHEE+HRP   KG VIK N++QRYA++ VT  + +++A    +P Q+
Sbjct  97   ADMAHAVHPNYVDKHEENHRPAFHKGPVIKVNSNQRYASTAVTEAVIRDIATRVGVPLQE  156

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F+VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+C    +  +   FK F++ 
Sbjct  157  FMVRNDTPCGTTIGPILASRLGLRVLDIGCPQLAMHSIREMCCTSGVLQSITLFKGFFEL  216

Query  372  FSSVDRKLNVD  340
              +V   L VD
Sbjct  217  LPAVSSSLVVD  227



>ref|XP_008947935.1| PREDICTED: aspartyl aminopeptidase, partial [Merops nubicus]
Length=239

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DKHEE+HRP   KG VIK N++QRYA++ VT  + +++A    +P Q+
Sbjct  109  ADMAHAVHPNYVDKHEENHRPAFHKGPVIKVNSNQRYASTAVTEAVIRDIATRVGVPLQE  168

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F+VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+C    +  +   FK F++ 
Sbjct  169  FMVRNDTPCGTTIGPILASRLGLRVLDIGCPQLAMHSIREMCCTSGVLQSITLFKGFFEL  228

Query  372  FSSVDRKLNVD  340
              +V   L VD
Sbjct  229  LPAVSSSLVVD  239



>ref|XP_006683342.1| hypothetical protein BATDEDRAFT_18145 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76038.1| hypothetical protein BATDEDRAFT_18145 [Batrachochytrium dendrobatidis 
JAM81]
Length=472

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 98/134 (73%), Gaps = 6/134 (4%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHN-----  568
            ADMAH +HPN+ +KHE++HRP +  G+VIK NA+QRYAT+ +++ + +EVA++       
Sbjct  336  ADMAHALHPNYFEKHEDNHRPLINSGVVIKQNANQRYATTAISTLVLREVAKLAGKEGSG  395

Query  567  -LPTQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHF  391
             +  Q+FVVRND  CGSTIGP+L++ +G+RTVD G  Q SMHS+RE CG ED+  A   F
Sbjct  396  GVALQEFVVRNDSPCGSTIGPMLSASLGVRTVDVGNPQWSMHSIRETCGVEDVQHAVNLF  455

Query  390  KAFYQTFSSVDRKL  349
            K+F+  F++VD ++
Sbjct  456  KSFFDHFAAVDARI  469



>ref|XP_009033025.1| hypothetical protein AURANDRAFT_20254 [Aureococcus anophagefferens]
 gb|EGB11910.1| hypothetical protein AURANDRAFT_20254 [Aureococcus anophagefferens]
Length=494

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            +DMAHGVHPN+ ++H+  H P+LQ GLVIKHNA+QRYAT+ V + + +E A   ++PTQD
Sbjct  344  SDMAHGVHPNYAERHDPKHGPKLQGGLVIKHNANQRYATNAVGAVMVREFAARADVPTQD  403

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F V+ D GCG+TIGPI A+  G+RTVD G  QLSMHS RE+ G +D+    K  KA Y+ 
Sbjct  404  FAVKADSGCGTTIGPITAALTGMRTVDVGPPQLSMHSCREMMGSDDVFYTIKLCKAAYEH  463

Query  372  FSSVDRKLNVD  340
            F+ V + ++VD
Sbjct  464  FADVTKAVDVD  474



>ref|XP_010181866.1| PREDICTED: aspartyl aminopeptidase [Mesitornis unicolor]
Length=365

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -2

Query  732  ADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQD  553
            ADMAH VHPN+ DKHEE+HRP   KG VIK N++QRYA++ VT  + +++A    +P Q+
Sbjct  235  ADMAHAVHPNYVDKHEENHRPAFHKGPVIKVNSNQRYASTAVTEAVIRDIAARVGVPLQE  294

Query  552  FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQT  373
            F+VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+C    +  +   FKAF++ 
Sbjct  295  FMVRNDTPCGTTIGPILASRLGLRVLDIGCPQLAMHSIREMCCTSGVLQSITLFKAFFEL  354

Query  372  FSSVDRKLNVD  340
              +V   L VD
Sbjct  355  LPTVSSSLVVD  365



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485