BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022H18

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002526232.1|  calmodulin binding protein, putative               189   6e-53   
gb|KDP22927.1|  hypothetical protein JCGZ_01764                         189   4e-52   Jatropha curcas
emb|CDP02958.1|  unnamed protein product                                182   3e-49   Coffea canephora [robusta coffee]
ref|XP_011079310.1|  PREDICTED: uncharacterized protein LOC105162855    179   2e-48   Sesamum indicum [beniseed]
ref|XP_011018189.1|  PREDICTED: uncharacterized protein LOC105121292    177   1e-47   Populus euphratica
ref|XP_011044001.1|  PREDICTED: uncharacterized protein LOC105139309    177   1e-47   Populus euphratica
ref|XP_007014163.1|  Calmodulin-binding protein isoform 4               177   2e-47   
ref|XP_007014160.1|  Calmodulin-binding protein isoform 1               176   2e-47   
gb|AAB37246.1|  calmodulin-binding protein                              176   2e-47   Nicotiana tabacum [American tobacco]
ref|XP_002325070.1|  calmodulin-binding family protein                  176   5e-47   Populus trichocarpa [western balsam poplar]
gb|ACJ85726.1|  unknown                                                 161   3e-46   Medicago truncatula
ref|XP_010103014.1|  hypothetical protein L484_022898                   169   7e-45   Morus notabilis
gb|KJB22129.1|  hypothetical protein B456_004G031000                    169   8e-45   Gossypium raimondii
ref|XP_006453423.1|  hypothetical protein CICLE_v10007720mg             168   2e-44   
gb|KDO62470.1|  hypothetical protein CISIN_1g006542mg                   168   2e-44   Citrus sinensis [apfelsine]
gb|KDO62471.1|  hypothetical protein CISIN_1g006542mg                   168   2e-44   Citrus sinensis [apfelsine]
ref|XP_008453624.1|  PREDICTED: uncharacterized protein LOC103494282    167   4e-44   Cucumis melo [Oriental melon]
ref|XP_010323248.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    167   4e-44   
gb|KHG10046.1|  Protein very KIND                                       166   8e-44   Gossypium arboreum [tree cotton]
ref|XP_010047003.1|  PREDICTED: uncharacterized protein LOC104435...    166   1e-43   Eucalyptus grandis [rose gum]
gb|KHG27572.1|  Cytochrome P450                                         166   1e-43   Gossypium arboreum [tree cotton]
ref|XP_006366189.1|  PREDICTED: uncharacterized protein LOC102581064    165   2e-43   
ref|XP_003610155.1|  Calmodulin-binding protein                         164   4e-43   Medicago truncatula
ref|XP_007154785.1|  hypothetical protein PHAVU_003G147800g             164   5e-43   Phaseolus vulgaris [French bean]
ref|XP_011457401.1|  PREDICTED: uncharacterized protein LOC101314910    164   8e-43   Fragaria vesca subsp. vesca
gb|KHN17575.1|  hypothetical protein glysoja_005772                     163   1e-42   Glycine soja [wild soybean]
ref|XP_003549493.1|  PREDICTED: uncharacterized protein LOC100803...    163   1e-42   Glycine max [soybeans]
gb|KJB83411.1|  hypothetical protein B456_013G246400                    162   2e-42   Gossypium raimondii
ref|XP_004146305.1|  PREDICTED: uncharacterized protein LOC101216741    162   2e-42   Cucumis sativus [cucumbers]
ref|XP_003542171.1|  PREDICTED: uncharacterized protein LOC100790...    160   7e-42   Glycine max [soybeans]
ref|XP_002270522.1|  PREDICTED: uncharacterized protein LOC100264...    160   9e-42   Vitis vinifera
emb|CBI17793.3|  unnamed protein product                                160   9e-42   Vitis vinifera
ref|XP_010656822.1|  PREDICTED: uncharacterized protein LOC100264...    159   2e-41   
gb|KHN22715.1|  hypothetical protein glysoja_027603                     159   2e-41   Glycine soja [wild soybean]
gb|EYU20920.1|  hypothetical protein MIMGU_mgv1a002870mg                158   7e-41   Erythranthe guttata [common monkey flower]
ref|XP_010265456.1|  PREDICTED: uncharacterized protein LOC104603...    157   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009388351.1|  PREDICTED: uncharacterized protein LOC103975166    153   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010265458.1|  PREDICTED: uncharacterized protein LOC104603...    157   1e-40   
ref|XP_010265459.1|  PREDICTED: uncharacterized protein LOC104603...    157   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010265460.1|  PREDICTED: uncharacterized protein LOC104603...    157   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006401191.1|  hypothetical protein EUTSA_v10012939mg             157   2e-40   Eutrema salsugineum [saltwater cress]
gb|EYU20919.1|  hypothetical protein MIMGU_mgv1a002870mg                154   2e-39   Erythranthe guttata [common monkey flower]
gb|AAN65367.1|  calmodulin-binding protein 60-A                         142   6e-39   Phaseolus vulgaris [French bean]
ref|XP_006281432.1|  hypothetical protein CARUB_v10027506mg             152   8e-39   Capsella rubella
ref|XP_002866219.1|  calmodulin-binding protein                         152   1e-38   
ref|XP_010259794.1|  PREDICTED: uncharacterized protein LOC104599111    152   1e-38   
ref|NP_200566.1|  Calmodulin-binding protein                            151   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452498.1|  PREDICTED: uncharacterized protein LOC104734591    149   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004507834.1|  PREDICTED: uncharacterized protein LOC101488...    149   1e-37   
ref|XP_004507832.1|  PREDICTED: uncharacterized protein LOC101488...    149   1e-37   Cicer arietinum [garbanzo]
ref|XP_010913644.1|  PREDICTED: uncharacterized protein LOC105039256    149   1e-37   Elaeis guineensis
ref|XP_007225676.1|  hypothetical protein PRUPE_ppa002789mg             148   2e-37   Prunus persica
ref|XP_008805417.1|  PREDICTED: uncharacterized protein LOC103718396    148   2e-37   Phoenix dactylifera
ref|XP_008800271.1|  PREDICTED: uncharacterized protein LOC103714689    148   2e-37   Phoenix dactylifera
ref|XP_004507831.1|  PREDICTED: uncharacterized protein LOC101488...    148   3e-37   Cicer arietinum [garbanzo]
ref|XP_010483282.1|  PREDICTED: uncharacterized protein LOC104761843    148   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008808337.1|  PREDICTED: uncharacterized protein LOC103720426    147   4e-37   Phoenix dactylifera
ref|XP_010914125.1|  PREDICTED: uncharacterized protein LOC105039615    147   5e-37   Elaeis guineensis
emb|CDY69506.1|  BnaCnng63910D                                          146   1e-36   Brassica napus [oilseed rape]
ref|XP_009120276.1|  PREDICTED: uncharacterized protein LOC103845193    146   1e-36   Brassica rapa
emb|CDY49721.1|  BnaA10g11510D                                          146   1e-36   Brassica napus [oilseed rape]
ref|XP_010443447.1|  PREDICTED: uncharacterized protein LOC104726314    146   2e-36   Camelina sativa [gold-of-pleasure]
gb|AAL11615.1|AF424622_1  At2g18750/MSF3.13                             142   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929241.1|  PREDICTED: uncharacterized protein LOC105050...    145   2e-36   Elaeis guineensis
ref|XP_010929240.1|  PREDICTED: uncharacterized protein LOC105050...    145   2e-36   Elaeis guineensis
ref|XP_010489590.1|  PREDICTED: uncharacterized protein LOC104767243    144   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010467708.1|  PREDICTED: uncharacterized protein LOC104747723    144   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006297211.1|  hypothetical protein CARUB_v10013220mg             144   7e-36   Capsella rubella
gb|AFW71858.1|  hypothetical protein ZEAMMB73_193945                    136   1e-35   
ref|XP_010414641.1|  PREDICTED: uncharacterized protein LOC104700762    143   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002886266.1|  calmodulin-binding protein                         142   2e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_010536924.1|  PREDICTED: uncharacterized protein LOC104811802    142   5e-35   Tarenaya hassleriana [spider flower]
ref|NP_565441.2|  Calmodulin-binding protein                            141   8e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AFW62647.1|  hypothetical protein ZEAMMB73_771415                    135   8e-35   
ref|XP_009398635.1|  PREDICTED: uncharacterized protein LOC103983171    140   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ94992.1|  predicted protein                                      140   3e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008645829.1|  PREDICTED: uncharacterized protein LOC103627...    139   6e-34   Zea mays [maize]
ref|XP_008645828.1|  PREDICTED: uncharacterized protein LOC103627...    139   6e-34   Zea mays [maize]
ref|XP_009589610.1|  PREDICTED: uncharacterized protein LOC104086953    138   7e-34   Nicotiana tomentosiformis
ref|XP_009606926.1|  PREDICTED: uncharacterized protein LOC104101...    137   9e-34   
gb|AGT16661.1|  hypothetical protein SHCRBa_107_F16_R_30                138   1e-33   Saccharum hybrid cultivar R570
ref|XP_010092630.1|  hypothetical protein L484_006392                   138   1e-33   Morus notabilis
ref|XP_009606927.1|  PREDICTED: uncharacterized protein LOC104101...    137   1e-33   Nicotiana tomentosiformis
ref|XP_004232807.1|  PREDICTED: uncharacterized protein LOC101255950    137   2e-33   Solanum lycopersicum
gb|ABK95891.1|  unknown                                                 134   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006347126.1|  PREDICTED: uncharacterized protein LOC102591443    137   2e-33   Solanum tuberosum [potatoes]
emb|CAD40976.1|  OSJNBa0027P08.1                                        129   3e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010525739.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_004952753.1|  PREDICTED: uncharacterized protein LOC101756...    136   4e-33   Setaria italica
ref|XP_004952755.1|  PREDICTED: uncharacterized protein LOC101756...    136   4e-33   Setaria italica
ref|XP_002452291.1|  hypothetical protein SORBIDRAFT_04g023100          136   5e-33   Sorghum bicolor [broomcorn]
ref|XP_010688497.1|  PREDICTED: uncharacterized protein LOC104902420    135   7e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009794879.1|  PREDICTED: uncharacterized protein LOC104241635    135   8e-33   Nicotiana sylvestris
ref|XP_006647388.1|  PREDICTED: uncharacterized protein LOC102720...    135   1e-32   Oryza brachyantha
ref|XP_006647389.1|  PREDICTED: uncharacterized protein LOC102720...    135   1e-32   Oryza brachyantha
emb|CAB71126.1|  calmodulin-binding protein                             131   1e-32   Cicer arietinum [garbanzo]
ref|XP_008678706.1|  PREDICTED: uncharacterized protein LOC103653644    135   1e-32   Zea mays [maize]
ref|NP_001047151.1|  Os02g0562300                                       135   1e-32   
ref|XP_007148242.1|  hypothetical protein PHAVU_006G191900g             134   2e-32   Phaseolus vulgaris [French bean]
emb|CAN66517.1|  hypothetical protein VITISV_001611                     134   3e-32   Vitis vinifera
ref|XP_010646160.1|  PREDICTED: uncharacterized protein LOC100256775    134   3e-32   Vitis vinifera
emb|CDY29246.1|  BnaA06g25110D                                          134   3e-32   Brassica napus [oilseed rape]
emb|CBI23322.3|  unnamed protein product                                134   3e-32   Vitis vinifera
gb|EEC73417.1|  hypothetical protein OsI_07682                          134   4e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_002316655.1|  calmodulin-binding protein 60-C                    133   5e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008349259.1|  PREDICTED: uncharacterized protein LOC103412486    127   6e-32   
ref|XP_003575160.1|  PREDICTED: uncharacterized protein LOC100846...    133   6e-32   Brachypodium distachyon [annual false brome]
ref|XP_010235560.1|  PREDICTED: uncharacterized protein LOC100846...    133   6e-32   Brachypodium distachyon [annual false brome]
ref|XP_011043288.1|  PREDICTED: uncharacterized protein LOC105138...    133   7e-32   Populus euphratica
ref|XP_007025783.1|  Calmodulin-binding protein isoform 2               132   2e-31   
ref|XP_007025782.1|  Calmodulin-binding protein isoform 1               132   2e-31   
gb|EAY94271.1|  hypothetical protein OsI_16040                          132   2e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_001052891.1|  Os04g0444200                                       132   2e-31   
gb|ABR25523.1|  calmodulin binding protein cellular communication...    122   3e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_009761692.1|  PREDICTED: uncharacterized protein LOC104213...    130   3e-31   Nicotiana sylvestris
ref|XP_004485707.1|  PREDICTED: uncharacterized protein LOC101498971    130   5e-31   Cicer arietinum [garbanzo]
emb|CDY02746.1|  BnaC02g11430D                                          130   5e-31   
ref|XP_009761691.1|  PREDICTED: uncharacterized protein LOC104213...    130   5e-31   Nicotiana sylvestris
ref|XP_006409114.1|  hypothetical protein EUTSA_v10022604mg             130   5e-31   Eutrema salsugineum [saltwater cress]
ref|XP_009150716.1|  PREDICTED: uncharacterized protein LOC103874061    130   5e-31   
ref|XP_004504984.1|  PREDICTED: uncharacterized protein LOC101509425    130   7e-31   Cicer arietinum [garbanzo]
ref|XP_006361013.1|  PREDICTED: uncharacterized protein LOC102605248    130   7e-31   Solanum tuberosum [potatoes]
ref|XP_006384008.1|  hypothetical protein POPTR_0004s03510g             129   1e-30   
ref|XP_010539448.1|  PREDICTED: uncharacterized protein LOC104813528    129   2e-30   Tarenaya hassleriana [spider flower]
gb|KEH36516.1|  calmodulin-binding protein                              129   2e-30   Medicago truncatula
ref|XP_009126828.1|  PREDICTED: uncharacterized protein LOC103851701    129   2e-30   Brassica rapa
ref|XP_011001128.1|  PREDICTED: uncharacterized protein LOC105108501    128   3e-30   Populus euphratica
ref|XP_010696621.1|  PREDICTED: uncharacterized protein LOC104909...    127   6e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010696620.1|  PREDICTED: uncharacterized protein LOC104909...    127   7e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK38635.1|  unknown                                                 119   7e-30   Medicago truncatula
ref|XP_008383819.1|  PREDICTED: uncharacterized protein LOC103446473    127   7e-30   
ref|XP_002869655.1|  calmodulin-binding protein                         127   8e-30   
emb|CDO99627.1|  unnamed protein product                                127   8e-30   Coffea canephora [robusta coffee]
gb|AAN65369.1|  calmodulin-binding protein 60-C                         119   1e-29   Phaseolus vulgaris [French bean]
ref|XP_009414724.1|  PREDICTED: uncharacterized protein LOC103995757    127   1e-29   
gb|KDP20890.1|  hypothetical protein JCGZ_21361                         126   1e-29   Jatropha curcas
gb|KDO75731.1|  hypothetical protein CISIN_1g006875mg                   126   1e-29   Citrus sinensis [apfelsine]
ref|XP_006467892.1|  PREDICTED: uncharacterized protein LOC102626942    126   2e-29   Citrus sinensis [apfelsine]
ref|XP_006449222.1|  hypothetical protein CICLE_v10014600mg             126   2e-29   Citrus clementina [clementine]
gb|KDO75730.1|  hypothetical protein CISIN_1g006875mg                   126   2e-29   Citrus sinensis [apfelsine]
ref|XP_003545838.1|  PREDICTED: uncharacterized protein LOC100802...    126   2e-29   Glycine max [soybeans]
emb|CDY59992.1|  BnaA02g35270D                                          126   2e-29   Brassica napus [oilseed rape]
ref|XP_006449221.1|  hypothetical protein CICLE_v10014600mg             125   2e-29   
gb|KDO75734.1|  hypothetical protein CISIN_1g006875mg                   125   2e-29   Citrus sinensis [apfelsine]
ref|XP_010327020.1|  PREDICTED: uncharacterized protein LOC101268...    125   2e-29   
gb|ACN34699.1|  unknown                                                 122   2e-29   Zea mays [maize]
ref|XP_008224944.1|  PREDICTED: uncharacterized protein LOC103324...    126   2e-29   Prunus mume [ume]
ref|XP_003570530.1|  PREDICTED: uncharacterized protein LOC100822237    125   2e-29   Brachypodium distachyon [annual false brome]
ref|XP_010327019.1|  PREDICTED: uncharacterized protein LOC101268...    125   2e-29   
ref|XP_008224946.1|  PREDICTED: uncharacterized protein LOC103324...    126   2e-29   Prunus mume [ume]
ref|XP_004248099.1|  PREDICTED: uncharacterized protein LOC101268...    125   3e-29   Solanum lycopersicum
ref|XP_004248098.1|  PREDICTED: uncharacterized protein LOC101268...    125   3e-29   Solanum lycopersicum
gb|AAA33446.1|  calmodulin-binding protein                              117   4e-29   Zea mays [maize]
gb|KHN07315.1|  hypothetical protein glysoja_027405                     124   6e-29   Glycine soja [wild soybean]
ref|XP_003529298.1|  PREDICTED: uncharacterized protein LOC100812605    124   6e-29   Glycine max [soybeans]
ref|XP_010057559.1|  PREDICTED: uncharacterized protein LOC104445366    124   6e-29   Eucalyptus grandis [rose gum]
ref|XP_002524676.1|  calmodulin binding protein, putative               123   8e-29   
ref|XP_009112562.1|  PREDICTED: uncharacterized protein LOC103837921    124   8e-29   Brassica rapa
emb|CDY30302.1|  BnaA09g09750D                                          124   8e-29   Brassica napus [oilseed rape]
ref|XP_007213593.1|  hypothetical protein PRUPE_ppa002740mg             124   9e-29   Prunus persica
ref|NP_001046071.1|  Os02g0177800                                       124   1e-28   
gb|EEC72606.1|  hypothetical protein OsI_06079                          124   1e-28   Oryza sativa Indica Group [Indian rice]
gb|AFW66308.1|  hypothetical protein ZEAMMB73_910550                    120   1e-28   
ref|NP_001130446.1|  uncharacterized protein LOC100191543               122   1e-28   
ref|XP_011096210.1|  PREDICTED: uncharacterized protein LOC105175464    123   2e-28   Sesamum indicum [beniseed]
ref|XP_002535201.1|  hypothetical protein RCOM_0245460                  100   3e-28   
gb|EEE56432.1|  hypothetical protein OsJ_05602                          123   3e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CDY52577.1|  BnaCnng22620D                                          122   3e-28   Brassica napus [oilseed rape]
tpg|DAA37640.1|  TPA: hypothetical protein ZEAMMB73_428755              120   5e-28   
ref|XP_008667040.1|  PREDICTED: uncharacterized protein LOC100191...    122   5e-28   Zea mays [maize]
ref|XP_008667039.1|  PREDICTED: uncharacterized protein LOC100191...    122   5e-28   
gb|KHN00110.1|  hypothetical protein glysoja_028638                     122   5e-28   Glycine soja [wild soybean]
ref|XP_003532556.1|  PREDICTED: uncharacterized protein LOC100806393    122   5e-28   Glycine max [soybeans]
ref|XP_002535531.1|  hypothetical protein RCOM_2098470                  100   8e-28   
ref|XP_004293506.1|  PREDICTED: uncharacterized protein LOC101308261    121   1e-27   Fragaria vesca subsp. vesca
ref|XP_010433589.1|  PREDICTED: uncharacterized protein LOC104717678    121   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006845603.1|  hypothetical protein AMTR_s00019p00206980          121   1e-27   Amborella trichopoda
ref|NP_001150045.1|  calmodulin binding protein                         120   1e-27   Zea mays [maize]
gb|AFW70388.1|  calmodulin binding protein                              120   2e-27   
ref|XP_009376054.1|  PREDICTED: uncharacterized protein LOC103964...    120   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_009375849.1|  PREDICTED: uncharacterized protein LOC103964...    120   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_003608224.1|  Calmodulin-binding protein                         120   2e-27   Medicago truncatula
ref|XP_011043291.1|  PREDICTED: uncharacterized protein LOC105138...    120   2e-27   Populus euphratica
gb|KJB57646.1|  hypothetical protein B456_009G173400                    120   2e-27   Gossypium raimondii
gb|KHG24590.1|  eukaryotic translation initiation factor 3 subunit m    120   2e-27   Gossypium arboreum [tree cotton]
gb|EYU42432.1|  hypothetical protein MIMGU_mgv1a025463mg                120   2e-27   Erythranthe guttata [common monkey flower]
ref|NP_001152440.1|  LOC100286080                                       120   2e-27   Zea mays [maize]
gb|ACG47634.1|  calmodulin binding protein                              120   2e-27   Zea mays [maize]
ref|XP_011043290.1|  PREDICTED: uncharacterized protein LOC105138...    120   3e-27   Populus euphratica
ref|XP_011043289.1|  PREDICTED: uncharacterized protein LOC105138...    120   3e-27   Populus euphratica
ref|XP_007159256.1|  hypothetical protein PHAVU_002G222600g             120   3e-27   Phaseolus vulgaris [French bean]
ref|XP_006646962.1|  PREDICTED: uncharacterized protein LOC102709708    119   4e-27   Oryza brachyantha
ref|XP_004951715.1|  PREDICTED: uncharacterized protein LOC101768423    119   4e-27   Setaria italica
emb|CAB39601.1|  putative calmodulin-binding protein                    118   7e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27904.1|  hypothetical protein MIMGU_mgv1a0037712mg               117   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_010438831.1|  PREDICTED: uncharacterized protein LOC104722380    118   1e-26   Camelina sativa [gold-of-pleasure]
ref|NP_194310.3|  Calmodulin-binding protein                            118   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448369.1|  PREDICTED: uncharacterized protein LOC104730...    118   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010448367.1|  PREDICTED: uncharacterized protein LOC104730...    117   2e-26   Camelina sativa [gold-of-pleasure]
gb|AHI49901.1|  calmodulin-binding protein                              108   3e-26   Lavandula angustifolia [lavender]
emb|CDY59605.1|  BnaC03g74590D                                          116   5e-26   Brassica napus [oilseed rape]
gb|EMT26442.1|  hypothetical protein F775_27587                         116   6e-26   
ref|XP_008364142.1|  PREDICTED: uncharacterized protein LOC103427...    116   7e-26   Malus domestica [apple tree]
ref|XP_008364144.1|  PREDICTED: uncharacterized protein LOC103427...    116   8e-26   
gb|EMS55488.1|  hypothetical protein TRIUR3_12862                       115   1e-25   Triticum urartu
ref|XP_002453396.1|  hypothetical protein SORBIDRAFT_04g005240          115   1e-25   Sorghum bicolor [broomcorn]
ref|XP_002532915.1|  hypothetical protein RCOM_1318360                92.4    2e-25   
ref|XP_002446536.1|  hypothetical protein SORBIDRAFT_06g017740          115   2e-25   Sorghum bicolor [broomcorn]
ref|XP_009394895.1|  PREDICTED: uncharacterized protein LOC103980282    114   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006282572.1|  hypothetical protein CARUB_v10004387mg             114   3e-25   Capsella rubella
ref|XP_004975724.1|  PREDICTED: uncharacterized protein LOC101760...    114   3e-25   Setaria italica
ref|XP_004975725.1|  PREDICTED: uncharacterized protein LOC101760...    114   4e-25   Setaria italica
gb|AAA33447.1|  calmodulin-binding protein                              108   3e-24   Zea mays [maize]
gb|EMS66803.1|  hypothetical protein TRIUR3_04882                       110   4e-24   Triticum urartu
dbj|BAJ96828.1|  predicted protein                                      109   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04468.1|  predicted protein                                      109   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT33137.1|  hypothetical protein F775_28653                         108   7e-23   
gb|EMS66476.1|  hypothetical protein TRIUR3_28909                       107   1e-22   Triticum urartu
gb|EMT06125.1|  hypothetical protein F775_27254                         106   2e-22   
ref|XP_002316656.1|  calmodulin-binding protein 60-C                    104   7e-22   Populus trichocarpa [western balsam poplar]
gb|KHG17962.1|  Insulin-like receptor                                   103   2e-21   Gossypium arboreum [tree cotton]
ref|XP_002527587.1|  hypothetical protein RCOM_1566570                97.4    3e-21   
emb|CAN60089.1|  hypothetical protein VITISV_005487                   96.3    7e-21   Vitis vinifera
gb|KJB68601.1|  hypothetical protein B456_010G254300                    101   8e-21   Gossypium raimondii
gb|AAN65370.1|  calmodulin-binding protein 60-D                       98.6    8e-21   Phaseolus vulgaris [French bean]
gb|KDO59436.1|  hypothetical protein CISIN_1g007350mg                   101   1e-20   Citrus sinensis [apfelsine]
gb|KDO59439.1|  hypothetical protein CISIN_1g007350mg                   100   1e-20   Citrus sinensis [apfelsine]
gb|KDP38647.1|  hypothetical protein JCGZ_04000                         100   2e-20   Jatropha curcas
ref|XP_006587151.1|  PREDICTED: uncharacterized protein LOC100808...  99.0    4e-20   
ref|XP_006473988.1|  PREDICTED: uncharacterized protein LOC102629839  99.4    4e-20   Citrus sinensis [apfelsine]
gb|AFK33712.1|  unknown                                               96.7    5e-20   Medicago truncatula
ref|XP_007138149.1|  hypothetical protein PHAVU_009G184300g           99.4    5e-20   Phaseolus vulgaris [French bean]
ref|XP_003533889.1|  PREDICTED: uncharacterized protein LOC100808...  99.0    6e-20   Glycine max [soybeans]
gb|AHM26861.1|  calmodulin-binding protein                            95.1    7e-20   Anthurium andraeanum [flamingo-lily]
gb|KJB69416.1|  hypothetical protein B456_011G022600                  98.6    8e-20   Gossypium raimondii
ref|XP_002523509.1|  calmodulin binding protein, putative             97.1    8e-20   
ref|XP_004488927.1|  PREDICTED: uncharacterized protein LOC101515...  97.4    2e-19   Cicer arietinum [garbanzo]
ref|XP_009127322.1|  PREDICTED: uncharacterized protein LOC103852...  95.9    2e-19   Brassica rapa
ref|XP_010419299.1|  PREDICTED: uncharacterized protein LOC104705005  92.0    3e-19   Camelina sativa [gold-of-pleasure]
gb|KEH37860.1|  calmodulin-binding protein                            96.7    4e-19   Medicago truncatula
ref|XP_009127315.1|  PREDICTED: uncharacterized protein LOC103852...  95.9    5e-19   Brassica rapa
ref|XP_007011980.1|  Calmodulin-binding protein isoform 1             95.9    8e-19   
emb|CDX68716.1|  BnaC01g07370D                                        95.1    1e-18   
ref|XP_010265653.1|  PREDICTED: uncharacterized protein LOC104603341  95.1    1e-18   Nelumbo nucifera [Indian lotus]
emb|CDY28237.1|  BnaA01g06120D                                        94.4    2e-18   Brassica napus [oilseed rape]
ref|XP_003633161.1|  PREDICTED: uncharacterized protein LOC100255894  94.7    2e-18   Vitis vinifera
ref|XP_010548510.1|  PREDICTED: uncharacterized protein LOC104819913  94.0    3e-18   
ref|XP_010417184.1|  PREDICTED: uncharacterized protein LOC104702949  90.9    3e-18   Camelina sativa [gold-of-pleasure]
emb|CBI18672.3|  unnamed protein product                              92.8    4e-18   Vitis vinifera
gb|KJB27327.1|  hypothetical protein B456_004G291200                  93.2    5e-18   Gossypium raimondii
gb|KJB27328.1|  hypothetical protein B456_004G291200                  93.2    5e-18   Gossypium raimondii
emb|CDY46137.1|  BnaA04g14250D                                        93.2    5e-18   Brassica napus [oilseed rape]
emb|CDY20299.1|  BnaC04g36570D                                        93.2    5e-18   Brassica napus [oilseed rape]
gb|KHG21283.1|  pentafunctional arom polypeptide                      93.2    5e-18   Gossypium arboreum [tree cotton]
ref|XP_009140533.1|  PREDICTED: uncharacterized protein LOC103864...  93.2    5e-18   Brassica rapa
ref|XP_009140532.1|  PREDICTED: uncharacterized protein LOC103864...  93.2    6e-18   
ref|XP_002878744.1|  calmodulin-binding protein                       92.0    1e-17   
ref|XP_006404953.1|  hypothetical protein EUTSA_v10000138mg           91.7    1e-17   
ref|XP_006295420.1|  hypothetical protein CARUB_v10024519mg           92.0    2e-17   
ref|XP_010039935.1|  PREDICTED: uncharacterized protein LOC104428671  88.6    2e-17   
ref|XP_003546611.1|  PREDICTED: uncharacterized protein LOC100775528  91.7    2e-17   Glycine max [soybeans]
gb|KCW45621.1|  hypothetical protein EUGRSUZ_L006162                  88.6    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010472432.1|  PREDICTED: uncharacterized protein LOC104752066  91.3    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009139545.1|  PREDICTED: uncharacterized protein LOC103863555  90.5    4e-17   Brassica rapa
gb|AAD18103.1|  putative calmodulin-binding protein                   90.1    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973527.1|  Calmodulin-binding protein                          90.5    5e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDX89394.1|  BnaA01g14990D                                        90.1    5e-17   
ref|NP_180007.2|  Calmodulin-binding protein                          90.1    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429400.1|  PREDICTED: uncharacterized protein LOC104713...  90.1    6e-17   
ref|XP_006412639.1|  hypothetical protein EUTSA_v10024817mg           90.1    6e-17   
ref|XP_010429406.1|  PREDICTED: uncharacterized protein LOC104713...  90.1    6e-17   Camelina sativa [gold-of-pleasure]
gb|KFK32663.1|  hypothetical protein AALP_AA6G272300                  89.7    7e-17   Arabis alpina [alpine rockcress]
emb|CDX94414.1|  BnaC01g17700D                                        89.7    7e-17   
gb|AAL32934.1|  putative calmodulin-binding protein                   86.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001291237.1|  uncharacterized LOC105121148                     87.8    3e-16   Populus euphratica
ref|XP_011033469.1|  PREDICTED: uncharacterized protein LOC105131940  87.8    4e-16   Populus euphratica
ref|XP_004287109.1|  PREDICTED: uncharacterized protein LOC101306949  87.8    4e-16   Fragaria vesca subsp. vesca
ref|XP_007203768.1|  hypothetical protein PRUPE_ppa002988mg           87.0    6e-16   Prunus persica
ref|XP_010049867.1|  PREDICTED: uncharacterized protein LOC104438419  87.0    6e-16   Eucalyptus grandis [rose gum]
emb|CAA18193.1|  putative calmodulin-binding protein                  86.3    7e-16   
ref|XP_002324557.1|  calmodulin-binding protein 60-D                  86.7    8e-16   
ref|NP_001190876.1|  Calmodulin-binding protein                       85.9    1e-15   
ref|NP_194829.2|  Calmodulin-binding protein                          85.9    1e-15   
ref|XP_011017983.1|  PREDICTED: uncharacterized protein LOC105121148  85.9    1e-15   
ref|XP_010436318.1|  PREDICTED: uncharacterized protein LOC104720044  85.5    2e-15   
ref|XP_008384593.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  84.7    4e-15   
ref|XP_010447628.1|  PREDICTED: uncharacterized protein LOC104730192  84.3    4e-15   
ref|XP_010438093.1|  PREDICTED: uncharacterized protein LOC104721...  84.0    5e-15   
ref|XP_006453636.1|  hypothetical protein CICLE_v10008603mg           84.3    5e-15   
ref|XP_001766477.1|  predicted protein                                84.0    6e-15   
ref|XP_010438091.1|  PREDICTED: uncharacterized protein LOC104721...  83.6    7e-15   
ref|XP_008336916.1|  PREDICTED: uncharacterized protein LOC103400014  83.6    8e-15   
ref|XP_009366145.1|  PREDICTED: uncharacterized protein LOC103955955  83.2    1e-14   
ref|XP_009358482.1|  PREDICTED: uncharacterized protein LOC103949109  82.8    1e-14   
ref|XP_002869350.1|  calmodulin-binding protein                       82.4    2e-14   
ref|XP_001782625.1|  predicted protein                                80.5    1e-13   
ref|XP_008242948.1|  PREDICTED: uncharacterized protein LOC103341237  79.7    2e-13   
ref|XP_002309326.2|  calmodulin-binding protein 60-D                  78.6    4e-13   
ref|XP_002532197.1|  hypothetical protein RCOM_0445830                70.9    1e-12   
ref|XP_006283459.1|  hypothetical protein CARUB_v10004503mg           75.9    3e-12   
emb|CAN66518.1|  hypothetical protein VITISV_001612                   69.7    3e-12   
ref|XP_010527109.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.9    4e-12   
ref|XP_002531050.1|  hypothetical protein RCOM_0518120                70.9    6e-12   
ref|XP_001756257.1|  predicted protein                                74.3    8e-12   
ref|XP_010927522.1|  PREDICTED: uncharacterized protein LOC105049...  73.6    2e-11   
ref|XP_010927523.1|  PREDICTED: uncharacterized protein LOC105049...  73.6    2e-11   
ref|XP_010103374.1|  hypothetical protein L484_016885                 71.2    1e-10   
ref|XP_002531478.1|  conserved hypothetical protein                   53.1    3e-10   
ref|XP_007011982.1|  Calmodulin-binding protein isoform 3             69.3    3e-10   
ref|XP_007011981.1|  Calmodulin-binding protein isoform 2             69.3    4e-10   
gb|AAN65368.1|  calmodulin-binding protein 60-B                       63.5    5e-10   
ref|XP_008796866.1|  PREDICTED: uncharacterized protein LOC103712...  68.9    5e-10   
ref|XP_008796874.1|  PREDICTED: uncharacterized protein LOC103712...  68.9    6e-10   
gb|ABA27028.1|  TO69-3                                                62.4    2e-09   
ref|XP_002993171.1|  hypothetical protein SELMODRAFT_187271           63.9    2e-08   
ref|XP_001767931.1|  predicted protein                                63.9    2e-08   
ref|XP_002964136.1|  hypothetical protein SELMODRAFT_166784           63.9    3e-08   
ref|XP_001758879.1|  predicted protein                                62.8    5e-08   
gb|EAZ30858.1|  hypothetical protein OsJ_14930                        58.5    1e-06   
ref|XP_002532912.1|  conserved hypothetical protein                   52.0    3e-05   
ref|XP_002530779.1|  conserved hypothetical protein                   49.7    2e-04   
ref|XP_002532196.1|  hypothetical protein RCOM_0445820                50.1    3e-04   
ref|XP_010070137.1|  PREDICTED: uncharacterized protein LOC104456...  51.6    3e-04   
ref|XP_010070058.1|  PREDICTED: uncharacterized protein LOC104456...  51.6    3e-04   
ref|XP_010070201.1|  PREDICTED: uncharacterized protein LOC104456...  51.6    3e-04   
ref|XP_010065428.1|  PREDICTED: uncharacterized protein LOC104452659  50.1    0.001   



>ref|XP_002526232.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF36173.1| calmodulin binding protein, putative [Ricinus communis]
Length=466

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+N RDKGV+EY +EEEIR+RSHEMLENEDMQHLLRLFSMGGH +VNIPEDGF F P+M
Sbjct  355  DWTNNRDKGVDEYFTEEEIRIRSHEMLENEDMQHLLRLFSMGGHGAVNIPEDGFSFPPYM  414

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            A SP   YDE+  RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  415  AASPMPNYDENSGRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  459



>gb|KDP22927.1| hypothetical protein JCGZ_01764 [Jatropha curcas]
Length=631

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 1/105 (1%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+N RDKGV+EY +EEEIRLRSHEMLENEDMQHLLRLFSMG HASVNIPEDG+GF P+M
Sbjct  521  DWANNRDKGVDEYFAEEEIRLRSHEMLENEDMQHLLRLFSMGAHASVNIPEDGYGFPPYM  580

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              SP   YDEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  581  Q-SPMPNYDEDRTRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  624



>emb|CDP02958.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+  RDK V+++LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHA+VN+P+D F F  +M
Sbjct  519  DWTQNRDKSVDDFLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHAAVNVPDDNFAFQSYM  578

Query  562  -APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +PSP++ Y+EDR R GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  579  PSPSPNYSYEEDRTRSGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  624



>ref|XP_011079310.1| PREDICTED: uncharacterized protein LOC105162855 [Sesamum indicum]
Length=643

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS  RDKGV+++LSEEEIR+RSHEMLENEDMQHLLRLFSMGGHASVN+PEDG+ F  +M
Sbjct  531  DWSTNRDKGVDDFLSEEEIRMRSHEMLENEDMQHLLRLFSMGGHASVNVPEDGYNFPSYM  590

Query  562  -APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +PSP F Y EDR R GKAV GWLKIKAAMRWG FIRKKAAERRA+
Sbjct  591  PSPSPGFSYGEDRTRSGKAVAGWLKIKAAMRWGIFIRKKAAERRAR  636



>ref|XP_011018189.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018190.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018191.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
 ref|XP_011018192.1| PREDICTED: uncharacterized protein LOC105121292 [Populus euphratica]
Length=647

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 3/105 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+N RDK  +E+ SEEEIR+RSHEMLENEDMQHLLRLFSMGGHA  N+PEDGF + P+M
Sbjct  537  DWTNNRDKSADEFFSEEEIRVRSHEMLENEDMQHLLRLFSMGGHA--NVPEDGFSYPPYM  594

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            A SP   YDEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  595  A-SPMPNYDEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  638



>ref|XP_011044001.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044002.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044003.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
 ref|XP_011044004.1| PREDICTED: uncharacterized protein LOC105139309 [Populus euphratica]
Length=647

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 3/105 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+N RDK  +E+ SEEEIR+RSHEMLENEDMQHLLRLFSMGGHA  N+PEDGF + P+M
Sbjct  537  DWTNNRDKSADEFFSEEEIRVRSHEMLENEDMQHLLRLFSMGGHA--NVPEDGFSYPPYM  594

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            A SP   YDEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  595  A-SPMPNYDEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  638



>ref|XP_007014163.1| Calmodulin-binding protein isoform 4 [Theobroma cacao]
 gb|EOY31782.1| Calmodulin-binding protein isoform 4 [Theobroma cacao]
Length=643

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 95/107 (89%), Gaps = 3/107 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPF  566
            DW+N RDKGVE+  SEEEIR+RSHEMLENEDMQHLLRLFSMGGHAS+N+ ED G+GF  +
Sbjct  530  DWTNNRDKGVEDLFSEEEIRIRSHEMLENEDMQHLLRLFSMGGHASINVTEDGGYGFPNY  589

Query  565  M-APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            M +P P+F  DEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  590  MQSPMPNF-VDEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  635



>ref|XP_007014160.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 ref|XP_007014161.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 ref|XP_007014162.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31779.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31780.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY31781.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=642

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 95/107 (89%), Gaps = 3/107 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPF  566
            DW+N RDKGVE+  SEEEIR+RSHEMLENEDMQHLLRLFSMGGHAS+N+ ED G+GF  +
Sbjct  529  DWTNNRDKGVEDLFSEEEIRIRSHEMLENEDMQHLLRLFSMGGHASINVTEDGGYGFPNY  588

Query  565  M-APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            M +P P+F  DEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  589  MQSPMPNF-VDEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  634



>gb|AAB37246.1| calmodulin-binding protein [Nicotiana tabacum]
Length=551

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 2/107 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-HASVNIPEDGFGFTPF  566
            DW + RDKGV+E+LSEEEIR+RSHE+LEN+DMQHLLRLFSMGG H SVN+ EDG+GF  F
Sbjct  438  DWPHNRDKGVDEFLSEEEIRMRSHEILENDDMQHLLRLFSMGGGHGSVNVSEDGYGFPSF  497

Query  565  M-APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            M +PSP+FGYDED    GKAVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  498  MPSPSPTFGYDEDPKPSGKAVVGWLKIKAAMRWGFFVRKKAAERRAQ  544



>ref|XP_002325070.1| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEF03635.1| calmodulin-binding family protein [Populus trichocarpa]
Length=648

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 3/105 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW++ RDK  +E+ SEEEIR+RSHEMLENEDMQHLLRLFSMGGHA  N+PEDGF + P+M
Sbjct  538  DWTSNRDKSADEFFSEEEIRIRSHEMLENEDMQHLLRLFSMGGHA--NVPEDGFSYPPYM  595

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            A SP   YDEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  596  A-SPMPNYDEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  639



>gb|ACJ85726.1| unknown [Medicago truncatula]
Length=119

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWSN RDKGV+++ SE+EIR+RS+E+LENEDMQHLLRLFSMGGH S+N  EDG+ F  FM
Sbjct  11   DWSNNRDKGVDDFFSEDEIRVRSNEILENEDMQHLLRLFSMGGHPSMNT-EDGYSFPSFM  69

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   +DEDR RPGKAVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  70   -PSPMPNFDEDRSRPGKAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  113



>ref|XP_010103014.1| hypothetical protein L484_022898 [Morus notabilis]
 gb|EXB94581.1| hypothetical protein L484_022898 [Morus notabilis]
Length=641

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 4/106 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS  RDKGV+++ SEEEIR++SHEMLENEDMQHLLR+FSMGGH S+N+PEDG+ F+ FM
Sbjct  530  DWSQHRDKGVDDFFSEEEIRIKSHEMLENEDMQHLLRIFSMGGHPSMNMPEDGYAFSSFM  589

Query  562  -APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P+P+F  DEDR R GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  590  HSPTPNF--DEDR-RSGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  632



>gb|KJB22129.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
 gb|KJB22130.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
 gb|KJB22131.1| hypothetical protein B456_004G031000 [Gossypium raimondii]
Length=640

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 89/106 (84%), Gaps = 2/106 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWSN RDKGVE+  SEEEIRLRSHEMLENEDMQHLLRLFSMGGH +    + GFGF  +M
Sbjct  524  DWSNNRDKGVEDLFSEEEIRLRSHEMLENEDMQHLLRLFSMGGHHATVTEDGGFGFPNYM  583

Query  562  APSPSFGY-DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   + DEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  584  -PSPMVNFIDEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  628



>ref|XP_006453423.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 ref|XP_006453424.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 ref|XP_006474152.1| PREDICTED: uncharacterized protein LOC102625149 isoform X1 [Citrus 
sinensis]
 ref|XP_006474153.1| PREDICTED: uncharacterized protein LOC102625149 isoform X2 [Citrus 
sinensis]
 gb|ESR66663.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 gb|ESR66664.1| hypothetical protein CICLE_v10007720mg [Citrus clementina]
 gb|KDO62468.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
 gb|KDO62469.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=641

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 91/105 (87%), Gaps = 5/105 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKGVE++ SEEEIR+RS+EMLEN+DMQHLLRLFSMGGHAS    EDG+ F  FM
Sbjct  535  DWSHNRDKGVEDFFSEEEIRMRSNEMLENDDMQHLLRLFSMGGHAS----EDGYSFPSFM  590

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   +DEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  591  -PSPMPNFDEDRTRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  634



>gb|KDO62470.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=639

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 91/105 (87%), Gaps = 5/105 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKGVE++ SEEEIR+RS+EMLEN+DMQHLLRLFSMGGHAS    EDG+ F  FM
Sbjct  533  DWSHNRDKGVEDFFSEEEIRMRSNEMLENDDMQHLLRLFSMGGHAS----EDGYSFPSFM  588

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   +DEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  589  -PSPMPNFDEDRTRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  632



>gb|KDO62471.1| hypothetical protein CISIN_1g006542mg [Citrus sinensis]
Length=635

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 91/105 (87%), Gaps = 5/105 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKGVE++ SEEEIR+RS+EMLEN+DMQHLLRLFSMGGHAS    EDG+ F  FM
Sbjct  529  DWSHNRDKGVEDFFSEEEIRMRSNEMLENDDMQHLLRLFSMGGHAS----EDGYSFPSFM  584

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   +DEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  585  -PSPMPNFDEDRTRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  628



>ref|XP_008453624.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
 ref|XP_008453625.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
 ref|XP_008453626.1| PREDICTED: uncharacterized protein LOC103494282 [Cucumis melo]
Length=637

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 4/106 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWSN RDKGV+++ SE+EIR+RSHEMLENEDMQ LLR+FSMGGHASVN+ ++GF F  FM
Sbjct  528  DWSNNRDKGVDDFFSEDEIRMRSHEMLENEDMQQLLRMFSMGGHASVNVHDEGFSFPSFM  587

Query  562  -APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P PSF   +DR R GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  588  PSPMPSF---DDRNRSGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  630



>ref|XP_010323248.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101245373 
[Solanum lycopersicum]
Length=632

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFG-FTPF  566
            DWS+ RDKGV+E+LSEEEIR+RS+E+LEN+DMQHLLRLFSMGGH S+N+PEDG+G  +  
Sbjct  520  DWSHNRDKGVDEFLSEEEIRMRSNEILENDDMQHLLRLFSMGGHGSINVPEDGYGFPSFM  579

Query  565  MAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +PSPSF YDEDR RPGKAVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  580  PSPSPSFSYDEDRTRPGKAVVGWLKIKAAMRWGFFVRKKAAERRAQ  625



>gb|KHG10046.1| Protein very KIND [Gossypium arboreum]
Length=640

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 88/105 (84%), Gaps = 2/105 (2%)
 Frame = -3

Query  739  WSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMA  560
            WSN RDKGVE+  SEEEIRLRSHEMLENEDMQHLLRLFSMGGH +    + GFGF  +M 
Sbjct  525  WSNNRDKGVEDMFSEEEIRLRSHEMLENEDMQHLLRLFSMGGHHATVTEDGGFGFPNYM-  583

Query  559  PSPSFGY-DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            PSP   + DEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  584  PSPMVNFIDEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  628



>ref|XP_010047003.1| PREDICTED: uncharacterized protein LOC104435977 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047005.1| PREDICTED: uncharacterized protein LOC104435977 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78744.1| hypothetical protein EUGRSUZ_C00185 [Eucalyptus grandis]
Length=635

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 93/106 (88%), Gaps = 3/106 (3%)
 Frame = -3

Query  742  DWSNTRDKGVE-EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF  566
            DWS  RDKG + E+L+EEEIR+RSHEMLENEDMQ LLRLFSMGGH S+++PED +GFT +
Sbjct  526  DWSGNRDKGGDIEFLTEEEIRMRSHEMLENEDMQQLLRLFSMGGHTSISVPEDAYGFTTY  585

Query  565  MAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + PSP   +DE+R RPGKAVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  586  V-PSPQ-PFDEERSRPGKAVVGWLKIKAAMRWGFFVRKKAAERRAQ  629



>gb|KHG27572.1| Cytochrome P450 [Gossypium arboreum]
Length=643

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 96/107 (90%), Gaps = 3/107 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPF  566
            DW+N  DKGVE++LSEEEIR+RS+EMLENE+MQHLLRLF+MGG+AS+N+ ED G+GF  +
Sbjct  529  DWTNNHDKGVEDFLSEEEIRVRSNEMLENEEMQHLLRLFNMGGNASINMTEDSGYGFPNY  588

Query  565  M-APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +P P+F  DEDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  589  IPSPMPNF-VDEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  634



>ref|XP_006366189.1| PREDICTED: uncharacterized protein LOC102581064 [Solanum tuberosum]
Length=618

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFG-FTPF  566
            DWS+ RDKGV+E+LSEEEIR+RS+E+LEN+DMQ LLRLFSMGGH SVN+PEDG+G  +  
Sbjct  506  DWSHNRDKGVDEFLSEEEIRMRSNEILENDDMQQLLRLFSMGGHGSVNVPEDGYGFPSFM  565

Query  565  MAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +PSPSF YDEDR RPGKAVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  566  PSPSPSFSYDEDRTRPGKAVVGWLKIKAAMRWGFFVRKKAAERRAQ  611



>ref|XP_003610155.1| Calmodulin-binding protein [Medicago truncatula]
 gb|AES92352.1| calmodulin-binding protein [Medicago truncatula]
Length=636

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 91/105 (87%), Gaps = 2/105 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWSN RDKGV+++ SE+EIR+RS+E+LENEDMQHLLRLFSMGGH S+N  EDG+ F  FM
Sbjct  528  DWSNNRDKGVDDFFSEDEIRVRSNEILENEDMQHLLRLFSMGGHPSMNT-EDGYSFPSFM  586

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   +DEDR RPGKAVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  587  -PSPMPNFDEDRSRPGKAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  630



>ref|XP_007154785.1| hypothetical protein PHAVU_003G147800g [Phaseolus vulgaris]
 gb|ESW26779.1| hypothetical protein PHAVU_003G147800g [Phaseolus vulgaris]
Length=637

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-HASVNIPEDGFGFTPF  566
            DWS+ RDKGV+E+ SEEEIRLRSHEMLENEDMQHLLRLFSMGG H S+++ EDG+ F  F
Sbjct  527  DWSHNRDKGVDEFFSEEEIRLRSHEMLENEDMQHLLRLFSMGGGHGSMSV-EDGYSFPTF  585

Query  565  MAPSPSF-GYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            M PSP+   YDEDR RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  586  M-PSPNVPNYDEDRSRPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  631



>ref|XP_011457401.1| PREDICTED: uncharacterized protein LOC101314910 [Fragaria vesca 
subsp. vesca]
Length=639

 Score =   164 bits (414),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 90/103 (87%), Gaps = 2/103 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW   R+KG +++ SEE+IR+RSHEMLENEDMQHLLR+FSMGGH S+++P+DG+ F P+M
Sbjct  529  DWGTNREKGGDDFFSEEDIRIRSHEMLENEDMQHLLRIFSMGGHGSIDMPDDGYAF-PYM  587

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERR  434
             PSP   +DEDR RPGKAVVGWLKIKAAMRWGFF+RKKAAERR
Sbjct  588  -PSPMPNFDEDRTRPGKAVVGWLKIKAAMRWGFFVRKKAAERR  629



>gb|KHN17575.1| hypothetical protein glysoja_005772 [Glycine soja]
Length=627

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 89/106 (84%), Gaps = 3/106 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKG +E+ SEEEIR RSHEMLENEDMQ LLRLFSMGGH S++  EDGF F  FM
Sbjct  518  DWSHNRDKGADEFFSEEEIRFRSHEMLENEDMQQLLRLFSMGGHGSMS-AEDGFSFPSFM  576

Query  562  APSPSF-GYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSPS   YDEDR RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  577  -PSPSIPNYDEDRSRPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  621



>ref|XP_003549493.1| PREDICTED: uncharacterized protein LOC100803029 isoform X1 [Glycine 
max]
 ref|XP_006600498.1| PREDICTED: uncharacterized protein LOC100803029 isoform X2 [Glycine 
max]
Length=627

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 89/106 (84%), Gaps = 3/106 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKG +E+ SEEEIR RSHEMLENEDMQ LLRLFSMGGH S++  EDGF F  FM
Sbjct  518  DWSHNRDKGADEFFSEEEIRFRSHEMLENEDMQQLLRLFSMGGHGSMS-AEDGFSFPSFM  576

Query  562  APSPSF-GYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSPS   YDEDR RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  577  -PSPSIPNYDEDRSRPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  621



>gb|KJB83411.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
 gb|KJB83412.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
 gb|KJB83413.1| hypothetical protein B456_013G246400 [Gossypium raimondii]
Length=644

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 95/107 (89%), Gaps = 3/107 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTPF  566
            DW+N  DKGVE++LSEEEIR+RS+EMLENE+MQHLLRLF+MGG+AS+N+ ED G+GF  +
Sbjct  529  DWTNNHDKGVEDFLSEEEIRVRSNEMLENEEMQHLLRLFNMGGNASINMTEDSGYGFPNY  588

Query  565  M-APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +P P+F  DEDR R GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  589  IPSPMPNF-VDEDRSRSGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  634



>ref|XP_004146305.1| PREDICTED: uncharacterized protein LOC101216741 [Cucumis sativus]
 ref|XP_004165695.1| PREDICTED: uncharacterized LOC101216741 [Cucumis sativus]
 gb|KGN65434.1| hypothetical protein Csa_1G422430 [Cucumis sativus]
Length=636

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWSN RDKGV+++ SE+EIR+RSHEMLENEDMQ LLR+FSMGGHASVN  ++GF F  FM
Sbjct  527  DWSNNRDKGVDDFFSEDEIRMRSHEMLENEDMQQLLRMFSMGGHASVNGHDEGFSFPSFM  586

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   +D DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  587  -PSPMPNFD-DRNRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAQ  629



>ref|XP_003542171.1| PREDICTED: uncharacterized protein LOC100790087 isoform X1 [Glycine 
max]
 ref|XP_006593544.1| PREDICTED: uncharacterized protein LOC100790087 isoform X2 [Glycine 
max]
Length=631

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 89/106 (84%), Gaps = 3/106 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKG +E+ SEEEIR RSHEMLENEDMQ LLRLFSMGG+ S++  EDG+ F  FM
Sbjct  522  DWSHNRDKGADEFFSEEEIRFRSHEMLENEDMQQLLRLFSMGGNGSMS-AEDGYSFPSFM  580

Query  562  APSPSF-GYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSPS   YDEDR RPG+AVVGWLKIKAAMRWGFFIRK AAERRAQ
Sbjct  581  -PSPSIPNYDEDRSRPGRAVVGWLKIKAAMRWGFFIRKIAAERRAQ  625



>ref|XP_002270522.1| PREDICTED: uncharacterized protein LOC100264980 isoform X1 [Vitis 
vinifera]
Length=642

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            D  N RDKGV++Y +EEEIRLRSHEMLE++DMQ LLR+FSMGGH    IP+DG+GF P+M
Sbjct  533  DLLNNRDKGVDDYFTEEEIRLRSHEMLESDDMQQLLRVFSMGGHI---IPDDGYGFPPYM  589

Query  562  A-PSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            A PS     +EDR RPGKAVVGWLKIKAAMRWGFFIRKKAAE+RAQ
Sbjct  590  ASPSNCLYEEEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAEKRAQ  635



>emb|CBI17793.3| unnamed protein product [Vitis vinifera]
Length=628

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            D  N RDKGV++Y +EEEIRLRSHEMLE++DMQ LLR+FSMGGH    IP+DG+GF P+M
Sbjct  519  DLLNNRDKGVDDYFTEEEIRLRSHEMLESDDMQQLLRVFSMGGHI---IPDDGYGFPPYM  575

Query  562  A-PSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            A PS     +EDR RPGKAVVGWLKIKAAMRWGFFIRKKAAE+RAQ
Sbjct  576  ASPSNCLYEEEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAEKRAQ  621



>ref|XP_010656822.1| PREDICTED: uncharacterized protein LOC100264980 isoform X2 [Vitis 
vinifera]
Length=573

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 4/106 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            D  N RDKGV++Y +EEEIRLRSHEMLE++DMQ LLR+FSMGGH    IP+DG+GF P+M
Sbjct  464  DLLNNRDKGVDDYFTEEEIRLRSHEMLESDDMQQLLRVFSMGGHI---IPDDGYGFPPYM  520

Query  562  A-PSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            A PS     +EDR RPGKAVVGWLKIKAAMRWGFFIRKKAAE+RAQ
Sbjct  521  ASPSNCLYEEEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAEKRAQ  566



>gb|KHN22715.1| hypothetical protein glysoja_027603 [Glycine soja]
Length=631

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 89/106 (84%), Gaps = 3/106 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKG +E+ SEEEIR RSHEMLENEDMQ LLRLFSMGG+ S++  EDG+ F  FM
Sbjct  522  DWSHNRDKGADEFFSEEEIRFRSHEMLENEDMQQLLRLFSMGGNGSMS-AEDGYSFPSFM  580

Query  562  APSPSF-GYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSPS   YDEDR RPG+AVVGWLKIKAA+RWGFFIRK AAERRAQ
Sbjct  581  -PSPSIPNYDEDRSRPGRAVVGWLKIKAALRWGFFIRKIAAERRAQ  625



>gb|EYU20920.1| hypothetical protein MIMGU_mgv1a002870mg [Erythranthe guttata]
Length=629

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 3/108 (3%)
 Frame = -3

Query  742  DWS-NTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH-ASVNIPEDGFGFTP  569
            DWS N  +KG++++LSE+EIR+RSHEMLENEDMQHLLRLFSMGG+ ASV+ PEDGF F  
Sbjct  515  DWSTNHNNKGIDDFLSEDEIRMRSHEMLENEDMQHLLRLFSMGGNNASVSGPEDGFSFPS  574

Query  568  FM-APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +M +PSP F + EDR R GKAV GWLKIKAAMRWG FIRKKAAERRA+
Sbjct  575  YMPSPSPGFSFGEDRARSGKAVAGWLKIKAAMRWGIFIRKKAAERRAR  622



>ref|XP_010265456.1| PREDICTED: uncharacterized protein LOC104603183 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265457.1| PREDICTED: uncharacterized protein LOC104603183 isoform X1 [Nelumbo 
nucifera]
Length=645

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = -3

Query  742  DWSNTRDKG-VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTP  569
            DW + R+ G VE + SEEEIR+RSHEMLENEDMQHLLR+FSMGGHA+V++P+D G+ ++ 
Sbjct  532  DWPHNRENGGVEGFFSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAAVSVPDDGGYSYSY  591

Query  568  FMAPSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +PSP+F +DEDR RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  592  MPSPSPNFSFDEDRSRPSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  639



>ref|XP_009388351.1| PREDICTED: uncharacterized protein LOC103975166 [Musa acuminata 
subsp. malaccensis]
Length=327

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF  566
            DWS  +D + ++++ SEEEIRLRSHEMLENEDMQHLLR F+MGG ASV +PEDG+GF P+
Sbjct  214  DWSGQQDSRCMDDFFSEEEIRLRSHEMLENEDMQHLLRTFTMGG-ASVGLPEDGYGFPPY  272

Query  565  M-APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRA  431
            M +P P+F +D++R R  GKAVVGWLKIKAAMRWG F+RKKAAERRA
Sbjct  273  MPSPCPNFNFDDERNRSSGKAVVGWLKIKAAMRWGIFVRKKAAERRA  319



>ref|XP_010265458.1| PREDICTED: uncharacterized protein LOC104603183 isoform X2 [Nelumbo 
nucifera]
Length=642

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = -3

Query  742  DWSNTRDKG-VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTP  569
            DW + R+ G VE + SEEEIR+RSHEMLENEDMQHLLR+FSMGGHA+V++P+D G+ ++ 
Sbjct  529  DWPHNRENGGVEGFFSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAAVSVPDDGGYSYSY  588

Query  568  FMAPSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +PSP+F +DEDR RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  589  MPSPSPNFSFDEDRSRPSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  636



>ref|XP_010265459.1| PREDICTED: uncharacterized protein LOC104603183 isoform X3 [Nelumbo 
nucifera]
Length=595

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = -3

Query  742  DWSNTRDKG-VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTP  569
            DW + R+ G VE + SEEEIR+RSHEMLENEDMQHLLR+FSMGGHA+V++P+D G+ ++ 
Sbjct  482  DWPHNRENGGVEGFFSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAAVSVPDDGGYSYSY  541

Query  568  FMAPSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +PSP+F +DEDR RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  542  MPSPSPNFSFDEDRSRPSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  589



>ref|XP_010265460.1| PREDICTED: uncharacterized protein LOC104603183 isoform X4 [Nelumbo 
nucifera]
Length=592

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 93/108 (86%), Gaps = 3/108 (3%)
 Frame = -3

Query  742  DWSNTRDKG-VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPED-GFGFTP  569
            DW + R+ G VE + SEEEIR+RSHEMLENEDMQHLLR+FSMGGHA+V++P+D G+ ++ 
Sbjct  479  DWPHNRENGGVEGFFSEEEIRMRSHEMLENEDMQHLLRIFSMGGHAAVSVPDDGGYSYSY  538

Query  568  FMAPSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +PSP+F +DEDR RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  539  MPSPSPNFSFDEDRSRPSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  586



>ref|XP_006401191.1| hypothetical protein EUTSA_v10012939mg [Eutrema salsugineum]
 gb|ESQ42644.1| hypothetical protein EUTSA_v10012939mg [Eutrema salsugineum]
Length=642

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 3/107 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTP  569
            DWSN R++G EE+ SEEEIRLRSHEMLENEDMQ  LRLFSMGG   ++ ++PEDG+ F  
Sbjct  527  DWSNHRERGAEEFFSEEEIRLRSHEMLENEDMQQFLRLFSMGGGNGSATHLPEDGYTFPS  586

Query  568  FMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  587  FLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  632



>gb|EYU20919.1| hypothetical protein MIMGU_mgv1a002870mg [Erythranthe guttata]
Length=611

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH-ASVNIPEDGFGFTPF  566
            D +   +KG++++LSE+EIR+RSHEMLENEDMQHLLRLFSMGG+ ASV+ PEDGF F  +
Sbjct  498  DPTTYDNKGIDDFLSEDEIRMRSHEMLENEDMQHLLRLFSMGGNNASVSGPEDGFSFPSY  557

Query  565  M-APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            M +PSP F + EDR R GKAV GWLKIKAAMRWG FIRKKAAERRA+
Sbjct  558  MPSPSPGFSFGEDRARSGKAVAGWLKIKAAMRWGIFIRKKAAERRAR  604



>gb|AAN65367.1| calmodulin-binding protein 60-A [Phaseolus vulgaris]
Length=101

 Score =   142 bits (358),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 84/97 (87%), Gaps = 4/97 (4%)
 Frame = -3

Query  712  EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-HASVNIPEDGFGFTPFMAPSPSF-GY  539
            +E+ SEEEIRLRSHEMLENEDMQHLLRLFSMGG H S+++ EDG+ F  FM PSP+   Y
Sbjct  1    DEFFSEEEIRLRSHEMLENEDMQHLLRLFSMGGGHGSMSV-EDGYSFPTFM-PSPNVPNY  58

Query  538  DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            DEDR RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  59   DEDRSRPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  95



>ref|XP_006281432.1| hypothetical protein CARUB_v10027506mg [Capsella rubella]
 gb|EOA14330.1| hypothetical protein CARUB_v10027506mg [Capsella rubella]
Length=651

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH---ASVNIPEDGFGFT  572
            DWSN R++G E++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F 
Sbjct  533  DWSNHRERGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTFP  592

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  593  SFLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  639



>ref|XP_002866219.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42478.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=646

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 89/108 (82%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH---ASVNIPEDGFGFT  572
            DWSN R++G E++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F 
Sbjct  527  DWSNPRERGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTFP  586

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  587  SFLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  633



>ref|XP_010259794.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
 ref|XP_010259795.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
 ref|XP_010259796.1| PREDICTED: uncharacterized protein LOC104599111 [Nelumbo nucifera]
Length=644

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 92/108 (85%), Gaps = 3/108 (3%)
 Frame = -3

Query  742  DWSNTRDKG-VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF  566
            DWS++R+ G V+ + SEEEIR+RSHEMLENEDMQHLLR+FSMGG  ++NI E+G+ +  +
Sbjct  531  DWSHSRENGGVDGFFSEEEIRMRSHEMLENEDMQHLLRIFSMGGQTAINISEEGYSYPSY  590

Query  565  M-APSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +P+P+ G+DEDR R  GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  591  IPSPTPNLGFDEDRSRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  638



>ref|NP_200566.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAB08793.1| calmodulin-binding protein [Arabidopsis thaliana]
 gb|AAL07138.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AAM14373.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AED96923.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=647

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH---ASVNIPEDGFGFT  572
            DWSN R++G +++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F 
Sbjct  529  DWSNPRERGPDDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTFP  588

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  589  SFLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  635



>ref|XP_010452498.1| PREDICTED: uncharacterized protein LOC104734591 [Camelina sativa]
 ref|XP_010452506.1| PREDICTED: uncharacterized protein LOC104734591 [Camelina sativa]
Length=659

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 90/109 (83%), Gaps = 5/109 (5%)
 Frame = -3

Query  742  DWSNTRDK-GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH---ASVNIPEDGFGF  575
            DWSN+R++ G E++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F
Sbjct  540  DWSNSRERVGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTF  599

Query  574  TPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  600  PSFLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  647



>ref|XP_004507834.1| PREDICTED: uncharacterized protein LOC101488801 isoform X4 [Cicer 
arietinum]
Length=625

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKGV+++ SE+EIR+RS+E+LENEDMQHLLRLFSMGGHAS+N  EDG+   P  
Sbjct  517  DWSHNRDKGVDDFFSEDEIRVRSNEILENEDMQHLLRLFSMGGHASMNT-EDGY-SFPPF  574

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   +DEDR RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  575  MPSPMPNFDEDRTRPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  619



>ref|XP_004507832.1| PREDICTED: uncharacterized protein LOC101488801 isoform X2 [Cicer 
arietinum]
 ref|XP_004507833.1| PREDICTED: uncharacterized protein LOC101488801 isoform X3 [Cicer 
arietinum]
Length=635

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKGV+++ SE+EIR+RS+E+LENEDMQHLLRLFSMGGHAS+N  EDG+   P  
Sbjct  527  DWSHNRDKGVDDFFSEDEIRVRSNEILENEDMQHLLRLFSMGGHASMNT-EDGY-SFPPF  584

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   +DEDR RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  585  MPSPMPNFDEDRTRPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  629



>ref|XP_010913644.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
 ref|XP_010913645.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
 ref|XP_010913646.1| PREDICTED: uncharacterized protein LOC105039256 [Elaeis guineensis]
Length=651

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 15/118 (13%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF  566
            DWS  RD +G++++ SEEEIR RSHEMLENEDMQ LLR+FSMGG  +VN+PEDG+ F+ +
Sbjct  530  DWSRQRDSRGIDDFFSEEEIRTRSHEMLENEDMQQLLRVFSMGG--TVNLPEDGYSFSSY  587

Query  565  M-APSPSFGYDEDRPR-----------PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +P P+F +D+DR R            GKAVVGWLKIKAAMRWG FIRKKAAERRAQ
Sbjct  588  VPSPCPNFNFDDDRNRNFNFDEDRNRSSGKAVVGWLKIKAAMRWGIFIRKKAAERRAQ  645



>ref|XP_007225676.1| hypothetical protein PRUPE_ppa002789mg [Prunus persica]
 gb|EMJ26875.1| hypothetical protein PRUPE_ppa002789mg [Prunus persica]
Length=633

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 86/105 (82%), Gaps = 6/105 (6%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+  RD     + SEE+IR+RSHEMLENEDMQHLLR+FSMGGH S+++P+DG+ F    
Sbjct  528  DWTTNRD-----FFSEEDIRIRSHEMLENEDMQHLLRIFSMGGHGSIDVPDDGYSFP-PF  581

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   YDEDR RPGKAVVGWLKIKAAMRWGFF+RKKAAERRAQ
Sbjct  582  MPSPMPSYDEDRNRPGKAVVGWLKIKAAMRWGFFVRKKAAERRAQ  626



>ref|XP_008805417.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
 ref|XP_008805418.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
 ref|XP_008805420.1| PREDICTED: uncharacterized protein LOC103718396 [Phoenix dactylifera]
Length=654

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 92/109 (84%), Gaps = 5/109 (5%)
 Frame = -3

Query  742  DWSNTRD-KGVEEY-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  RD + VE++ LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS +IPED +GF P
Sbjct  541  DWSRQRDVQAVEDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASSSIPEDAYGFPP  599

Query  568  FMA-PSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +++ P P+F +DEDR R  G+AVVGWLKIKAAMRWG FIRKKAAE+RAQ
Sbjct  600  YISSPCPNFNFDEDRSRSSGRAVVGWLKIKAAMRWGIFIRKKAAEKRAQ  648



>ref|XP_008800271.1| PREDICTED: uncharacterized protein LOC103714689 [Phoenix dactylifera]
Length=641

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 7/109 (6%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF  566
            DWS  RD + ++++ SEEEIR+RSHEMLENEDMQ LLR+FSMGG  +VN PEDG+GF+ +
Sbjct  530  DWSRQRDSRRIDDFFSEEEIRMRSHEMLENEDMQQLLRVFSMGG--AVNAPEDGYGFSSY  587

Query  565  MAPSP--SFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             APSP  +F +D+DR R  GKAVVGWLKIKAAMRWG FIRKKAAERRAQ
Sbjct  588  -APSPCQNFNFDDDRSRSSGKAVVGWLKIKAAMRWGIFIRKKAAERRAQ  635



>ref|XP_004507831.1| PREDICTED: uncharacterized protein LOC101488801 isoform X1 [Cicer 
arietinum]
Length=694

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ RDKGV+++ SE+EIR+RS+E+LENEDMQHLLRLFSMGGHAS+N  EDG+ F    
Sbjct  586  DWSHNRDKGVDDFFSEDEIRVRSNEILENEDMQHLLRLFSMGGHASMNT-EDGYSFP-PF  643

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   +DEDR RPG+AVVGWLKIKAAMRWGFFIRK AAE+RAQ
Sbjct  644  MPSPMPNFDEDRTRPGRAVVGWLKIKAAMRWGFFIRKIAAEKRAQ  688



>ref|XP_010483282.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483283.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483284.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483285.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483286.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
 ref|XP_010483287.1| PREDICTED: uncharacterized protein LOC104761843 [Camelina sativa]
Length=659

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 89/109 (82%), Gaps = 5/109 (5%)
 Frame = -3

Query  742  DWSNTRDKG-VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH---ASVNIPEDGFGF  575
            DWSN R++G  E++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F
Sbjct  540  DWSNPRERGGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTF  599

Query  574  TPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  600  PSFLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  647



>ref|XP_008808337.1| PREDICTED: uncharacterized protein LOC103720426 [Phoenix dactylifera]
Length=641

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 92/109 (84%), Gaps = 5/109 (5%)
 Frame = -3

Query  742  DWSNTRD-KGVEEY-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  RD + VE++ LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS ++PEDG+GF  
Sbjct  528  DWSRQRDVQAVEDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASSSVPEDGYGFPS  586

Query  568  FM-APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            ++ +P P+F +DEDR R  G+AVVGWLKIKAAMRWG FIRKKAAERRAQ
Sbjct  587  YIPSPCPNFNFDEDRNRSSGRAVVGWLKIKAAMRWGIFIRKKAAERRAQ  635



>ref|XP_010914125.1| PREDICTED: uncharacterized protein LOC105039615 [Elaeis guineensis]
 ref|XP_010914126.1| PREDICTED: uncharacterized protein LOC105039615 [Elaeis guineensis]
Length=638

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 5/109 (5%)
 Frame = -3

Query  742  DWSNTRD-KGVEEY-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  RD + VE++ LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS +IPED +GF  
Sbjct  525  DWSRQRDIQAVEDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASASIPEDTYGFQS  583

Query  568  FMA-PSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +++ P PSF +DEDR R  G+AVVGWLKIKAAMRWG FIRKKAAE+RAQ
Sbjct  584  YISSPCPSFNFDEDRSRSSGRAVVGWLKIKAAMRWGIFIRKKAAEKRAQ  632



>emb|CDY69506.1| BnaCnng63910D [Brassica napus]
Length=654

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 88/111 (79%), Gaps = 7/111 (6%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH------ASVNIPEDGF  581
            DWSN R++G EE+ SEEEIRLRSHEMLENEDMQ  LRLFSMGG       ++ ++ EDG+
Sbjct  535  DWSNHRERGAEEFFSEEEIRLRSHEMLENEDMQQFLRLFSMGGGGGGGNGSASHLQEDGY  594

Query  580  GFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F  F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  595  TFPSFLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  644



>ref|XP_009120276.1| PREDICTED: uncharacterized protein LOC103845193 [Brassica rapa]
Length=654

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 88/111 (79%), Gaps = 7/111 (6%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH------ASVNIPEDGF  581
            DWSN R++G EE+ SEEEIRLRSHEMLENEDMQ  LRLFSMGG       ++ ++ EDG+
Sbjct  535  DWSNHRERGAEEFFSEEEIRLRSHEMLENEDMQQFLRLFSMGGGGGGGNGSASHLQEDGY  594

Query  580  GFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F  F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  595  TFPSFLH-TPMQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  644



>emb|CDY49721.1| BnaA10g11510D [Brassica napus]
Length=654

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 88/111 (79%), Gaps = 7/111 (6%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH------ASVNIPEDGF  581
            DWSN R++G EE+ SEEEIRLRSHEMLENEDMQ  LRLFSMGG       ++ ++ EDG+
Sbjct  535  DWSNHRERGAEEFFSEEEIRLRSHEMLENEDMQQFLRLFSMGGGGGGGNGSASHLQEDGY  594

Query  580  GFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F  F+  +P  GYDEDR R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  595  TFPSFLH-TPLQGYDEDRGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  644



>ref|XP_010443447.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
 ref|XP_010443448.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
 ref|XP_010443449.1| PREDICTED: uncharacterized protein LOC104726314 [Camelina sativa]
Length=659

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 89/109 (82%), Gaps = 5/109 (5%)
 Frame = -3

Query  742  DWSNTRDKG-VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH---ASVNIPEDGFGF  575
            DWSN R++G  E++ SEEEIRLRSHEMLE+EDMQ  LRLFSMGG    ++ ++PEDG+ F
Sbjct  540  DWSNPRERGGPEDFFSEEEIRLRSHEMLESEDMQQFLRLFSMGGGGNGSATHLPEDGYTF  599

Query  574  TPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              F+  +P  GYDE+R R G+AVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  600  PSFLH-TPMQGYDEERGRSGRAVVGWLKIKAAMRWGFFIRRKAAERRAQ  647



>gb|AAL11615.1|AF424622_1 At2g18750/MSF3.13 [Arabidopsis thaliana]
 gb|AAN28789.1| At2g18750/MSF3.13 [Arabidopsis thaliana]
Length=315

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFT  572
            DWSNT ++GV+ +LSEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ ED FGF 
Sbjct  200  DWSNTCNRGVDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTPLNMGEDSFGFH  259

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F   S +  Y+EDR   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  260  SFGQTSMA-DYEEDRSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  306



>ref|XP_010929241.1| PREDICTED: uncharacterized protein LOC105050786 isoform X2 [Elaeis 
guineensis]
Length=640

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 92/109 (84%), Gaps = 5/109 (5%)
 Frame = -3

Query  742  DWSNTRD-KGVEEY-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  RD + VE++ LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS ++PEDG+GF  
Sbjct  527  DWSRQRDVQAVEDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASTSVPEDGYGFPS  585

Query  568  FM-APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            ++ +P P+F +DEDR R  G+AVVGWLKIKAAMRWG FIRK+AA+RRAQ
Sbjct  586  YIPSPCPNFNFDEDRNRSSGRAVVGWLKIKAAMRWGIFIRKRAAQRRAQ  634



>ref|XP_010929240.1| PREDICTED: uncharacterized protein LOC105050786 isoform X1 [Elaeis 
guineensis]
Length=653

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 92/109 (84%), Gaps = 5/109 (5%)
 Frame = -3

Query  742  DWSNTRD-KGVEEY-LSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  RD + VE++ LSEEEIR+RSHE+LENE+MQ LLR+FSMGG AS ++PEDG+GF  
Sbjct  540  DWSRQRDVQAVEDFNLSEEEIRMRSHEILENEEMQQLLRVFSMGG-ASTSVPEDGYGFPS  598

Query  568  FM-APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            ++ +P P+F +DEDR R  G+AVVGWLKIKAAMRWG FIRK+AA+RRAQ
Sbjct  599  YIPSPCPNFNFDEDRNRSSGRAVVGWLKIKAAMRWGIFIRKRAAQRRAQ  647



>ref|XP_010489590.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
 ref|XP_010489591.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
 ref|XP_010489592.1| PREDICTED: uncharacterized protein LOC104767243 [Camelina sativa]
Length=624

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFT  572
            DWSNT ++GV+ +LSEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF 
Sbjct  508  DWSNTCNRGVDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTQMNMGEDGFGFH  567

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F   S +  Y+EDR   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  568  TFGETSMA-DYEEDRSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  614



>ref|XP_010467708.1| PREDICTED: uncharacterized protein LOC104747723 [Camelina sativa]
 ref|XP_010467709.1| PREDICTED: uncharacterized protein LOC104747723 [Camelina sativa]
Length=629

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFT  572
            DWSNT ++GV+ +LSEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF 
Sbjct  513  DWSNTCNRGVDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTQMNMGEDGFGFH  572

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F   S +  Y+EDR   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  573  SFGETSMA-DYEEDRSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  619



>ref|XP_006297211.1| hypothetical protein CARUB_v10013220mg [Capsella rubella]
 gb|EOA30109.1| hypothetical protein CARUB_v10013220mg [Capsella rubella]
Length=624

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFT  572
            DWSNT ++GV+ +LSEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF 
Sbjct  508  DWSNTCNRGVDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTPMNMGEDGFGFH  567

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F   S +  Y+EDR   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  568  SFGQTSMA-DYEEDRSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  614



>gb|AFW71858.1| hypothetical protein ZEAMMB73_193945 [Zea mays]
Length=173

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 4/103 (4%)
 Frame = -3

Query  730  TRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APS  554
             R  GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  ++ EDGF F P+M APS
Sbjct  67   NRGGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AGTSLAEDGFNFPPYMPAPS  124

Query  553  PSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            P+  Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  125  PNVSYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  167



>ref|XP_010414641.1| PREDICTED: uncharacterized protein LOC104700762 [Camelina sativa]
 ref|XP_010414649.1| PREDICTED: uncharacterized protein LOC104700762 [Camelina sativa]
Length=624

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFT  572
            DWSNT ++GV+ +LSEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF 
Sbjct  508  DWSNTCNRGVDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGEQQTPMNMGEDGFGFH  567

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F   S +  Y+EDR   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  568  SFGETSMA-DYEEDRSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  614



>ref|XP_002886266.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62525.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=621

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFT  572
            DWSNT ++GV+ +LSEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ EDGFGF 
Sbjct  506  DWSNTCNRGVDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTPMNMGEDGFGFH  565

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F   +    Y+EDR   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  566  SF-GQTAIADYEEDRSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  612



>ref|XP_010536924.1| PREDICTED: uncharacterized protein LOC104811802 [Tarenaya hassleriana]
Length=646

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 86/108 (80%), Gaps = 5/108 (5%)
 Frame = -3

Query  742  DWSNTRDKGV-EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDG--FGFT  572
            +WSN R++G  +++ SEEEIR RSHEMLENEDMQ LLRLFSMGG+   ++ EDG  F F 
Sbjct  529  EWSNHRERGGGDDFFSEEEIRSRSHEMLENEDMQQLLRLFSMGGN--THVAEDGGLFSFP  586

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             FM  +P   ++EDR R GKAVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  587  SFMQQTPMQSFEEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAQ  634



>ref|NP_565441.2| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001031372.1| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001189550.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAH30392.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06802.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEC06803.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEC06804.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=622

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFT  572
            DWSNT ++GV+ +LSEEEIR RS+EMLEN+DMQ LLRLFSM G      +N+ ED FGF 
Sbjct  507  DWSNTCNRGVDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGDQQTPLNMGEDSFGFH  566

Query  571  PFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             F   S +  Y+EDR   GKAVVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  567  SFGQTSMA-DYEEDRSNSGKAVVGWLKIKAAMRWGFFIRRKAAQRRAQ  613



>gb|AFW62647.1| hypothetical protein ZEAMMB73_771415 [Zea mays]
Length=222

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 4/99 (4%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFG  542
            GV++YL EE IR+RSHE+LENE+MQ +LRL S GG A  N+ EDGF F  +M APSP   
Sbjct  120  GVDDYLMEE-IRMRSHEILENEEMQQMLRLLSTGG-AGTNLTEDGFSFPSYMPAPSPKLS  177

Query  541  YDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  178  YEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  216



>ref|XP_009398635.1| PREDICTED: uncharacterized protein LOC103983171 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398636.1| PREDICTED: uncharacterized protein LOC103983171 [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 88/107 (82%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF  566
            DWS  RD +G++++ SE+EIRLRSHE+LE++DMQHLLR+F+MGG A   + +DG+ F  +
Sbjct  542  DWSRQRDSRGIDDFFSEDEIRLRSHELLEHDDMQHLLRVFTMGG-APTGLHDDGYAFPSY  600

Query  565  M-APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRA  431
            M +P P+F +D+DR R  GKAVVGWLKIKAAMRWG F+RKKAAERRA
Sbjct  601  MPSPCPAFNFDDDRSRTSGKAVVGWLKIKAAMRWGIFVRKKAAERRA  647



>dbj|BAJ94992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=653

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 91/107 (85%), Gaps = 5/107 (5%)
 Frame = -3

Query  739  WSNTR-DKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            WS+ + ++GV++YL EE IRLRSHE+LEN++MQ +LR+ +MGG AS N+ +DGF F P+M
Sbjct  543  WSHPQENRGVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-ASTNMTDDGFTFPPYM  600

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +PSP+F +++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  601  ESPSPNFNFEDDRTRPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  647



>ref|XP_008645829.1| PREDICTED: uncharacterized protein LOC103627307 isoform X2 [Zea 
mays]
Length=650

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 4/103 (4%)
 Frame = -3

Query  730  TRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APS  554
             R  GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  ++ EDGF F P+M APS
Sbjct  544  NRGGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AGTSLAEDGFNFPPYMPAPS  601

Query  553  PSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            P+  Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  602  PNVSYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  644



>ref|XP_008645828.1| PREDICTED: uncharacterized protein LOC103627307 isoform X1 [Zea 
mays]
 gb|AFW71857.1| hypothetical protein ZEAMMB73_193945 [Zea mays]
Length=651

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 4/103 (4%)
 Frame = -3

Query  730  TRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APS  554
             R  GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  ++ EDGF F P+M APS
Sbjct  545  NRGGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AGTSLAEDGFNFPPYMPAPS  602

Query  553  PSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            P+  Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  603  PNVSYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  645



>ref|XP_009589610.1| PREDICTED: uncharacterized protein LOC104086953 [Nicotiana tomentosiformis]
Length=619

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 84/102 (82%), Gaps = 4/102 (4%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG-GHASVNIPEDGFGFTPFMAP--SP  551
            +G E++L+EEEIR+RSHEMLENEDMQHLLR+FSMG GHAS ++ E+ + +     P  S 
Sbjct  511  RGAEDFLTEEEIRMRSHEMLENEDMQHLLRIFSMGQGHASSSVGEENYQYGSSYMPNMSS  570

Query  550  SFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +FG+DEDR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  571  TFGFDEDRTRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  612



>ref|XP_009606926.1| PREDICTED: uncharacterized protein LOC104101191 isoform X1 [Nicotiana 
tomentosiformis]
Length=581

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 82/102 (80%), Gaps = 4/102 (4%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS  548
            KG +++ +EEEIR+RSHEMLENEDMQHLLR+F+MGG  HAS +  ED + + P   PS S
Sbjct  473  KGTDDFFAEEEIRMRSHEMLENEDMQHLLRIFNMGGQNHASSSNTEDNYPYGPSYMPSMS  532

Query  547  --FGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +G+ EDR R GKAVVGWLK+KAA+RWG FIRKKAAE+RAQ
Sbjct  533  STYGFQEDRTRSGKAVVGWLKLKAALRWGIFIRKKAAEKRAQ  574



>gb|AGT16661.1| hypothetical protein SHCRBa_107_F16_R_30 [Saccharum hybrid cultivar 
R570]
Length=649

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 82/99 (83%), Gaps = 4/99 (4%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFG  542
            GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  N+ EDGF F  +M APSP+  
Sbjct  547  GVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AGTNLTEDGFNFPSYMPAPSPNLS  604

Query  541  YDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  605  YEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  643



>ref|XP_010092630.1| hypothetical protein L484_006392 [Morus notabilis]
 gb|EXB51819.1| hypothetical protein L484_006392 [Morus notabilis]
Length=650

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASV-NIPEDGFGFTPFMAPSPSF  545
            +GV+++ SEEEIR+RSHEMLENEDMQHLL +F+MGGH  V N+ EDG+ ++    P+ S 
Sbjct  543  RGVDDFFSEEEIRMRSHEMLENEDMQHLLHIFNMGGHGHVPNVVEDGYPYSSGYMPNTSL  602

Query  544  GY--DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             Y  ++DR R GKAVVGWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  603  NYNLNDDRTRSGKAVVGWLKLKAALRWGIFVRKRAAERRAQ  643



>ref|XP_009606927.1| PREDICTED: uncharacterized protein LOC104101191 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 82/102 (80%), Gaps = 4/102 (4%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS  548
            KG +++ +EEEIR+RSHEMLENEDMQHLLR+F+MGG  HAS +  ED + + P   PS S
Sbjct  518  KGTDDFFAEEEIRMRSHEMLENEDMQHLLRIFNMGGQNHASSSNTEDNYPYGPSYMPSMS  577

Query  547  --FGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +G+ EDR R GKAVVGWLK+KAA+RWG FIRKKAAE+RAQ
Sbjct  578  STYGFQEDRTRSGKAVVGWLKLKAALRWGIFIRKKAAEKRAQ  619



>ref|XP_004232807.1| PREDICTED: uncharacterized protein LOC101255950 [Solanum lycopersicum]
Length=621

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 84/102 (82%), Gaps = 4/102 (4%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG-GHASVNIPEDGFGFTPFMAPSPS-  548
            KG E++L+EEEIR++SHEMLENEDMQHLLR+FSMG GHAS ++ E+ + +     PS S 
Sbjct  513  KGAEDFLTEEEIRMKSHEMLENEDMQHLLRMFSMGQGHASSSVAEENYQYGSAYMPSMSS  572

Query  547  -FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             FG+DE+R R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  573  NFGFDEERTRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  614



>gb|ABK95891.1| unknown [Populus trichocarpa]
Length=326

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM-APSPS  548
            G E+Y SEEEIR RSHEMLENEDMQ+LLR F MGG   +S N+ EDG+ ++ +M  PSPS
Sbjct  219  GTEDYFSEEEIRTRSHEMLENEDMQNLLRGFHMGGQGPSSFNVTEDGYPYSSYMPCPSPS  278

Query  547  FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +++D  R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  279  YCFEDDPSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  319



>ref|XP_006347126.1| PREDICTED: uncharacterized protein LOC102591443 [Solanum tuberosum]
Length=621

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 84/102 (82%), Gaps = 4/102 (4%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG-GHASVNIPEDGFGFTPFMAP--SP  551
            KG E++L+EEEIR++SHEMLENEDMQHLLR+FSMG GHAS ++ E+ + +     P  S 
Sbjct  513  KGAEDFLTEEEIRMKSHEMLENEDMQHLLRMFSMGQGHASSSVAEENYQYGSAYMPNMSS  572

Query  550  SFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +FG+DE+R R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  573  NFGFDEERTRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  614



>emb|CAD40976.1| OSJNBa0027P08.1 [Oryza sativa Japonica Group]
Length=143

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 8/110 (7%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENE-DMQHLLRLFSMGGHASVNIPEDGFGFT  572
            DWS  ++   GV++YL EE IR+RSHE+LENE DMQ +LR+ SMGG +S N+   G GF+
Sbjct  31   DWSRLQENRGGVDDYLMEE-IRVRSHEILENEEDMQQMLRILSMGG-SSANM-NHGDGFS  87

Query  571  PFM-APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            PFM +P+P+F Y++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  88   PFMPSPAPAFNYEDDRARPSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  137



>ref|XP_010525739.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104803505 
[Tarenaya hassleriana]
Length=636

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 4/96 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWSNT ++G EE+LSEEEIR RS+E+LEN+DMQ LLRLFSMG   + N+P+DG+GF  F+
Sbjct  526  DWSNTHERGAEEFLSEEEIRARSNEILENDDMQQLLRLFSMGDQQASNVPDDGYGFHSFI  585

Query  562  -APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFI  458
             +P P+F   EDR + GKAVVGWLKIKAAMRWGFF+
Sbjct  586  HSPMPNF---EDRTQSGKAVVGWLKIKAAMRWGFFV  618



>ref|XP_004952753.1| PREDICTED: uncharacterized protein LOC101756263 isoform X1 [Setaria 
italica]
 ref|XP_004952754.1| PREDICTED: uncharacterized protein LOC101756263 isoform X2 [Setaria 
italica]
Length=649

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 87/109 (80%), Gaps = 6/109 (6%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            +WS  ++   GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG A  N+ EDGF F  
Sbjct  537  EWSQPQENRGGVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-AGTNLTEDGFNFPS  594

Query  568  FM-APSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +M APSP+  +++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  595  YMPAPSPNLNFEDDRTRTPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  643



>ref|XP_004952755.1| PREDICTED: uncharacterized protein LOC101756263 isoform X3 [Setaria 
italica]
Length=648

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 87/109 (80%), Gaps = 6/109 (6%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            +WS  ++   GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG A  N+ EDGF F  
Sbjct  536  EWSQPQENRGGVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-AGTNLTEDGFNFPS  593

Query  568  FM-APSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +M APSP+  +++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  594  YMPAPSPNLNFEDDRTRTPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  642



>ref|XP_002452291.1| hypothetical protein SORBIDRAFT_04g023100 [Sorghum bicolor]
 gb|EES05267.1| hypothetical protein SORBIDRAFT_04g023100 [Sorghum bicolor]
Length=650

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 4/99 (4%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFG  542
            GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  N+ ED F F  +M APSP+  
Sbjct  548  GVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AGTNLTEDAFNFPSYMPAPSPNLS  605

Query  541  YDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  606  YEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  644



>ref|XP_010688497.1| PREDICTED: uncharacterized protein LOC104902420 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688498.1| PREDICTED: uncharacterized protein LOC104902420 [Beta vulgaris 
subsp. vulgaris]
Length=645

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 12/108 (11%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS+ +       +SE+EIR RSHE+LE++DMQ LLRLFSMGGH  VN+P++ F   P  
Sbjct  541  DWSHNQ-------ISEDEIRNRSHELLESDDMQQLLRLFSMGGH--VNMPDETFSSFPSF  591

Query  562  APSPSF---GYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             P+PS     ++EDR RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ
Sbjct  592  MPTPSNYNNSFEEDRSRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  639



>ref|XP_009794879.1| PREDICTED: uncharacterized protein LOC104241635 [Nicotiana sylvestris]
Length=621

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 7/103 (7%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG-GHASVNIPED---GFGFTPFMAPS  554
            KG E++L+EEEIR+RSHEMLENEDMQHLLR+FSMG GHAS    E+   G  + P M  S
Sbjct  514  KGAEDFLTEEEIRMRSHEMLENEDMQHLLRIFSMGQGHASSRGEENYQYGSSYMPNM--S  571

Query  553  PSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +FG+DEDR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  572  STFGFDEDRTRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  614



>ref|XP_006647388.1| PREDICTED: uncharacterized protein LOC102720488 isoform X1 [Oryza 
brachyantha]
Length=655

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 86/109 (79%), Gaps = 6/109 (6%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  ++   GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG AS N+ EDGF F  
Sbjct  543  DWSQPQENRSGVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-ASTNLTEDGFSFPN  600

Query  568  FMAPSP-SFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +M  +P +F Y +DR RP G+AVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  601  YMPSTPPNFNYADDRARPSGRAVVGWLKIKAAMRWGIFVRKKAAERRAQ  649



>ref|XP_006647389.1| PREDICTED: uncharacterized protein LOC102720488 isoform X2 [Oryza 
brachyantha]
Length=654

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 86/109 (79%), Gaps = 6/109 (6%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  ++   GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG AS N+ EDGF F  
Sbjct  542  DWSQPQENRSGVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-ASTNLTEDGFSFPN  599

Query  568  FMAPSP-SFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +M  +P +F Y +DR RP G+AVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  600  YMPSTPPNFNYADDRARPSGRAVVGWLKIKAAMRWGIFVRKKAAERRAQ  648



>emb|CAB71126.1| calmodulin-binding protein [Cicer arietinum]
Length=282

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 79/102 (77%), Gaps = 5/102 (5%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS  548
            +G E++  EE+IR+RSHEMLENEDMQHLLR+F+MGG  H+S N PEDG+ ++    P+ S
Sbjct  173  RGFEDFFPEEDIRMRSHEMLENEDMQHLLRIFNMGGQSHSSFNAPEDGYPYSSPYMPATS  232

Query  547  FGYDEDRPR---PGKAVVGWLKIKAAMRWGFFIRKKAAERRA  431
              Y+ D  R    GKAVVGWLK+KAA+RWG F+RKKAAERRA
Sbjct  233  INYNMDDERNRSSGKAVVGWLKLKAALRWGIFVRKKAAERRA  274



>ref|XP_008678706.1| PREDICTED: uncharacterized protein LOC103653644 [Zea mays]
 gb|AFW62646.1| hypothetical protein ZEAMMB73_771415 [Zea mays]
Length=652

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 4/99 (4%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFG  542
            GV++YL EE IR+RSHE+LENE+MQ +LRL S GG A  N+ EDGF F  +M APSP   
Sbjct  550  GVDDYLMEE-IRMRSHEILENEEMQQMLRLLSTGG-AGTNLTEDGFSFPSYMPAPSPKLS  607

Query  541  YDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  608  YEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>ref|NP_001047151.1| Os02g0562300 [Oryza sativa Japonica Group]
 dbj|BAD16554.1| putative calmodulin-binding protein [Oryza sativa Japonica Group]
 dbj|BAF09065.1| Os02g0562300 [Oryza sativa Japonica Group]
 dbj|BAG93360.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57202.1| hypothetical protein OsJ_07158 [Oryza sativa Japonica Group]
Length=652

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 86/109 (79%), Gaps = 6/109 (6%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  ++   GV++YL EE IR+RSHE+LENE+MQ +LR+ SMGG AS N+ EDGF F  
Sbjct  540  DWSQPQENRSGVDDYLMEE-IRMRSHEILENEEMQQMLRILSMGG-ASTNLTEDGFAFPN  597

Query  568  FMAPSP-SFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +M  +P +F + +DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  598  YMPSTPPNFNFGDDRARPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>ref|XP_007148242.1| hypothetical protein PHAVU_006G191900g [Phaseolus vulgaris]
 gb|ESW20236.1| hypothetical protein PHAVU_006G191900g [Phaseolus vulgaris]
Length=638

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 84/109 (77%), Gaps = 6/109 (6%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPF  566
            SN   +G+E+Y  EEEIR RSHEMLENEDMQ+LLR+F+MGG   HAS N PED + ++  
Sbjct  523  SNPCYRGLEDYFPEEEIRTRSHEMLENEDMQNLLRIFNMGGGQSHASFNTPEDAYPYSST  582

Query  565  MAPSPSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              P+ S GY  D++R R  GKAVVGWLK+KAA+RWG FIRK+AAE+RAQ
Sbjct  583  YMPATSMGYHLDDERNRSSGKAVVGWLKLKAALRWGIFIRKRAAEKRAQ  631



>emb|CAN66517.1| hypothetical protein VITISV_001611 [Vitis vinifera]
Length=637

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 5/101 (5%)
 Frame = -3

Query  715  VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPS--  548
            V+++  E+EIR+RSHEMLEN+DMQHLLR+F+MG  GHAS N+ +DG+ ++    P+ S  
Sbjct  524  VDDFFPEDEIRMRSHEMLENDDMQHLLRIFNMGNHGHASANVTDDGYPYSSAYMPTSSTG  583

Query  547  FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +G+DEDR R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  584  YGFDEDRSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  624



>ref|XP_010646160.1| PREDICTED: uncharacterized protein LOC100256775 [Vitis vinifera]
Length=631

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 5/101 (5%)
 Frame = -3

Query  715  VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPS--  548
            V+++  E+EIR+RSHEMLEN+DMQHLLR+F+MG  GHAS N+ +DG+ ++    P+ S  
Sbjct  524  VDDFFPEDEIRMRSHEMLENDDMQHLLRIFNMGNHGHASANVTDDGYPYSSAYMPTSSTG  583

Query  547  FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +G+DEDR R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  584  YGFDEDRSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  624



>emb|CDY29246.1| BnaA06g25110D [Brassica napus]
Length=625

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 9/113 (8%)
 Frame = -3

Query  742  DWSNTRDKGVEE-YLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-------HASVNIPED  587
            DWSNT ++G  + +LSEEEIR RS+EMLEN+DMQ LLRLFSM G          +N+ ED
Sbjct  506  DWSNTGNRGGGDGFLSEEEIRARSNEMLENDDMQQLLRLFSMSGGGGGGGPQTPMNMGED  565

Query  586  GFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            GFGF  F   S   GY EDR +PGK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  566  GFGFQSF-GQSSMDGYGEDRSQPGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  617



>emb|CBI23322.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 83/101 (82%), Gaps = 5/101 (5%)
 Frame = -3

Query  715  VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPS--  548
            V+++  E+EIR+RSHEMLEN+DMQHLLR+F+MG  GHAS N+ +DG+ ++    P+ S  
Sbjct  524  VDDFFPEDEIRMRSHEMLENDDMQHLLRIFNMGNHGHASANVTDDGYPYSSAYMPTSSTG  583

Query  547  FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +G+DEDR R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  584  YGFDEDRSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  624



>gb|EEC73417.1| hypothetical protein OsI_07682 [Oryza sativa Indica Group]
Length=652

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 86/109 (79%), Gaps = 6/109 (6%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  ++   GV++YL EE IR++SHE+LENE+MQ +LR+ SMGG AS N+ EDGF F  
Sbjct  540  DWSQPQENRSGVDDYLMEE-IRMQSHEILENEEMQQMLRILSMGG-ASTNLTEDGFAFPN  597

Query  568  FMAPSP-SFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +M  +P +F + +DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  598  YMPSTPPNFNFGDDRARPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>ref|XP_002316655.1| calmodulin-binding protein 60-C [Populus trichocarpa]
 gb|EEE97267.1| calmodulin-binding protein 60-C [Populus trichocarpa]
Length=637

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 4/101 (4%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM-APSPS  548
            G E+Y SEEEIR RSHEMLENEDMQ+LLR F MGG   +S N+ EDG+ ++ +M  PSPS
Sbjct  530  GTEDYFSEEEIRTRSHEMLENEDMQNLLRGFHMGGQGPSSFNVTEDGYPYSSYMPCPSPS  589

Query  547  FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +++D  R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  590  YCFEDDPSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  630



>ref|XP_008349259.1| PREDICTED: uncharacterized protein LOC103412486 [Malus domestica]
Length=228

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 11/109 (10%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--------HASVNIPEDGFGFTPF  566
            +GVE+   EEEIR+RS+E+LENEDMQHLLR+ +MGG        H+S+N+ ED + ++  
Sbjct  113  RGVEDLFPEEEIRMRSNEILENEDMQHLLRVINMGGQGQGHSYGHSSMNVTEDNYPYSSP  172

Query  565  MAPSPSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              P+P   Y  D+D+ R PGKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  173  YIPTPQANYSIDDDQSRSPGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  221



>ref|XP_003575160.1| PREDICTED: uncharacterized protein LOC100846328 isoform X2 [Brachypodium 
distachyon]
Length=649

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 86/107 (80%), Gaps = 5/107 (5%)
 Frame = -3

Query  739  WSNTR-DKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            WS  + ++GV++YL EE IRLRSHE+LEN++MQ +LR+ +MGG    N+PEDGF F   M
Sbjct  539  WSQPQENRGVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-VPTNLPEDGFSFPYNM  596

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P PSF +++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  597  QSPLPSFNFEDDRTRPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  643



>ref|XP_010235560.1| PREDICTED: uncharacterized protein LOC100846328 isoform X1 [Brachypodium 
distachyon]
Length=650

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 86/107 (80%), Gaps = 5/107 (5%)
 Frame = -3

Query  739  WSNTR-DKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            WS  + ++GV++YL EE IRLRSHE+LEN++MQ +LR+ +MGG    N+PEDGF F   M
Sbjct  540  WSQPQENRGVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-VPTNLPEDGFSFPYNM  597

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P PSF +++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  598  QSPLPSFNFEDDRTRPPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  644



>ref|XP_011043288.1| PREDICTED: uncharacterized protein LOC105138780 isoform X1 [Populus 
euphratica]
Length=637

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHA-SVNIPEDGFGFTPFM-APSPSF  545
            G E+Y SEEEIR RSHEMLENEDMQ+LLR F+MGG   S N+ EDG+ ++ +M  PSPS+
Sbjct  531  GTEDYFSEEEIRTRSHEMLENEDMQNLLRGFNMGGQGPSFNVTEDGYPYSSYMPCPSPSY  590

Query  544  GYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             + +D  R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  591  CFGDDPSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  630



>ref|XP_007025783.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
 gb|EOY28405.1| Calmodulin-binding protein isoform 2 [Theobroma cacao]
Length=632

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 5/103 (5%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTP-FMA-PS  554
            +GVE++ SEEEIR+RSHEMLENEDMQHLLR+F+MG  GH S N  EDG+  +  +M+ PS
Sbjct  523  RGVEDFFSEEEIRMRSHEMLENEDMQHLLRIFNMGSHGHTSFNATEDGYPHSSAYMSTPS  582

Query  553  PSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             ++G+D +  R  GKAVVGWLK+KAA+RWG FIRKKAAERRA 
Sbjct  583  LNYGFDNEASRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAH  625



>ref|XP_007025782.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY28404.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=635

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 83/103 (81%), Gaps = 5/103 (5%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTP-FMA-PS  554
            +GVE++ SEEEIR+RSHEMLENEDMQHLLR+F+MG  GH S N  EDG+  +  +M+ PS
Sbjct  526  RGVEDFFSEEEIRMRSHEMLENEDMQHLLRIFNMGSHGHTSFNATEDGYPHSSAYMSTPS  585

Query  553  PSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             ++G+D +  R  GKAVVGWLK+KAA+RWG FIRKKAAERRA 
Sbjct  586  LNYGFDNEASRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAH  628



>gb|EAY94271.1| hypothetical protein OsI_16040 [Oryza sativa Indica Group]
Length=652

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 8/110 (7%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENE-DMQHLLRLFSMGGHASVNIPEDGFGFT  572
            DWS  ++   GV++YL EE IR+RSHE+LENE DMQ +LR+ SMGG +S N+   G GF+
Sbjct  540  DWSRLQENRGGVDDYLMEE-IRVRSHEILENEEDMQQMLRILSMGG-SSANM-NHGDGFS  596

Query  571  PFM-APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            PFM +P+P+F Y++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  597  PFMPSPAPAFNYEDDRARPSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>ref|NP_001052891.1| Os04g0444200 [Oryza sativa Japonica Group]
 emb|CAE02429.1| OSJNBa0058G03.4 [Oryza sativa Japonica Group]
 dbj|BAF14805.1| Os04g0444200 [Oryza sativa Japonica Group]
Length=652

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 8/110 (7%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENE-DMQHLLRLFSMGGHASVNIPEDGFGFT  572
            DWS  ++   GV++YL EE IR+RSHE+LENE DMQ +LR+ SMGG +S N+   G GF+
Sbjct  540  DWSRLQENRGGVDDYLMEE-IRVRSHEILENEEDMQQMLRILSMGG-SSANM-NHGDGFS  596

Query  571  PFM-APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            PFM +P+P+F Y++DR RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  597  PFMPSPAPAFNYEDDRARPSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  646



>gb|ABR25523.1| calmodulin binding protein cellular communication/signal transduction 
mechanism [Oryza sativa Indica Group]
Length=98

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 5/92 (5%)
 Frame = -3

Query  694  EEIRLRSHEMLENE-DMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPR  521
            EEIR+RSHE+LENE DMQ +LR+ SMGG +S N+   G GF+PFM +P+P+F Y++DR R
Sbjct  3    EEIRVRSHEILENEEDMQQMLRILSMGG-SSANM-NHGDGFSPFMPSPAPAFNYEDDRAR  60

Query  520  P-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            P GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  61   PSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  92



>ref|XP_009761692.1| PREDICTED: uncharacterized protein LOC104213840 isoform X2 [Nicotiana 
sylvestris]
Length=583

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 81/102 (79%), Gaps = 4/102 (4%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS  548
            KG +++ +E+EIR+RSHEMLENEDMQHLLR+F+MGG  HAS +  +D + +     PS S
Sbjct  475  KGADDFFTEQEIRMRSHEMLENEDMQHLLRIFNMGGQNHASSSSTQDNYQYGSSYMPSIS  534

Query  547  --FGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +G+ EDR R GKAVVGWLK+KAA+RWG FIRK+AA++RAQ
Sbjct  535  STYGFQEDRTRSGKAVVGWLKLKAALRWGIFIRKEAADKRAQ  576



>ref|XP_004485707.1| PREDICTED: uncharacterized protein LOC101498971 [Cicer arietinum]
Length=634

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 85/103 (83%), Gaps = 5/103 (5%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGF-TPFM-APS  554
            +G E++  EE+IR+RSHEMLENEDMQHLLR+F+MGG  H+S N PEDG+ + +P+M A S
Sbjct  525  RGFEDFFPEEDIRMRSHEMLENEDMQHLLRIFNMGGQSHSSFNAPEDGYPYSSPYMPATS  584

Query  553  PSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             ++  D++R R  GKAVVGWLK+KAA+RWG F+RKKAAERRA+
Sbjct  585  INYNMDDERNRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAR  627



>emb|CDY02746.1| BnaC02g11430D [Brassica napus]
Length=624

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 9/114 (8%)
 Frame = -3

Query  742  DWSNTRDKG---VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH-----ASVNIPED  587
            DWSN  ++G    E++ SEEEIRLRSHEMLENEDMQ  LRLFSMGG      +  + PED
Sbjct  501  DWSNHGERGGGGAEDFFSEEEIRLRSHEMLENEDMQKFLRLFSMGGGGAGNGSPAHFPED  560

Query  586  GFGFTPFMAPSPSFGYD-EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            G+   P    +P  GYD EDR + G++VVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  561  GYASFPSFLNTPMQGYDDEDRGQSGRSVVGWLKIKAAMRWGFFIRRKAAERRAQ  614



>ref|XP_009761691.1| PREDICTED: uncharacterized protein LOC104213840 isoform X1 [Nicotiana 
sylvestris]
Length=628

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 81/102 (79%), Gaps = 4/102 (4%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS  548
            KG +++ +E+EIR+RSHEMLENEDMQHLLR+F+MGG  HAS +  +D + +     PS S
Sbjct  520  KGADDFFTEQEIRMRSHEMLENEDMQHLLRIFNMGGQNHASSSSTQDNYQYGSSYMPSIS  579

Query  547  --FGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +G+ EDR R GKAVVGWLK+KAA+RWG FIRK+AA++RAQ
Sbjct  580  STYGFQEDRTRSGKAVVGWLKLKAALRWGIFIRKEAADKRAQ  621



>ref|XP_006409114.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 ref|XP_006409115.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 gb|ESQ50567.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
 gb|ESQ50568.1| hypothetical protein EUTSA_v10022604mg [Eutrema salsugineum]
Length=608

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 79/110 (72%), Gaps = 10/110 (9%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-----HASVNIPEDGFG  578
            DWSNT +     +LSEEEIR RS+EMLEN+DMQ LLRLFSM G        +N+ EDGFG
Sbjct  496  DWSNTGNG----FLSEEEIRARSNEMLENDDMQQLLRLFSMSGGEQQQTTPMNLSEDGFG  551

Query  577  FTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            F  F   S    Y+EDR   GK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  552  FHSF-GQSSMADYEEDRSNSGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  600



>ref|XP_009150716.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150718.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150719.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
 ref|XP_009150720.1| PREDICTED: uncharacterized protein LOC103874061 [Brassica rapa]
Length=626

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 82/114 (72%), Gaps = 10/114 (9%)
 Frame = -3

Query  742  DWSNTRDKGVEE-YLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--------HASVNIPE  590
            DWSNT ++G  + +LSEEEIR RS+EMLEN+DMQ LLRLF M G           +N+ E
Sbjct  506  DWSNTGNRGGGDGFLSEEEIRARSNEMLENDDMQQLLRLFCMSGGGGGGGGPQTPMNMGE  565

Query  589  DGFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            DG GF  F   S   GY EDR +PGK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  566  DGLGFQSF-GQSSMDGYGEDRSQPGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  618



>ref|XP_004504984.1| PREDICTED: uncharacterized protein LOC101509425 [Cicer arietinum]
Length=627

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 5/108 (5%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFM  563
            SN+  +GVE+   EEEIR+RSHEMLENEDMQHLLR+F+MGG  HAS N  E+G+  T   
Sbjct  513  SNSTYRGVEDLFPEEEIRIRSHEMLENEDMQHLLRIFNMGGHAHASFNAHEEGYPNTSTY  572

Query  562  APS--PSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PS   S+ +D++  R  GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  573  MPSNHTSYNFDDEPNRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  620



>ref|XP_006361013.1| PREDICTED: uncharacterized protein LOC102605248 [Solanum tuberosum]
Length=625

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 81/107 (76%), Gaps = 5/107 (5%)
 Frame = -3

Query  733  NTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTP  569
            N+  KG +++ +EEEIR RSHEMLEN+DMQHLL +F+MGG  HAS +  ED    +G   
Sbjct  512  NSSYKGTDDFFTEEEIRTRSHEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPY  571

Query  568  FMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              + S SFG DEDR R GKAVVGWLK+KAA+RWG FIRKKAAE+RAQ
Sbjct  572  MPSMSSSFGIDEDRTRSGKAVVGWLKLKAALRWGIFIRKKAAEKRAQ  618



>ref|XP_006384008.1| hypothetical protein POPTR_0004s03510g [Populus trichocarpa]
 gb|ERP61805.1| hypothetical protein POPTR_0004s03510g [Populus trichocarpa]
Length=640

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 7/104 (7%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFT----PFMA  560
            KG E++ SEEEIR RSHEMLEN+DMQHLLR+F+MGG   +S N  EDG+ F+    P   
Sbjct  531  KGTEDFFSEEEIRTRSHEMLENDDMQHLLRIFNMGGQGLSSFNATEDGYPFSSTNMPTAP  590

Query  559  PSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            P+ SFG D  R   GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  591  PNYSFGDDPSRS-SGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  633



>ref|XP_010539448.1| PREDICTED: uncharacterized protein LOC104813528 [Tarenaya hassleriana]
Length=632

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 84/107 (79%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            +WSN R+KG EE+ SEEEIRLRS+EMLENEDMQ LLRLFSMGG       EDG+GF  FM
Sbjct  516  NWSNHREKGPEEFFSEEEIRLRSNEMLENEDMQQLLRLFSMGGGGHAG--EDGYGFPSFM  573

Query  562  -APSPSFGY-DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              P     Y +E+R R GKAVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  574  QTPQMMQSYEEEERGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAQ  620



>gb|KEH36516.1| calmodulin-binding protein [Medicago truncatula]
Length=634

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 78/103 (76%), Gaps = 5/103 (5%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFMAPSPS  548
            +G E++  E++IR+RSHEMLENEDMQHLLR+F+MGG  H S N PED + ++    P+ S
Sbjct  525  RGFEDFFPEDDIRIRSHEMLENEDMQHLLRIFNMGGQPHTSFNAPEDEYPYSSAYMPATS  584

Query  547  FGYDEDRPR---PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              Y+ D  R    GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  585  TNYNVDDERNRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  627



>ref|XP_009126828.1| PREDICTED: uncharacterized protein LOC103851701 [Brassica rapa]
 ref|XP_009126829.1| PREDICTED: uncharacterized protein LOC103851701 [Brassica rapa]
Length=625

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 82/116 (71%), Gaps = 11/116 (9%)
 Frame = -3

Query  742  DWSNTRDKG-----VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVN-----IP  593
            DWSN  ++G      E++ SEEEIRLRSHEMLENEDMQ  +RLFSMGG  + N      P
Sbjct  500  DWSNHGERGGGGGGAEDFFSEEEIRLRSHEMLENEDMQKFVRLFSMGGGGTGNDSVAHFP  559

Query  592  EDGFGFTPFMAPSPSFGYD-EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            EDG+   P    +P  GYD ED  R G++VVGWLKIKAAMRWGF IR+KAAERRAQ
Sbjct  560  EDGYTSFPSFLNTPMQGYDDEDSGRSGRSVVGWLKIKAAMRWGFSIRRKAAERRAQ  615



>ref|XP_011001128.1| PREDICTED: uncharacterized protein LOC105108501 [Populus euphratica]
Length=637

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 7/104 (7%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGF----TPFMA  560
            KG E++ SEEEIR RSHEMLEN+DMQHLLR+F+MGG   +S N  EDG+ F     P   
Sbjct  528  KGTEDFFSEEEIRTRSHEMLENDDMQHLLRIFNMGGQGLSSFNATEDGYPFLSTNMPTAP  587

Query  559  PSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            P+ SFG D  R   GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  588  PNYSFGDDPSR-SSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  630



>ref|XP_010696621.1| PREDICTED: uncharacterized protein LOC104909117 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=634

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 8/106 (8%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHAS---VNIPEDGFGFTPFMAP  557
            +G E  LSEE+IR+RSH+MLE+EDMQHLLR+F MG  GH +   V++ ED + ++   AP
Sbjct  522  RGNENLLSEEDIRMRSHQMLEHEDMQHLLRIFGMGNGGHQAQNPVSVSEDPYPYSAGYAP  581

Query  556  SPS--FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            SP+  F +DEDR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  582  SPAINFNFDEDRSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  627



>ref|XP_010696620.1| PREDICTED: uncharacterized protein LOC104909117 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 8/106 (8%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHAS---VNIPEDGFGFTPFMAP  557
            +G E  LSEE+IR+RSH+MLE+EDMQHLLR+F MG  GH +   V++ ED + ++   AP
Sbjct  527  RGNENLLSEEDIRMRSHQMLEHEDMQHLLRIFGMGNGGHQAQNPVSVSEDPYPYSAGYAP  586

Query  556  SPS--FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            SP+  F +DEDR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  587  SPAINFNFDEDRSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  632



>gb|AFK38635.1| unknown [Medicago truncatula]
Length=128

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 5/101 (5%)
 Frame = -3

Query  715  VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPSFG  542
            VE++  EEEIR+RSHEMLENEDMQ LLR+F+MG   HAS N  EDG+       P+ +  
Sbjct  21   VEDFSPEEEIRIRSHEMLENEDMQQLLRMFNMGSHAHASFNAHEDGYPNPSAYMPANNMS  80

Query  541  Y---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            Y   DE +   GKAVVGWLK+KAA+RWG F+RKKAA+RRAQ
Sbjct  81   YNFDDEPKSSSGKAVVGWLKLKAALRWGIFVRKKAADRRAQ  121



>ref|XP_008383819.1| PREDICTED: uncharacterized protein LOC103446473 [Malus domestica]
 ref|XP_008358694.1| PREDICTED: uncharacterized protein LOC103422407 [Malus domestica]
Length=636

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 11/109 (10%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--------HASVNIPEDGFGFTPF  566
            +GVE+   EEEIR+RS+E+LENEDMQHLLR+ +MGG        H+S+N+ ED + ++  
Sbjct  521  RGVEDLFPEEEIRMRSNEILENEDMQHLLRVINMGGQGQGHSYGHSSMNVTEDNYPYSSP  580

Query  565  MAPSPSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              P+P   Y  D+D+ R PGKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  581  YIPTPQANYSIDDDQSRSPGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  629



>ref|XP_002869655.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45914.1| calmodulin-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=600

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 77/107 (72%), Gaps = 9/107 (8%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW N  +    +  +EEEIR RSH+ML NEDMQ LL+LFSMGG       EDGF F  FM
Sbjct  493  DWINPNEN---DLFAEEEIRQRSHDMLANEDMQQLLQLFSMGGGNG----EDGFAFPSFM  545

Query  562  APSPSF-GY-DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P   GY DEDR R GKAVVGWLKIKAAMRWGFFIR+KAAERRAQ
Sbjct  546  HNTPMMQGYNDEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAQ  592



>emb|CDO99627.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 5/103 (5%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGF-TPFMAPSP  551
            +G ++  SEE+IRLRSHEMLENEDMQ+LLR+F+MGG  H  VN  E+ + +   +MA + 
Sbjct  524  RGFDDVFSEEDIRLRSHEMLENEDMQNLLRIFNMGGYGHTPVNGTENNYQYPLGYMAGTS  583

Query  550  S-FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            S + +DEDR RP GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  584  SGYAFDEDRTRPSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  626



>gb|AAN65369.1| calmodulin-binding protein 60-C [Phaseolus vulgaris]
Length=129

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 5/108 (5%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFM  563
            SN   +GVEEY  EEEIR+RSHEMLENEDMQ LLR+F++GG  H + N  +DG+  +   
Sbjct  15   SNPTYRGVEEYFPEEEIRIRSHEMLENEDMQQLLRMFNVGGQPHPTFNGLDDGYPSSSTY  74

Query  562  APSPSFGY---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +   GY   DE     GKAVVGWLK+KAA+RWG FIRK+AAE+RAQ
Sbjct  75   ISANPMGYNFDDEPNRSSGKAVVGWLKLKAALRWGIFIRKQAAEKRAQ  122



>ref|XP_009414724.1| PREDICTED: uncharacterized protein LOC103995757 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414730.1| PREDICTED: uncharacterized protein LOC103995757 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 8/107 (7%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS  +D    ++LSEEEIRLRSHEMLENEDMQHLLR  S+ G AS+++ EDG+GF P++
Sbjct  525  DWSCQQD----DFLSEEEIRLRSHEMLENEDMQHLLRNLSVVG-ASMSLHEDGYGFPPYV  579

Query  562  AP-SPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRA  431
                 +F  D+D R RP G+AVVGWLKIKAAMRWG F+RKKAAERRA
Sbjct  580  PLLCSNFNDDDDERSRPSGRAVVGWLKIKAAMRWGIFVRKKAAERRA  626



>gb|KDP20890.1| hypothetical protein JCGZ_21361 [Jatropha curcas]
Length=623

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 81/107 (76%), Gaps = 7/107 (7%)
 Frame = -3

Query  730  TRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHA--SVNIPEDGF----GFTP  569
            T  +G E++L EE+IR+RSHEMLE+EDMQHLLR+F+MGG    S N  EDG+     + P
Sbjct  511  TSYRGAEDFLQEEDIRMRSHEMLESEDMQHLLRIFNMGGQGLNSFNTTEDGYPYSSAYMP  570

Query  568  FMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             ++P+ S G D+ R   GKAV+GWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  571  ALSPNYSVGDDQSR-SSGKAVLGWLKLKAALRWGIFIRKKAAERRAQ  616



>gb|KDO75731.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=623

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 6/104 (6%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-P  557
            +G+E++ SEEEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA P
Sbjct  513  RGIEDFFSEEEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANP  572

Query  556  SPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            SP++ +D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  573  SPNYSFDDDSSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  616



>ref|XP_006467892.1| PREDICTED: uncharacterized protein LOC102626942 [Citrus sinensis]
 gb|KDO75732.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
 gb|KDO75733.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=628

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 6/104 (6%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-P  557
            +G+E++ SEEEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA P
Sbjct  518  RGIEDFFSEEEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANP  577

Query  556  SPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            SP++ +D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  578  SPNYSFDDDSSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  621



>ref|XP_006449222.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
 gb|ESR62462.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
Length=628

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 6/104 (6%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-P  557
            +G+E++ SEEEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA P
Sbjct  518  RGIEDFFSEEEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANP  577

Query  556  SPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            SP++ +D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  578  SPNYSFDDDSSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  621



>gb|KDO75730.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=627

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 6/104 (6%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-P  557
            +G+E++ SEEEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA P
Sbjct  517  RGIEDFFSEEEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANP  576

Query  556  SPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            SP++ +D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  577  SPNYSFDDDSSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  620



>ref|XP_003545838.1| PREDICTED: uncharacterized protein LOC100802994 isoform X1 [Glycine 
max]
 ref|XP_006597397.1| PREDICTED: uncharacterized protein LOC100802994 isoform X2 [Glycine 
max]
Length=635

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 77/109 (71%), Gaps = 6/109 (6%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG---HASVNIPEDGFGFTPF  566
            SN   +G+E+Y  E+EIR RSHEMLENEDMQHLLR+F+MGG   HA  N  ED + ++  
Sbjct  520  SNPNYRGLEDYFPEDEIRTRSHEMLENEDMQHLLRIFNMGGGQSHAPFNTQEDAYPYSSA  579

Query  565  MAPSPSFGY---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              P+ S      DE     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  580  YMPAASMSSNLDDEQNRSSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  628



>emb|CDY59992.1| BnaA02g35270D [Brassica napus]
Length=629

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = -3

Query  739  WSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSM------GGHASVNIPEDGFG  578
            WSN R    E++ SEEEIRLRSHEMLENEDM+  LRLFSM      G  +  + PEDG+ 
Sbjct  509  WSNHRGGAEEDFFSEEEIRLRSHEMLENEDMKQFLRLFSMGGGGGTGNDSVAHFPEDGYS  568

Query  577  FTPFMAPSPSFGY-DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              P    +P  GY DED  R G++VVGWLKIKAAMRWGF IR+KAAERRAQ
Sbjct  569  SFPSFLNTPMQGYDDEDSGRSGRSVVGWLKIKAAMRWGFSIRRKAAERRAQ  619



>ref|XP_006449221.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
 gb|ESR62461.1| hypothetical protein CICLE_v10014600mg [Citrus clementina]
Length=588

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 6/104 (6%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-P  557
            +G+E++ SEEEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA P
Sbjct  478  RGIEDFFSEEEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANP  537

Query  556  SPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            SP++ +D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  538  SPNYSFDDDSSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  581



>gb|KDO75734.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
 gb|KDO75735.1| hypothetical protein CISIN_1g006875mg [Citrus sinensis]
Length=588

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (84%), Gaps = 6/104 (6%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQ-HLLRLFSMGG--HASVNIPEDGFGFT-PFMA-P  557
            +G+E++ SEEEIR+RSHEMLENEDMQ HLLR+F+MGG  H S N+ ED + ++ PFMA P
Sbjct  478  RGIEDFFSEEEIRMRSHEMLENEDMQQHLLRIFNMGGQGHPSFNVAEDAYPYSSPFMANP  537

Query  556  SPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            SP++ +D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  538  SPNYSFDDDSSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  581



>ref|XP_010327020.1| PREDICTED: uncharacterized protein LOC101268806 isoform X4 [Solanum 
lycopersicum]
Length=570

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 5/107 (5%)
 Frame = -3

Query  733  NTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTP  569
            N+  KG +++ +EEEIR RS EMLEN+DMQHLL +F+MGG  HAS +  ED    +G   
Sbjct  457  NSSYKGTDDFYTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPY  516

Query  568  FMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              + S SFG DEDR R GKAVVGWLK+KAA+RWG FI+KKAAE+RAQ
Sbjct  517  MPSMSSSFGIDEDRTRSGKAVVGWLKLKAALRWGIFIKKKAAEKRAQ  563



>gb|ACN34699.1| unknown [Zea mays]
Length=304

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 5/107 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  
Sbjct  195  DWSRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--  251

Query  562  APSPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +P+P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  252  SPAPAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  298



>ref|XP_008224944.1| PREDICTED: uncharacterized protein LOC103324639 isoform X1 [Prunus 
mume]
 ref|XP_008224945.1| PREDICTED: uncharacterized protein LOC103324639 isoform X1 [Prunus 
mume]
Length=639

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 82/114 (72%), Gaps = 13/114 (11%)
 Frame = -3

Query  730  TRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSM----------GGHASVNIPEDGF  581
            T  +GVE+   EEEIR+RSHEMLENEDMQHLLR+F+M           GHAS+N+ ED +
Sbjct  519  TSYRGVEDLFPEEEIRMRSHEMLENEDMQHLLRIFNMGGQGHGHGHGYGHASMNVTEDNY  578

Query  580  GFTPFMAPSPSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             ++    P+P   Y  D+DR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  579  PYSTAYIPTPPVNYNIDDDRSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  632



>ref|XP_003570530.1| PREDICTED: uncharacterized protein LOC100822237 [Brachypodium 
distachyon]
 ref|XP_010233903.1| PREDICTED: uncharacterized protein LOC100822237 [Brachypodium 
distachyon]
Length=614

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+ TRD    +  +E+ IR++SH+MLE EDMQ LLR+FSMGG AS ++P++ F F  +M
Sbjct  504  DWTRTRDGQYADDFTED-IRMKSHQMLEGEDMQQLLRVFSMGG-ASTSLPDETFAFQSYM  561

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +  RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  562  PSPLPNLGFEGEPSRPSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  608



>ref|XP_010327019.1| PREDICTED: uncharacterized protein LOC101268806 isoform X3 [Solanum 
lycopersicum]
Length=588

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 5/107 (5%)
 Frame = -3

Query  733  NTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTP  569
            N+  KG +++ +EEEIR RS EMLEN+DMQHLL +F+MGG  HAS +  ED    +G   
Sbjct  475  NSSYKGTDDFYTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPY  534

Query  568  FMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              + S SFG DEDR R GKAVVGWLK+KAA+RWG FI+KKAAE+RAQ
Sbjct  535  MPSMSSSFGIDEDRTRSGKAVVGWLKLKAALRWGIFIKKKAAEKRAQ  581



>ref|XP_008224946.1| PREDICTED: uncharacterized protein LOC103324639 isoform X2 [Prunus 
mume]
 ref|XP_008224947.1| PREDICTED: uncharacterized protein LOC103324639 isoform X2 [Prunus 
mume]
Length=638

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 82/114 (72%), Gaps = 13/114 (11%)
 Frame = -3

Query  730  TRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSM----------GGHASVNIPEDGF  581
            T  +GVE+   EEEIR+RSHEMLENEDMQHLLR+F+M           GHAS+N+ ED +
Sbjct  518  TSYRGVEDLFPEEEIRMRSHEMLENEDMQHLLRIFNMGGQGHGHGHGYGHASMNVTEDNY  577

Query  580  GFTPFMAPSPSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             ++    P+P   Y  D+DR R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  578  PYSTAYIPTPPVNYNIDDDRSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  631



>ref|XP_004248099.1| PREDICTED: uncharacterized protein LOC101268806 isoform X2 [Solanum 
lycopersicum]
Length=594

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 5/107 (5%)
 Frame = -3

Query  733  NTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTP  569
            N+  KG +++ +EEEIR RS EMLEN+DMQHLL +F+MGG  HAS +  ED    +G   
Sbjct  481  NSSYKGTDDFYTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPY  540

Query  568  FMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              + S SFG DEDR R GKAVVGWLK+KAA+RWG FI+KKAAE+RAQ
Sbjct  541  MPSMSSSFGIDEDRTRSGKAVVGWLKLKAALRWGIFIKKKAAEKRAQ  587



>ref|XP_004248098.1| PREDICTED: uncharacterized protein LOC101268806 isoform X1 [Solanum 
lycopersicum]
Length=625

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 5/107 (5%)
 Frame = -3

Query  733  NTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDG---FGFTP  569
            N+  KG +++ +EEEIR RS EMLEN+DMQHLL +F+MGG  HAS +  ED    +G   
Sbjct  512  NSSYKGTDDFYTEEEIRTRSQEMLENDDMQHLLHIFNMGGQHHASSSTSEDNNYPYGSPY  571

Query  568  FMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              + S SFG DEDR R GKAVVGWLK+KAA+RWG FI+KKAAE+RAQ
Sbjct  572  MPSMSSSFGIDEDRTRSGKAVVGWLKLKAALRWGIFIKKKAAEKRAQ  618



>gb|AAA33446.1| calmodulin-binding protein, partial [Zea mays]
Length=129

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 77/102 (75%), Gaps = 3/102 (3%)
 Frame = -3

Query  730  TRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSP  551
             R  GV++YL EE IR+RSHE+LENE+MQ +LRL SMGG A  + P+     +    PSP
Sbjct  24   NRGGGVDDYLMEE-IRMRSHEILENEEMQQMLRLLSMGG-AEPSEPKTLQFPSVHACPSP  81

Query  550  SFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +  Y++DR R PGKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  82   NVSYEDDRTRAPGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  123



>gb|KHN07315.1| hypothetical protein glysoja_027405 [Glycine soja]
Length=623

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 78/108 (72%), Gaps = 5/108 (5%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFM  563
            SN   +GVEEY  EEEIR+RS+EMLENEDMQHLLR+F+MGG  H + N  +DG+  +   
Sbjct  509  SNPTYRGVEEYFPEEEIRIRSNEMLENEDMQHLLRIFNMGGQPHPTFNAQDDGYPSSSTY  568

Query  562  APSPSFGY---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +   GY   DE     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  569  ISANPMGYNFDDEPNRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  616



>ref|XP_003529298.1| PREDICTED: uncharacterized protein LOC100812605 [Glycine max]
Length=623

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 78/108 (72%), Gaps = 5/108 (5%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFM  563
            SN   +GVEEY  EEEIR+RS+EMLENEDMQHLLR+F+MGG  H + N  +DG+  +   
Sbjct  509  SNPTYRGVEEYFPEEEIRIRSNEMLENEDMQHLLRIFNMGGQPHPTFNAQDDGYPSSSTY  568

Query  562  APSPSFGY---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +   GY   DE     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  569  ISANPMGYNFDDEPNRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  616



>ref|XP_010057559.1| PREDICTED: uncharacterized protein LOC104445366 [Eucalyptus grandis]
 gb|KCW74752.1| hypothetical protein EUGRSUZ_E03474 [Eucalyptus grandis]
Length=621

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 5/103 (5%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGF-GFTPFMAP-S  554
            +G EE   EEEIR+RS  MLENEDMQHLLR+F+MGGH  +S +  EDG+   +P+M   S
Sbjct  512  RGAEELFPEEEIRMRSLAMLENEDMQHLLRIFNMGGHTESSFHATEDGYPCSSPYMPNLS  571

Query  553  PSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +FG++EDR R  GKAV+GWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  572  QNFGFNEDRSRSSGKAVIGWLKLKAALRWGIFVRKKAAERRAQ  614



>ref|XP_002524676.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF37695.1| calmodulin binding protein, putative [Ricinus communis]
Length=458

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 85/106 (80%), Gaps = 5/106 (5%)
 Frame = -3

Query  730  TRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGF--TPFM  563
            T  +G E++  EE++R+RS+EMLEN+DMQHLLR+F+MGG   +S+N+ EDG+ +  +   
Sbjct  346  TSYRGSEDFFPEEDLRVRSNEMLENDDMQHLLRIFNMGGQGLSSLNMGEDGYPYPSSYVP  405

Query  562  APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            APSP++ + +D+ R  GKAV+GWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  406  APSPNYSFGDDQSRSSGKAVIGWLKLKAALRWGIFVRKRAAERRAQ  451



>ref|XP_009112562.1| PREDICTED: uncharacterized protein LOC103837921 [Brassica rapa]
Length=624

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 11/112 (10%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-------HASVNIPEDG  584
            DWSN   +G + +LSEEEIR RS+EMLEN+DMQ LLRLFSM G          +N+ EDG
Sbjct  509  DWSN---RGGDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGGGGGGPQTPMNMGEDG  565

Query  583  FGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            FGF  F   S    Y+E+R + GK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  566  FGFHSF-GQSSLGDYEEERSQSGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  616



>emb|CDY30302.1| BnaA09g09750D [Brassica napus]
Length=624

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 11/112 (10%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-------HASVNIPEDG  584
            DWSN   +G + +LSEEEIR RS+EMLEN+DMQ LLRLFSM G          +N+ EDG
Sbjct  509  DWSN---RGGDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGGGGGGPQTPMNMGEDG  565

Query  583  FGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            FGF  F   S    Y+E+R + GK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  566  FGFHSF-GQSSLGDYEEERSQSGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  616



>ref|XP_007213593.1| hypothetical protein PRUPE_ppa002740mg [Prunus persica]
 gb|EMJ14792.1| hypothetical protein PRUPE_ppa002740mg [Prunus persica]
Length=638

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 81/114 (71%), Gaps = 13/114 (11%)
 Frame = -3

Query  730  TRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSM----------GGHASVNIPEDGF  581
            T  +GVE+   EEEIR+RSHEMLENEDMQHLLR+F+M           GHAS+NI ED +
Sbjct  518  TSYRGVEDLFPEEEIRMRSHEMLENEDMQHLLRIFNMGGQGHGHGHGYGHASMNITEDNY  577

Query  580  GFTPFMAPSPSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             ++    P+P   Y  D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  578  PYSTAYIPTPPVNYSTDDDHSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  631



>ref|NP_001046071.1| Os02g0177800 [Oryza sativa Japonica Group]
 dbj|BAD27989.1| putative calmodulin-binding protein [Oryza sativa Japonica Group]
 dbj|BAF07985.1| Os02g0177800 [Oryza sativa Japonica Group]
Length=624

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 84/107 (79%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+ +++    +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++ ED FGF  +M
Sbjct  514  DWTRSQNGQFADDFTED-IRMKSHQMLESEDMQQLLRVFSMGG-ASTSLQEDAFGFPTYM  571

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +R R  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  572  PSPLPNLGFEGERTRSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  618



>gb|EEC72606.1| hypothetical protein OsI_06079 [Oryza sativa Indica Group]
Length=669

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 84/107 (79%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+ +++    +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++ ED FGF  +M
Sbjct  559  DWTRSQNGQFADDFTED-IRMKSHQMLESEDMQQLLRVFSMGG-ASTSLQEDAFGFPTYM  616

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +R R  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  617  PSPLPNLGFEGERTRSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  663



>gb|AFW66308.1| hypothetical protein ZEAMMB73_910550 [Zea mays]
Length=317

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW   RD    +  +E+ IR++SH++LE EDMQ LLR+FSMGG AS ++P+D F F  +M
Sbjct  207  DWPRNRDSQYPDDFTED-IRVKSHQLLEGEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYM  264

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  265  PSPLPNLGFETERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  311



>ref|NP_001130446.1| uncharacterized protein LOC100191543 [Zea mays]
 gb|ACF78658.1| unknown [Zea mays]
Length=471

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 5/107 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  
Sbjct  362  DWSRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--  418

Query  562  APSPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +P+P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  419  SPAPAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  465



>ref|XP_011096210.1| PREDICTED: uncharacterized protein LOC105175464 [Sesamum indicum]
Length=636

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 8/102 (8%)
 Frame = -3

Query  709  EYLSEEEIRLRSHEMLENEDMQHLLRLFSM------GGHASVNIPEDGFGFTPFMAPSPS  548
            E + E+EIR+RSHEMLENEDMQHLLR+FSM       GHAS N+ E+ + ++ +   +PS
Sbjct  528  EDIPEDEIRIRSHEMLENEDMQHLLRVFSMGGHGHGHGHASFNVNENNYAYSAYTPMTPS  587

Query  547  -FGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             FG+D DR RP GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  588  TFGFDVDRTRPSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  629



>ref|XP_002535201.1| hypothetical protein RCOM_0245460 [Ricinus communis]
 gb|EEF27182.1| hypothetical protein RCOM_0245460 [Ricinus communis]
Length=192

 Score =   100 bits (248),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  619  GGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAE  440
            GG+A+VNIPEDGF F P+ A SP   YD++  RP KAVVGWLKIKAAMR GFFIRKKAAE
Sbjct  122  GGNAAVNIPEDGFSFPPYTAASPMPNYDKNGVRPNKAVVGWLKIKAAMRSGFFIRKKAAE  181

Query  439  RRAQ  428
            RRAQ
Sbjct  182  RRAQ  185


 Score = 53.1 bits (126),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  741  TGLTPVTRGLRNICLRRRFVSEAMKC*RMKICSTCFGSSAW  619
            TG T  TR L N  LR+RF SE M+C RMKIC+TCF S AW
Sbjct  81   TGPTTGTRELMNTLLRKRFASEVMRCLRMKICNTCFDSLAW  121



>gb|EEE56432.1| hypothetical protein OsJ_05602 [Oryza sativa Japonica Group]
Length=789

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 84/107 (79%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+ +++    +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++ ED FGF  +M
Sbjct  679  DWTRSQNGQFADDFTED-IRMKSHQMLESEDMQQLLRVFSMGG-ASTSLQEDAFGFPTYM  736

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +R R  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  737  PSPLPNLGFEGERTRSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  783



>emb|CDY52577.1| BnaCnng22620D [Brassica napus]
Length=623

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 10/111 (9%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG------HASVNIPEDGF  581
            DWS    +G + +LSEEEIR RS+EMLEN+DMQ LLRLFSM G         +N+ EDGF
Sbjct  509  DWST---RGGDGFLSEEEIRARSNEMLENDDMQQLLRLFSMNGGGGGGPQTPMNMGEDGF  565

Query  580  GFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            GF  F   S    Y+E+R + GK VVGWLKIKAAMRWGFFIR+KAA+RRAQ
Sbjct  566  GFHSF-GQSSMGDYEEERSQSGKPVVGWLKIKAAMRWGFFIRRKAAQRRAQ  615



>tpg|DAA37640.1| TPA: hypothetical protein ZEAMMB73_428755 [Zea mays]
Length=450

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 5/107 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  
Sbjct  341  DWSRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--  397

Query  562  APSPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +P+P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  398  SPAPAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  444



>ref|XP_008667040.1| PREDICTED: uncharacterized protein LOC100191543 isoform X2 [Zea 
mays]
Length=653

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 5/107 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  
Sbjct  544  DWSRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--  600

Query  562  APSPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +P+P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  601  SPAPAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  647



>ref|XP_008667039.1| PREDICTED: uncharacterized protein LOC100191543 isoform X1 [Zea 
mays]
Length=652

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 5/107 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS  ++  V+EYL +E IR RSHE+LEN++MQH+LR  S+GG  +     DGF   P  
Sbjct  543  DWSRLQESSVDEYLMDE-IRARSHELLENDEMQHMLRFLSVGGAPTGLNNVDGFLSYP--  599

Query  562  APSPSFGYDED-RPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +P+P+FG+DED R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  600  SPAPAFGFDEDDRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  646



>gb|KHN00110.1| hypothetical protein glysoja_028638 [Glycine soja]
Length=624

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 5/108 (5%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFM  563
            SN   +G EEY  EEEIR+RS+EMLEN DMQHLLR+F+MGG  H ++N  +DG+  +   
Sbjct  510  SNPTYRGAEEYFPEEEIRIRSNEMLENNDMQHLLRIFNMGGQSHPTLNAQDDGYPSSSTY  569

Query  562  APSPSFGY---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +   GY   DE     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  570  ISANPMGYNFDDEPNRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  617



>ref|XP_003532556.1| PREDICTED: uncharacterized protein LOC100806393 [Glycine max]
Length=624

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 5/108 (5%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFM  563
            SN   +G EEY  EEEIR+RS+EMLEN DMQHLLR+F+MGG  H ++N  +DG+  +   
Sbjct  510  SNPTYRGAEEYFPEEEIRIRSNEMLENNDMQHLLRIFNMGGQSHPTLNAQDDGYPSSSTY  569

Query  562  APSPSFGY---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +   GY   DE     GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  570  ISANPMGYNFDDEPNRSSGKAVVGWLKLKAALRWGIFIRKQAAERRAQ  617



>ref|XP_002535531.1| hypothetical protein RCOM_2098470 [Ricinus communis]
 gb|EEF26852.1| hypothetical protein RCOM_2098470 [Ricinus communis]
Length=196

 Score =   100 bits (248),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -3

Query  619  GGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAE  440
            GG A+VNIPE GF F P++A SP   YDE+  RP KAVVGWLKIKAAMRWGFFIRKKAAE
Sbjct  126  GGIAAVNIPEGGFSFPPYIAASPMPNYDENGVRPNKAVVGWLKIKAAMRWGFFIRKKAAE  185

Query  439  RRAQ  428
            R+ Q
Sbjct  186  RQEQ  189


 Score = 51.6 bits (122),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  741  TGLTPVTRGLRNICLRRRFVSEAMKC*RMKICSTCFGSSAW  619
            TG T  TR L N  LR+RF SE M+C RMKIC+TCF S  W
Sbjct  85   TGPTTGTRELMNTLLRKRFASEVMRCLRMKICNTCFDSLPW  125



>ref|XP_004293506.1| PREDICTED: uncharacterized protein LOC101308261 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460292.1| PREDICTED: uncharacterized protein LOC101308261 [Fragaria vesca 
subsp. vesca]
Length=636

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 80/117 (68%), Gaps = 13/117 (11%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHA---------SVNIPE  590
            D SN       ++  EEEIR RSHE+LENEDMQHLLR+F+MGGH          S+N  E
Sbjct  514  DTSNLASYRGLDFFPEEEIRTRSHEILENEDMQHLLRMFNMGGHGQVHGQSVHPSINATE  573

Query  589  DGFGFTPFMAPSPSFGY--DEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            D + ++    PSP+  Y  D+DR R  GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  574  D-YSYSSAYMPSPAINYNFDDDRSRSSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  629



>ref|XP_010433589.1| PREDICTED: uncharacterized protein LOC104717678 [Camelina sativa]
 ref|XP_010433590.1| PREDICTED: uncharacterized protein LOC104717678 [Camelina sativa]
Length=620

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 76/107 (71%), Gaps = 9/107 (8%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS   +    ++ SEEEIR RSHE+L NEDMQ LL+LF+MG        EDGF    FM
Sbjct  512  DWSKHHEG---DFFSEEEIRQRSHELLANEDMQELLQLFNMGDGNE----EDGFALPSFM  564

Query  562  APSPSF-GYDE-DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P+  GYDE DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  565  HNTPTMQGYDEEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  611



>ref|XP_006845603.1| hypothetical protein AMTR_s00019p00206980 [Amborella trichopoda]
 gb|ERN07278.1| hypothetical protein AMTR_s00019p00206980 [Amborella trichopoda]
Length=630

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 81/108 (75%), Gaps = 9/108 (8%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF  566
            DW+  RD +G+++Y +EEEIR+RS EMLENEDMQHLLRLFSMGG+       D + +  +
Sbjct  523  DWARHRDARGLDDYFTEEEIRMRSSEMLENEDMQHLLRLFSMGGNT------DAYSYPSY  576

Query  565  M-APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +P+ ++ Y+    RP GKA VGWLKIKAA+RWG F+RK AAE+RAQ
Sbjct  577  IPSPATNYTYEMCPGRPSGKAAVGWLKIKAALRWGIFVRKIAAEKRAQ  624



>ref|NP_001150045.1| calmodulin binding protein [Zea mays]
 gb|ACG37616.1| calmodulin binding protein [Zea mays]
Length=616

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW   RD    +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++ +D F F P+M
Sbjct  506  DWPRNRDSQYADDFTED-IRVKSHQMLESEDMQQLLRVFSMGG-ASGSLSDDTFNFQPYM  563

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  564  PSPLPNPGFESERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  610



>gb|AFW70388.1| calmodulin binding protein [Zea mays]
Length=616

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW   RD    +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++ +D F F P+M
Sbjct  506  DWPRNRDSQYADDFTED-IRVKSHQMLESEDMQQLLRVFSMGG-ASGSLSDDTFNFQPYM  563

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  564  PSPLPNPGFESERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  610



>ref|XP_009376054.1| PREDICTED: uncharacterized protein LOC103964603 isoform X2 [Pyrus 
x bretschneideri]
Length=637

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 79/115 (69%), Gaps = 12/115 (10%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH----------ASVNIPED  587
            SN   +G E+   EEEIR+RSHE+LENEDMQHLLR+F+MGG           AS+NI ED
Sbjct  516  SNPSYRGAEDLFPEEEIRMRSHEILENEDMQHLLRIFNMGGQGQGQGHGYGHASMNITED  575

Query  586  GFGFTPFMAPSPSFGY--DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             + ++    P+P   Y  D+     GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  576  NYPYSSPYMPTPQVNYSVDDQSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  630



>ref|XP_009375849.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375923.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375988.1| PREDICTED: uncharacterized protein LOC103964603 isoform X1 [Pyrus 
x bretschneideri]
Length=638

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 79/115 (69%), Gaps = 12/115 (10%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH----------ASVNIPED  587
            SN   +G E+   EEEIR+RSHE+LENEDMQHLLR+F+MGG           AS+NI ED
Sbjct  517  SNPSYRGAEDLFPEEEIRMRSHEILENEDMQHLLRIFNMGGQGQGQGHGYGHASMNITED  576

Query  586  GFGFTPFMAPSPSFGY--DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             + ++    P+P   Y  D+     GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  577  NYPYSSPYMPTPQVNYSVDDQSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  631



>ref|XP_003608224.1| Calmodulin-binding protein [Medicago truncatula]
 gb|AES90421.1| calmodulin-binding protein [Medicago truncatula]
Length=629

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 74/101 (73%), Gaps = 5/101 (5%)
 Frame = -3

Query  715  VEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPSFG  542
            VE++  EEEIR+RSHEMLENEDMQ LLR+F+MG   HAS N  EDG+       P+ +  
Sbjct  522  VEDFFPEEEIRIRSHEMLENEDMQQLLRMFNMGSHAHASFNAHEDGYPNPSAYMPANNMS  581

Query  541  Y---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            Y   DE +   GKAVVGWLK+KAA+RWG F+RKKAA+RRAQ
Sbjct  582  YNFDDEPKSSSGKAVVGWLKLKAALRWGIFVRKKAADRRAQ  622



>ref|XP_011043291.1| PREDICTED: uncharacterized protein LOC105138780 isoform X4 [Populus 
euphratica]
Length=578

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 79/104 (76%), Gaps = 6/104 (6%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM-APSP  551
            +G E++ SEEEIR RSH+MLENEDMQ LLR+F+MGG   +S ++ E G+ ++ +M +PSP
Sbjct  468  RGKEDFFSEEEIRTRSHDMLENEDMQQLLRIFNMGGQGLSSNSVTEYGYPYSSYMPSPSP  527

Query  550  SFGYD-EDRPR--PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
               Y   D P    GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  528  CPNYSLSDNPSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  571



>gb|KJB57646.1| hypothetical protein B456_009G173400 [Gossypium raimondii]
Length=631

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 10/108 (9%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP-------EDGFGFTPFM  563
            KG++++ SEEEI++RS+EML+NEDMQHLLR+F+MG H     P       ED   +    
Sbjct  517  KGIDDFFSEEEIKMRSNEMLDNEDMQHLLRIFNMGSHCHATPPPPPFNAIEDTHPYPSTY  576

Query  562  APSPS--FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             P+PS  +G+D D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRA 
Sbjct  577  MPTPSLAYGFDNDASRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAH  624



>gb|KHG24590.1| eukaryotic translation initiation factor 3 subunit m [Gossypium 
arboreum]
Length=631

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 10/108 (9%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP-------EDGFGFTPFM  563
            KG++++ SEEEI++RS+EML+NEDMQHLLR+F+MG H     P       ED   +    
Sbjct  517  KGIDDFFSEEEIKMRSNEMLDNEDMQHLLRIFNMGSHCHATPPPPPFNAIEDTHPYPSTY  576

Query  562  APSPS--FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             P+PS  +G+D D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRA 
Sbjct  577  MPTPSLAYGFDNDASRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAH  624



>gb|EYU42432.1| hypothetical protein MIMGU_mgv1a025463mg [Erythranthe guttata]
Length=648

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 80/115 (70%), Gaps = 18/115 (16%)
 Frame = -3

Query  742  DWSNTRD---KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP--EDGFG  578
            +W   RD   KG  ++LSEE+IRLRSHE+LENEDMQHLLRLFSMGG    N+P  ED F 
Sbjct  535  EWPTNRDDNNKGGIDFLSEEDIRLRSHEILENEDMQHLLRLFSMGG----NVPPVEDSFS  590

Query  577  FTP-----FMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            F         APSP    D    R GKAVVGWLKIKAAMRWG FIRKKAAERRAQ
Sbjct  591  FPSSSSSYMTAPSP----DYRGARSGKAVVGWLKIKAAMRWGIFIRKKAAERRAQ  641



>ref|NP_001152440.1| LOC100286080 [Zea mays]
 gb|ACN34355.1| unknown [Zea mays]
 gb|AFW66305.1| calmodulin binding protein [Zea mays]
Length=612

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW   RD    +  +E+ IR++SH++LE EDMQ LLR+FSMGG AS ++P+D F F  +M
Sbjct  502  DWPRNRDSQYPDDFTED-IRVKSHQLLEGEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYM  559

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  560  PSPLPNLGFETERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  606



>gb|ACG47634.1| calmodulin binding protein [Zea mays]
Length=612

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW   RD    +  +E+ IR++SH++LE EDMQ LLR+FSMGG AS ++P+D F F  +M
Sbjct  502  DWPRNRDSQYPDDFTED-IRVKSHQLLEGEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYM  559

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  560  PSPLPNLGFETERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  606



>ref|XP_011043290.1| PREDICTED: uncharacterized protein LOC105138780 isoform X3 [Populus 
euphratica]
Length=623

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 79/104 (76%), Gaps = 6/104 (6%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM-APSP  551
            +G E++ SEEEIR RSH+MLENEDMQ LLR+F+MGG   +S ++ E G+ ++ +M +PSP
Sbjct  513  RGKEDFFSEEEIRTRSHDMLENEDMQQLLRIFNMGGQGLSSNSVTEYGYPYSSYMPSPSP  572

Query  550  SFGYD-EDRPR--PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
               Y   D P    GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  573  CPNYSLSDNPSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  616



>ref|XP_011043289.1| PREDICTED: uncharacterized protein LOC105138780 isoform X2 [Populus 
euphratica]
Length=626

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 79/104 (76%), Gaps = 6/104 (6%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFM-APSP  551
            +G E++ SEEEIR RSH+MLENEDMQ LLR+F+MGG   +S ++ E G+ ++ +M +PSP
Sbjct  516  RGKEDFFSEEEIRTRSHDMLENEDMQQLLRIFNMGGQGLSSNSVTEYGYPYSSYMPSPSP  575

Query  550  SFGYD-EDRPR--PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
               Y   D P    GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  576  CPNYSLSDNPSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  619



>ref|XP_007159256.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris]
 gb|ESW31250.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris]
Length=628

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 5/108 (5%)
 Frame = -3

Query  736  SNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFTPFM  563
            SN   +GVEEY  EEEIR+RSHEMLENEDMQ LLR+F++GG  H + N  +DG+  +   
Sbjct  514  SNPTYRGVEEYFPEEEIRIRSHEMLENEDMQQLLRMFNVGGQPHPTFNGLDDGYPSSSTY  573

Query  562  APSPSFGY---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +   GY   DE     GKAVVGWLK+KAA+RWG FIRK+AAE+RAQ
Sbjct  574  ISANPMGYNFDDEPNRSSGKAVVGWLKLKAALRWGIFIRKQAAEKRAQ  621



>ref|XP_006646962.1| PREDICTED: uncharacterized protein LOC102709708 [Oryza brachyantha]
Length=606

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+ +++    +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++ ED FGF  +M
Sbjct  499  DWTRSQNGQFADDFTED-IRMKSHQMLESEDMQQLLRVFSMGG-ASTSLQEDAFGFPSYM  556

Query  562  APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP   Y+ +R R  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  557  -PSP-LPYEGERTRSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  600



>ref|XP_004951715.1| PREDICTED: uncharacterized protein LOC101768423 [Setaria italica]
Length=617

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW   R+    +  +E+ IR++SH+MLE+EDMQ LLR+FSMGG AS ++P+D F F  +M
Sbjct  507  DWPRNRESQYGDDFTED-IRIKSHQMLESEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYM  564

Query  562  -APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             +P P+ G++ +R    GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  565  PSPLPNLGFEGERSHSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  611



>emb|CAB39601.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 emb|CAB79435.1| putative calmodulin-binding protein [Arabidopsis thaliana]
Length=536

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 76/107 (71%), Gaps = 11/107 (10%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+N  +    ++ SEEEIR  SH++L NEDMQ LL  FSMGG       EDGF F  FM
Sbjct  428  DWTNLSEN---DFFSEEEIRQTSHDLLANEDMQQLL--FSMGGGKG----EDGFTFPSFM  478

Query  562  APSPSF-GYDED-RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P   GYDE+ R R GKAVVGWLK+KAAMRWGFFIR+KAAERRAQ
Sbjct  479  QNTPMMQGYDEEGRGRSGKAVVGWLKVKAAMRWGFFIRRKAAERRAQ  525



>gb|EYU27904.1| hypothetical protein MIMGU_mgv1a0037712mg, partial [Erythranthe 
guttata]
Length=526

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 3/96 (3%)
 Frame = -3

Query  709  EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPS-FGYDE  533
            E + E+EIR+RSHEMLE+EDMQHLLR+FSMGGH   +  E  + ++ +   +PS FG+ E
Sbjct  425  EDIPEDEIRVRSHEMLEHEDMQHLLRMFSMGGHTPFSGNEHNY-YSAYTPATPSTFGFGE  483

Query  532  DRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             R R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  484  GRTRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  519



>ref|XP_010438831.1| PREDICTED: uncharacterized protein LOC104722380 [Camelina sativa]
Length=630

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 77/107 (72%), Gaps = 10/107 (9%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWSN  +    ++ SEEEIR RS+E+L NEDMQ LL+LF   G+      EDGF F  FM
Sbjct  515  DWSNHHEG---DFFSEEEIRQRSNELLANEDMQELLQLFMGDGNE-----EDGFAFPSFM  566

Query  562  APSPSF-GYDE-DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P+  GY+E DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  567  HNTPTMQGYEEEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  613



>ref|NP_194310.3| Calmodulin-binding protein [Arabidopsis thaliana]
 ref|NP_001078448.1| Calmodulin-binding protein [Arabidopsis thaliana]
 dbj|BAE98742.1| putative calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEE85115.1| Calmodulin-binding protein [Arabidopsis thaliana]
 gb|AEE85116.1| Calmodulin-binding protein [Arabidopsis thaliana]
Length=601

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 76/107 (71%), Gaps = 11/107 (10%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW+N  +    ++ SEEEIR  SH++L NEDMQ LL  FSMGG       EDGF F  FM
Sbjct  493  DWTNLSEN---DFFSEEEIRQTSHDLLANEDMQQLL--FSMGGGKG----EDGFTFPSFM  543

Query  562  APSPSF-GYDED-RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P   GYDE+ R R GKAVVGWLK+KAAMRWGFFIR+KAAERRAQ
Sbjct  544  QNTPMMQGYDEEGRGRSGKAVVGWLKVKAAMRWGFFIRRKAAERRAQ  590



>ref|XP_010448369.1| PREDICTED: uncharacterized protein LOC104730838 isoform X2 [Camelina 
sativa]
 ref|XP_010448370.1| PREDICTED: uncharacterized protein LOC104730838 isoform X2 [Camelina 
sativa]
Length=614

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 77/107 (72%), Gaps = 9/107 (8%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS   +    ++ SEEEIR RS+E+L NED+Q LL+LF+MG        EDGF F  FM
Sbjct  505  DWSKHNEG---DFFSEEEIRQRSNELLANEDLQELLQLFNMGDGNE----EDGFAFPSFM  557

Query  562  APSPSF-GYDE-DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P+  GY+E DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  558  DNTPTMQGYEEEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  604



>ref|XP_010448367.1| PREDICTED: uncharacterized protein LOC104730838 isoform X1 [Camelina 
sativa]
 ref|XP_010448368.1| PREDICTED: uncharacterized protein LOC104730838 isoform X1 [Camelina 
sativa]
Length=624

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 77/107 (72%), Gaps = 9/107 (8%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS   +    ++ SEEEIR RS+E+L NED+Q LL+LF+MG        EDGF F  FM
Sbjct  515  DWSKHNEG---DFFSEEEIRQRSNELLANEDLQELLQLFNMGDGNE----EDGFAFPSFM  567

Query  562  APSPSF-GYDE-DRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P+  GY+E DR R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  568  DNTPTMQGYEEEDRGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  614



>gb|AHI49901.1| calmodulin-binding protein, partial [Lavandula angustifolia]
Length=84

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 62/79 (78%), Gaps = 3/79 (4%)
 Frame = -3

Query  658  NEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGY--DEDRPRPGKAVVGWLKIK  485
            NE+MQ LLR+FS+G     N+PEDG+GF P  AP PS G   +ED+ R GKAVVGWLKIK
Sbjct  1    NEEMQDLLRIFSLGSQTPANVPEDGYGF-PSHAPLPSPGLTLNEDQTRSGKAVVGWLKIK  59

Query  484  AAMRWGFFIRKKAAERRAQ  428
            AAMRWG FIRKKAAERRAQ
Sbjct  60   AAMRWGIFIRKKAAERRAQ  78



>emb|CDY59605.1| BnaC03g74590D [Brassica napus]
Length=627

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 73/103 (71%), Gaps = 9/103 (9%)
 Frame = -3

Query  742  DWSNTRDKGVEE-YLSEEEIRLRSHEMLENEDMQHLLRLFSMGG-------HASVNIPED  587
            DWSNT ++G  + +LSEEEIR RS+EMLEN+DMQ LLRLFSM G          +N+ ED
Sbjct  508  DWSNTGNRGGGDGFLSEEEIRARSNEMLENDDMQQLLRLFSMSGGGGGGGPQTPINMGED  567

Query  586  GFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFI  458
            GFGF  F   S   GY EDR + GK VVGWLKIKAAMRWGFFI
Sbjct  568  GFGFNSF-GQSSMGGYGEDRSQSGKPVVGWLKIKAAMRWGFFI  609



>gb|EMT26442.1| hypothetical protein F775_27587 [Aegilops tauschii]
Length=613

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 79/106 (75%), Gaps = 3/106 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            +W + RD    +  +E+ IRL+SH++LE +DMQ LLR+F+MGG AS  +P++ F F    
Sbjct  504  NWHHNRDGQYADDFTED-IRLKSHQLLEGDDMQQLLRVFNMGG-ASTGLPDETFSFPYMQ  561

Query  562  APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +P P+ G++ +  RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  562  SPLPNPGFEGEPSRPSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  607



>ref|XP_008364142.1| PREDICTED: uncharacterized protein LOC103427840 isoform X1 [Malus 
domestica]
 ref|XP_008364143.1| PREDICTED: uncharacterized protein LOC103427840 isoform X1 [Malus 
domestica]
Length=638

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 11/109 (10%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--------ASVNIPEDGFGFTPF  566
            +G E+   EEEIR+RSHE+LENEDMQ LL +F+MGG         AS+NI ED + ++  
Sbjct  523  RGAEDLFPEEEIRMRSHEILENEDMQRLLHIFNMGGQGQGHGYGHASMNITEDNYPYSSP  582

Query  565  MAPSPSFGY--DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              P+P   Y  D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  583  YVPTPQVNYSVDDDHSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  631



>ref|XP_008364144.1| PREDICTED: uncharacterized protein LOC103427840 isoform X2 [Malus 
domestica]
Length=637

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 11/109 (10%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--------ASVNIPEDGFGFTPF  566
            +G E+   EEEIR+RSHE+LENEDMQ LL +F+MGG         AS+NI ED + ++  
Sbjct  522  RGAEDLFPEEEIRMRSHEILENEDMQRLLHIFNMGGQGQGHGYGHASMNITEDNYPYSSP  581

Query  565  MAPSPSFGY--DEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              P+P   Y  D+D  R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  582  YVPTPQVNYSVDDDHSRSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  630



>gb|EMS55488.1| hypothetical protein TRIUR3_12862 [Triticum urartu]
Length=657

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 9/110 (8%)
 Frame = -3

Query  742  DW---SNTRDKGVEEYLSEEEIRLRSHEMLENED-MQHLLRLFSMGGHASVNIPEDGFGF  575
            DW   S     GV+++L EE IR+RSH++LENE+ MQH+LR+ S G  A++N   DGF +
Sbjct  546  DWPGRSQENRGGVDDFLMEE-IRVRSHDILENEEEMQHMLRILSGGAAANMN-NVDGFPY  603

Query  574  TPFMAPSPSFGYDEDR-PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             P  +P P+F +++DR P  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  604  IP--SPVPTFNFEDDRAPSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  651



>ref|XP_002453396.1| hypothetical protein SORBIDRAFT_04g005240 [Sorghum bicolor]
 gb|EES06372.1| hypothetical protein SORBIDRAFT_04g005240 [Sorghum bicolor]
Length=622

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 3/105 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DW   RD    +  +E+ I ++SH+MLE+EDMQ LLR+FSMGG AS ++P+D F F  +M
Sbjct  515  DWPRNRDNQYADDFTED-IHVKSHQMLESEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYM  572

Query  562  APSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             PSP     E     GKAVVGWLKIKAA+RWG F+RKKAAERRAQ
Sbjct  573  -PSPLPNQTERSHSSGKAVVGWLKIKAAIRWGIFVRKKAAERRAQ  616



>ref|XP_002532915.1| hypothetical protein RCOM_1318360 [Ricinus communis]
 gb|EEF29472.1| hypothetical protein RCOM_1318360 [Ricinus communis]
Length=195

 Score = 92.4 bits (228),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  619  GGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAE  440
            G + +VNI EDGF F P+MA SP   YDE+  RPGKAVVGWLKIK AMR GFF+RKKA E
Sbjct  133  GENGAVNIHEDGFQFPPYMAASPMPNYDENGVRPGKAVVGWLKIKVAMRLGFFVRKKATE  192

Query  439  RRA  431
            RRA
Sbjct  193  RRA  195


 Score = 51.2 bits (121),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  741  TGLTPVTRGLRNICLRRRFVSEAMKC*RMKICSTCFGSSAW  619
            TG T  TR L N  LR+RF SE M+C RMKIC++CF S AW
Sbjct  92   TGPTTRTRELMNTLLRKRFASEVMRCLRMKICNSCFESLAW  132



>ref|XP_002446536.1| hypothetical protein SORBIDRAFT_06g017740 [Sorghum bicolor]
 gb|EES10864.1| hypothetical protein SORBIDRAFT_06g017740 [Sorghum bicolor]
Length=652

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 7/109 (6%)
 Frame = -3

Query  742  DWS---NTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFT  572
            DWS     R  G ++YL +E IR RSHE+LEN++MQ +LRL SMGG  +     DGF   
Sbjct  541  DWSRLQENRGGGADDYLMDE-IRARSHEILENDEMQQMLRLLSMGGAPTGLNNVDGFPSY  599

Query  571  PFMAPSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            P  +P+P+F ++++R R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  600  P--SPAPAFSFEDNRARSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  646



>ref|XP_009394895.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394896.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394897.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394898.1| PREDICTED: uncharacterized protein LOC103980282 [Musa acuminata 
subsp. malaccensis]
Length=633

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 79/107 (74%), Gaps = 7/107 (7%)
 Frame = -3

Query  742  DWSNTRDK-GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGF---GF  575
            DWSN R   GV++YL+EEEIR+RSHE+LENE+MQ LLR F +G  +S N+P +GF    F
Sbjct  521  DWSNQRQSHGVDDYLTEEEIRMRSHEILENEEMQQLLRHFMVG--SSSNVPGNGFESPSF  578

Query  574  TPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERR  434
                +P  +F  D++R   GKAVVGWLKIKAAMRWG FIRKK A+RR
Sbjct  579  VSPPSPPFNFDVDQNRS-SGKAVVGWLKIKAAMRWGIFIRKKVAQRR  624



>ref|XP_006282572.1| hypothetical protein CARUB_v10004387mg [Capsella rubella]
 gb|EOA15470.1| hypothetical protein CARUB_v10004387mg [Capsella rubella]
Length=619

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 73/107 (68%), Gaps = 9/107 (8%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            DWS        +  SEEEIR  SHE+L NEDMQ LL+LFSMGG       EDGF F  FM
Sbjct  512  DWSKHHGN---DLFSEEEIRKISHELLANEDMQELLQLFSMGGGNG----EDGFAFPSFM  564

Query  562  APSP-SFGYDED-RPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P + G DE+   R GKAVVGWLKIKAAMRWGFFIR+KAAERRA 
Sbjct  565  HNTPRTQGSDEEGHGRSGKAVVGWLKIKAAMRWGFFIRRKAAERRAH  611



>ref|XP_004975724.1| PREDICTED: uncharacterized protein LOC101760764 isoform X1 [Setaria 
italica]
Length=660

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 6/108 (6%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  ++    V++YL EE IR RSHE+LEN++MQ +LR+ SMGG  +     D F   P
Sbjct  550  DWSRLQENRGSVDDYLMEE-IRARSHEILENDEMQQMLRILSMGGAPTGLNNVDSFPSYP  608

Query  568  FMAPSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P+P+F +++DR R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  609  --SPAPAFSFEDDRSRSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  654



>ref|XP_004975725.1| PREDICTED: uncharacterized protein LOC101760764 isoform X2 [Setaria 
italica]
Length=659

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 6/108 (6%)
 Frame = -3

Query  742  DWSNTRDK--GVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            DWS  ++    V++YL EE IR RSHE+LEN++MQ +LR+ SMGG  +     D F   P
Sbjct  549  DWSRLQENRGSVDDYLMEE-IRARSHEILENDEMQQMLRILSMGGAPTGLNNVDSFPSYP  607

Query  568  FMAPSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +P+P+F +++DR R  GKAVVGWLKIKAAMRWG F+R+KAAERRAQ
Sbjct  608  --SPAPAFSFEDDRSRSSGKAVVGWLKIKAAMRWGIFVRRKAAERRAQ  653



>gb|AAA33447.1| calmodulin-binding protein, partial [Zea mays]
Length=282

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 3/87 (3%)
 Frame = -3

Query  682  LRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM-APSPSFGYDEDRPRP-GKA  509
            LR+  +LE EDMQ LLR+FSMGG AS ++P+D F F  +M +P P+ G++ +R    GKA
Sbjct  191  LRATSLLEGEDMQQLLRVFSMGG-ASGSLPDDTFNFQSYMPSPMPNLGFETERTHSSGKA  249

Query  508  VVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            VVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  250  VVGWLKIKAAMRWGIFVRKKAAERRAQ  276



>gb|EMS66803.1| hypothetical protein TRIUR3_04882 [Triticum urartu]
Length=591

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            +W + RD    +  +E+ IR++SH++LE +DMQ LLR+F+MGG AS  +P++ F F    
Sbjct  482  NWHHNRDGQYADDFTED-IRMKSHQLLEGDDMQQLLRIFNMGG-ASTGLPDETFSFPDIP  539

Query  562  APSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +P P+   + +  RP GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  540  SPFPNPDSEGEPSRPSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  585



>dbj|BAJ96828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 6/99 (6%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENED-MQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFG  542
            GV++ L EE IR RSH+MLENE+ MQH+LR+ S G  A++N   +  GF  + +P P F 
Sbjct  554  GVDDCLMEE-IRGRSHDMLENEEEMQHMLRILSGGAAANMN---NVGGFPSYPSPVPDFN  609

Query  541  YDEDR-PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +DR P  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  610  FVDDRAPSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  648



>dbj|BAK04468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=655

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 6/99 (6%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENED-MQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFG  542
            GV++ L EE IR RSH+MLENE+ MQH+LR+ S G  A++N   +  GF  + +P P F 
Sbjct  555  GVDDCLMEE-IRGRSHDMLENEEEMQHMLRILSGGAAANMN---NVGGFPSYPSPVPDFN  610

Query  541  YDEDR-PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +DR P  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  611  FVDDRAPSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  649



>gb|EMT33137.1| hypothetical protein F775_28653 [Aegilops tauschii]
Length=959

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 11/99 (11%)
 Frame = -3

Query  718  GVEEYLSEEEIRLRSHEMLENED-MQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFG  542
            GV+++L EE IR+RSH++LENE+ MQH+LR+ S G  A++N        T   +P P++ 
Sbjct  864  GVDDFLMEE-IRVRSHDILENEEEMQHMLRILSGGAAANMN--------TYIPSPIPTYN  914

Query  541  YDEDR-PRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +++DR P  GKAVVGWLKIKAAMRWG F+RKKAAERRAQ
Sbjct  915  FEDDRAPSSGKAVVGWLKIKAAMRWGIFVRKKAAERRAQ  953



>gb|EMS66476.1| hypothetical protein TRIUR3_28909 [Triticum urartu]
Length=774

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 55/92 (60%), Positives = 74/92 (80%), Gaps = 5/92 (5%)
 Frame = -3

Query  739  WSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            WS  ++ + V++YL EE IRLRSHE+LEN++MQ +LR+ +MGG AS N+ +DGF F P+M
Sbjct  573  WSQPQENRAVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-ASTNMNDDGFTFPPYM  630

Query  562  -APSPSFGYDEDRPR-PGKAVVGWLKIKAAMR  473
             +PSP+  +++DR R PGKAVVGWLKIKAAMR
Sbjct  631  QSPSPNLNFEDDRTRPPGKAVVGWLKIKAAMR  662



>gb|EMT06125.1| hypothetical protein F775_27254 [Aegilops tauschii]
Length=699

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 74/92 (80%), Gaps = 5/92 (5%)
 Frame = -3

Query  739  WSNTR-DKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFM  563
            WS  + ++ V++YL EE IRLRSHE+LEN++MQ +LR+ +MGG AS N+ +DGF F P+M
Sbjct  538  WSQPQENRAVDDYLMEE-IRLRSHEILENDEMQQMLRILNMGG-ASTNMNDDGFTFPPYM  595

Query  562  -APSPSFGYDEDRPR-PGKAVVGWLKIKAAMR  473
             +PSP+  +++DR R PGKAVVGWLKIKAAMR
Sbjct  596  QSPSPNLNFEDDRTRPPGKAVVGWLKIKAAMR  627



>ref|XP_002316656.1| calmodulin-binding protein 60-C [Populus trichocarpa]
 gb|EEE97268.1| calmodulin-binding protein 60-C [Populus trichocarpa]
Length=625

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 8/106 (8%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGH--ASVNIPEDGFGFTPFMAPSPS  548
            +G +++ SEEEIR RSH+MLENEDMQ LLR+F+MGG   +S ++ EDG+ ++ +M     
Sbjct  513  RGKDDFFSEEEIRTRSHDMLENEDMQQLLRIFNMGGQGLSSNSVTEDGYPYSSYMPSPSP  572

Query  547  FGYDE----DRPR--PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
                     D P    GKAVVGWLK+KAA+RWG F+RKKAAERRAQ
Sbjct  573  SPSPNYSLSDNPSRSSGKAVVGWLKLKAALRWGIFVRKKAAERRAQ  618



>gb|KHG17962.1| Insulin-like receptor [Gossypium arboreum]
Length=538

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 72/99 (73%), Gaps = 7/99 (7%)
 Frame = -3

Query  712  EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPSFGY  539
            +++LSEEEIR+RS+E+LENEDMQHLLR+F+MG  GH + N     +  T   APS + G+
Sbjct  435  DDFLSEEEIRMRSNEVLENEDMQHLLRVFNMGSHGHGASNPCSSKYMPT---APSLNCGF  491

Query  538  D--EDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +  E     GKAVVGWLK+KAA+RWG F RKK AER A+
Sbjct  492  NNEEALSSSGKAVVGWLKLKAALRWGVFTRKKVAERLAR  530



>ref|XP_002527587.1| hypothetical protein RCOM_1566570 [Ricinus communis]
 gb|EEF34795.1| hypothetical protein RCOM_1566570 [Ricinus communis]
Length=158

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  613  HASVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERR  434
            HA VNIPEDGF F P+MA S    YD +  RP KAVVGWLKIKAAMRW FFIRKKA ERR
Sbjct  90   HAIVNIPEDGFAFLPYMATSAMTNYDGNGVRPSKAVVGWLKIKAAMRWRFFIRKKATERR  149

Query  433  AQ  428
            AQ
Sbjct  150  AQ  151



>emb|CAN60089.1| hypothetical protein VITISV_005487 [Vitis vinifera]
Length=156

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 77/120 (64%), Gaps = 17/120 (14%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG---------GHA-----  608
            D S +R+ +G+E+Y SEE IRLRS EMLEN++MQ +L+ F+MG         GH+     
Sbjct  34   DCSRSRNGQGLEDYFSEE-IRLRSSEMLENDEMQRMLKTFNMGVDAGMGPAFGHSDDACY  92

Query  607  SVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            S +IP +      F     +FG    R   GKAVVGWLK++AA+RWG FIRKKAAERRAQ
Sbjct  93   SYSIPYERQMDQTFGQMDQAFGQVHGRA-TGKAVVGWLKLRAALRWGIFIRKKAAERRAQ  151



>gb|KJB68601.1| hypothetical protein B456_010G254300 [Gossypium raimondii]
Length=621

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 73/106 (69%), Gaps = 8/106 (8%)
 Frame = -3

Query  721  KGVEEYLSE-EEIRLRSH-EMLENEDMQHLLRLFSMGG--HASVNIPEDGFGFT-PFMAP  557
            +GVE++ SE EE+R+RS+ EML NEDMQHL+R+F+ G   H   N  +D   ++  +M P
Sbjct  509  EGVEDFFSEDEEMRMRSNNEMLANEDMQHLIRIFNKGNQDHIPFNASDDSHPYSSTYMTP  568

Query  556  SPSFGY---DEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +  Y   +E  P  GKAVVGWLK+KAA+RWG F RKKAAER A 
Sbjct  569  TLALNYGFDNETSPSSGKAVVGWLKLKAALRWGIFTRKKAAERHAH  614



>gb|AAN65370.1| calmodulin-binding protein 60-D [Phaseolus vulgaris]
Length=285

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 9/112 (8%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNI---PEDGFGF  575
            DW+  R+ +G+E+ ++EE +RLRS EMLE++DMQ LL+  + G + S N+    E  + +
Sbjct  171  DWARPRNGQGLEDIVAEE-LRLRSSEMLESDDMQRLLKTINAGVNMSANLGHSNESCYTY  229

Query  574  TPFMAPS---PSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +    P     S G D+ +P  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  230  SLQYEPEMYHHSLGEDQGKP-SGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  280



>gb|KDO59436.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
 gb|KDO59437.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
Length=607

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP-EDGFGFTP  569
            DWS  R+  G+E++L+EE IR+RS EMLEN+DMQ LL+  SMG  AS +   E  + +  
Sbjct  496  DWSRPRNGHGLEDFLAEE-IRVRSSEMLENDDMQRLLKTLSMGMTASYDHSHEACYSYGI  554

Query  568  FMAPSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
               P     Y +D  R  GKAVVGWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  555  QYEPPMDQTYKQDLSRGSGKAVVGWLKLKAALRWGIFVRKRAAERRAQ  602



>gb|KDO59439.1| hypothetical protein CISIN_1g007350mg [Citrus sinensis]
Length=531

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP-EDGFGFTP  569
            DWS  R+  G+E++L+EE IR+RS EMLEN+DMQ LL+  SMG  AS +   E  + +  
Sbjct  420  DWSRPRNGHGLEDFLAEE-IRVRSSEMLENDDMQRLLKTLSMGMTASYDHSHEACYSYGI  478

Query  568  FMAPSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
               P     Y +D  R  GKAVVGWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  479  QYEPPMDQTYKQDLSRGSGKAVVGWLKLKAALRWGIFVRKRAAERRAQ  526



>gb|KDP38647.1| hypothetical protein JCGZ_04000 [Jatropha curcas]
Length=610

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 76/116 (66%), Gaps = 15/116 (13%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFT--  572
            DWS TR+ +G+E+Y +EE IRLRS EMLE+ DMQ LL+ F MG    +    +GFG +  
Sbjct  494  DWSQTRNGQGLEDYFAEE-IRLRSTEMLESGDMQRLLKTFGMGIGVGMG---NGFGSSDE  549

Query  571  -----PFMAPSPSFG--YDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
                    A  P     Y ++R R  GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  550  GCYSYSIQAYEPQMDQVYAQERSRGSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  605



>ref|XP_006587151.1| PREDICTED: uncharacterized protein LOC100808358 isoform X2 [Glycine 
max]
Length=507

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF-  566
            DWS  R+    E +  EE+RLRS EMLE++DMQ LL+  + G + S N+     G   + 
Sbjct  394  DWSRPRNAQGLEDIVAEELRLRSSEMLESDDMQRLLKTINAGVNMSTNLGHSNEGCNTYS  453

Query  565  --MAPSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
                P     + ED+ +  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  454  LQYEPQMYHSFSEDQGKSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  502



>ref|XP_006473988.1| PREDICTED: uncharacterized protein LOC102629839 [Citrus sinensis]
Length=607

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 73/108 (68%), Gaps = 4/108 (4%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIP-EDGFGFTP  569
            DWS  R+  G+E++L+EE IR+RS EMLEN+DMQ LL+  SMG  A  +   E  + +  
Sbjct  496  DWSRPRNGHGLEDFLAEE-IRVRSSEMLENDDMQRLLKTLSMGMTAGYDHSHEACYSYGI  554

Query  568  FMAPSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
               P     Y +D  R  GKAVVGWLK+KAA+RWG F+RK+AAERRAQ
Sbjct  555  QYEPPMDQTYKQDLSRGSGKAVVGWLKLKAALRWGIFVRKRAAERRAQ  602



>gb|AFK33712.1| unknown [Medicago truncatula]
Length=289

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 74/109 (68%), Gaps = 8/109 (7%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG---GHASVNIPEDGFGF  575
            DWS  R+ +G+E+ ++EE +RLRS +MLE +DMQ LL+  + G   GH++ N       +
Sbjct  180  DWSRQRNGQGLEDIVAEE-LRLRSPQMLEGDDMQRLLKTINEGANFGHSNENCYTYRLQY  238

Query  574  TPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             P M  S  FG D  +   GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  239  EPQMYHS--FGEDNVKC-SGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  284



>ref|XP_007138149.1| hypothetical protein PHAVU_009G184300g [Phaseolus vulgaris]
 gb|ESW10143.1| hypothetical protein PHAVU_009G184300g [Phaseolus vulgaris]
Length=614

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 77/112 (69%), Gaps = 9/112 (8%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNI---PEDGFGF  575
            DWS  R+ +G+E+ ++EE +RLRS EMLE++DMQ LL+  + G + S N+    E  + +
Sbjct  500  DWSRPRNGQGLEDIVAEE-LRLRSSEMLESDDMQRLLKTINAGVNMSANLGHSNESCYTY  558

Query  574  TPFMAPS---PSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +    P     S G D+ +P  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  559  SLQYEPEMYHHSLGEDQGKP-SGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  609



>ref|XP_003533889.1| PREDICTED: uncharacterized protein LOC100808358 isoform X1 [Glycine 
max]
 gb|KHN03660.1| hypothetical protein glysoja_048463 [Glycine soja]
Length=613

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF  566
            DWS  R+ +G+E+ ++EE +RLRS EMLE++DMQ LL+  + G + S N+     G   +
Sbjct  500  DWSRPRNAQGLEDIVAEE-LRLRSSEMLESDDMQRLLKTINAGVNMSTNLGHSNEGCNTY  558

Query  565  ---MAPSPSFGYDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
                 P     + ED+ +  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  559  SLQYEPQMYHSFSEDQGKSSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  608



>gb|AHM26861.1| calmodulin-binding protein, partial [Anthurium andraeanum]
Length=221

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 71/109 (65%), Gaps = 5/109 (5%)
 Frame = -3

Query  742  DWSNTRDKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG---GHASVNIPEDGFGFT  572
            DWSN+ D    +    EEIRLRS EMLE++DMQ+LLR F++G   G +S       +  +
Sbjct  109  DWSNSGDGRAYDDFISEEIRLRSSEMLEHDDMQNLLRSFTIGVGGGFSSTGEACYSYVDS  168

Query  571  PFMAP-SPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            P  +  +  FG +  +   GKAVVGWLK+KAA RWG F+RK+AAERRAQ
Sbjct  169  PLESQDADEFGQERSKSN-GKAVVGWLKLKAAFRWGIFVRKRAAERRAQ  216



>gb|KJB69416.1| hypothetical protein B456_011G022600 [Gossypium raimondii]
Length=605

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 7/99 (7%)
 Frame = -3

Query  712  EEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG--GHASVNIPEDGFGFTPFMAPSPSFGY  539
            +++LSEEEI +RS+E+LENEDMQHLLR+ +MG  GH + N     +  T   APS + G+
Sbjct  502  DDFLSEEEIIMRSNEVLENEDMQHLLRVINMGSHGHGASNPCSSTYMPT---APSLNCGF  558

Query  538  DEDRP--RPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +++      GKAVVGWLK+KAA+RWG F RKK AER A+
Sbjct  559  NKEEALSSSGKAVVGWLKLKAALRWGVFTRKKVAERLAR  597



>ref|XP_002523509.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF38848.1| calmodulin binding protein, putative [Ricinus communis]
Length=425

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 13/112 (12%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG---GHASVNIPEDGFGF  575
            DWS  R+ +GVE++ +EE IRLRS EMLE++DMQ LL+ F +G   GH+     E  + +
Sbjct  315  DWSRPRNGQGVEDFFTEE-IRLRSSEMLEHDDMQRLLKSFGIGSGFGHSD----EACYSY  369

Query  574  TPFMAPSPSF--GYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            +   A  P     Y + R R  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  370  S-IQAYEPQIDQAYTQGRGRGSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  420



>ref|XP_004488927.1| PREDICTED: uncharacterized protein LOC101515712 isoform X1 [Cicer 
arietinum]
 ref|XP_004488928.1| PREDICTED: uncharacterized protein LOC101515712 isoform X2 [Cicer 
arietinum]
Length=609

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  742  DWSNTRDKGVE--EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTP  569
            +WS  R+ G +  E +  EE+RLRS +MLEN+DMQ LL+  + G + S N  E  + +  
Sbjct  499  EWSRQRNNGQQGLEDIVAEELRLRSSQMLENDDMQRLLKTINAGVNMSSN--ESCYSYRL  556

Query  568  FMAPSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
               P     + ED  +  GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  557  QYEPQMYHSFGEDTVKCSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  604



>ref|XP_009127322.1| PREDICTED: uncharacterized protein LOC103852153 isoform X2 [Brassica 
rapa]
Length=443

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = -3

Query  724  DKGVE-EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPS  548
            D GV+ E +  EEIR+RS EMLE++DMQ LL+ F + G    +I E  +GF         
Sbjct  339  DNGVDREDVFTEEIRVRSSEMLESDDMQKLLKTFGIAG-GFTHIDESCYGFNDRYEAQVD  397

Query  547  FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             GY  +R R  GKAVVGWLK+KAA+RWG FIRKKAA+RR Q
Sbjct  398  KGYGRERGRGSGKAVVGWLKLKAALRWGIFIRKKAAQRRPQ  438



>ref|XP_010419299.1| PREDICTED: uncharacterized protein LOC104705005 [Camelina sativa]
 ref|XP_010419300.1| PREDICTED: uncharacterized protein LOC104705006 [Camelina sativa]
Length=155

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 73/119 (61%), Gaps = 20/119 (17%)
 Frame = -3

Query  742  DWSNTR--DKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNI--PEDGFGF  575
            DW   R   +G+E+  SEE IRLRS EMLE +DMQ LL+ F +G    VN    + GFG 
Sbjct  38   DWCRPRAAGQGLEDIFSEE-IRLRSSEMLETDDMQRLLKTFGIG----VNTVGTQGGFGQ  92

Query  574  T---------PFMAPSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            T         P+ A   +  Y  +R R  GKAVVGWLK+KAA+RWG FIRKKAAERR Q
Sbjct  93   TDESCYGYSIPYQAQIDNT-YRRERNRGSGKAVVGWLKLKAALRWGIFIRKKAAERRPQ  150



>gb|KEH37860.1| calmodulin-binding protein [Medicago truncatula]
Length=593

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 74/109 (68%), Gaps = 8/109 (7%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG---GHASVNIPEDGFGF  575
            DWS  R+ +G+E+ ++EE +RLRS +MLE +DMQ LL+  + G   GH++ N       +
Sbjct  484  DWSRQRNGQGLEDIVAEE-LRLRSSQMLEGDDMQRLLKTINEGANFGHSNENCYTYRLQY  542

Query  574  TPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             P M  S  FG D  +   GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  543  EPQMYHS--FGEDNVKC-SGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  588



>ref|XP_009127315.1| PREDICTED: uncharacterized protein LOC103852153 isoform X1 [Brassica 
rapa]
Length=545

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = -3

Query  724  DKGVE-EYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPS  548
            D GV+ E +  EEIR+RS EMLE++DMQ LL+ F + G    +I E  +GF         
Sbjct  441  DNGVDREDVFTEEIRVRSSEMLESDDMQKLLKTFGIAG-GFTHIDESCYGFNDRYEAQVD  499

Query  547  FGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             GY  +R R  GKAVVGWLK+KAA+RWG FIRKKAA+RR Q
Sbjct  500  KGYGRERGRGSGKAVVGWLKLKAALRWGIFIRKKAAQRRPQ  540



>ref|XP_007011980.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
 gb|EOY29599.1| Calmodulin-binding protein isoform 1 [Theobroma cacao]
Length=642

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (66%), Gaps = 14/114 (12%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG-------GHASVNIPED  587
            DWS  R+ +G+E++ +EE IRLRS EMLE++DMQ LL+ F +G       GH+     E 
Sbjct  529  DWSRPRNGQGLEDFFAEE-IRLRSSEMLESDDMQRLLKTFGVGVGMGAGFGHSD----EA  583

Query  586  GFGFTPFMAPSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             + +T          Y ++R R  GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  584  CYTYTIPYDHQIDHSYAQERGRGSGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  637



>emb|CDX68716.1| BnaC01g07370D [Brassica napus]
Length=544

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = -3

Query  694  EEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPR-P  518
            EEIR+RS EMLE +DMQ LLR F + G    +I E  +GF          GY  +R R  
Sbjct  451  EEIRVRSSEMLETDDMQKLLRTFGIAG-GFTHIAESCYGFDDRYEAQVDKGYRRERGRGS  509

Query  517  GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            GKAVVGWLK+KAA+RWG FIRKKAA+RR Q
Sbjct  510  GKAVVGWLKLKAALRWGIFIRKKAAQRRPQ  539



>ref|XP_010265653.1| PREDICTED: uncharacterized protein LOC104603341 [Nelumbo nucifera]
Length=607

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG-----GHASVNIPEDGFGFTPFMAP  557
            +G+E++LSEE IRLRS +MLEN+DMQ LLR F+       G A V+  E  + +     P
Sbjct  502  QGLEDFLSEE-IRLRSSQMLENDDMQRLLRTFNTEVDVGVGTAFVHSDEACYSYDAPYEP  560

Query  556  SPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
               F   + R   GKAVVGWLK+KAA+RWG FIRK+AAERRAQ
Sbjct  561  RREFEQQQSRS-SGKAVVGWLKLKAALRWGIFIRKRAAERRAQ  602



>emb|CDY28237.1| BnaA01g06120D [Brassica napus]
Length=545

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 61/90 (68%), Gaps = 2/90 (2%)
 Frame = -3

Query  694  EEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFGYDEDRPR-P  518
            EEIR+RS EMLE++DMQ LL+ F + G    +I E  +GF          GY  +R R  
Sbjct  452  EEIRVRSSEMLESDDMQKLLKTFGIAG-GFTHIDESCYGFNDRYEAQVDKGYGRERGRGS  510

Query  517  GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            GKAVVGWLK+KAA+RWG FIRKKAA+RR Q
Sbjct  511  GKAVVGWLKLKAALRWGIFIRKKAAQRRPQ  540



>ref|XP_003633161.1| PREDICTED: uncharacterized protein LOC100255894 [Vitis vinifera]
Length=618

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 77/120 (64%), Gaps = 17/120 (14%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMG---------GHA-----  608
            D S +R+ +G+E+Y SEE IRLRS EMLEN++MQ +L+ F+MG         GH+     
Sbjct  496  DCSRSRNGQGLEDYFSEE-IRLRSSEMLENDEMQRMLKTFNMGVDTGMGPAFGHSDDACY  554

Query  607  SVNIPEDGFGFTPFMAPSPSFGYDEDRPRPGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            S +IP +      F     +FG    R   GKAVVGWLK++AA+RWG FIRKKAAERRAQ
Sbjct  555  SYSIPYERQMDQTFGQMDQAFGQVHGRG-TGKAVVGWLKLRAALRWGIFIRKKAAERRAQ  613



>ref|XP_010548510.1| PREDICTED: uncharacterized protein LOC104819913 [Tarenaya hassleriana]
 ref|XP_010548511.1| PREDICTED: uncharacterized protein LOC104819913 [Tarenaya hassleriana]
Length=599

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 72/116 (62%), Gaps = 13/116 (11%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFT--  572
            DW   R  +G EE  +EE IRLRS EMLE++DMQ LLR F +G + ++     GFG T  
Sbjct  481  DWCRARSGQGFEENFAEE-IRLRSSEMLESDDMQRLLRTFGIGMN-TIGTSPGGFGHTDE  538

Query  571  -PFMAPSPSFG------YDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
              +    P  G      Y  +R R  GKAVVGWLK+KAA+RWG FIRKKAAERR Q
Sbjct  539  SCYGYSVPCEGHRVDNTYGRERGRGSGKAVVGWLKLKAALRWGIFIRKKAAERRPQ  594



>ref|XP_010417184.1| PREDICTED: uncharacterized protein LOC104702949 [Camelina sativa]
Length=230

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 73/119 (61%), Gaps = 20/119 (17%)
 Frame = -3

Query  742  DWSNTR--DKGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNI--PEDGFGF  575
            DW   R   +G+E+  SEE IRLRS EMLE +DMQ LL+ F +G    VN    + GFG 
Sbjct  113  DWCRPRAAGQGLEDIFSEE-IRLRSSEMLETDDMQRLLKTFGIG----VNTVGTQGGFGQ  167

Query  574  T---------PFMAPSPSFGYDEDRPR-PGKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            T         P+ A   +  Y  +R R  GKAVVGWLK+KAA+RWG FIRKKAAERR Q
Sbjct  168  TDESCYGYSIPYQAQIDN-TYRRERNRGSGKAVVGWLKLKAALRWGIFIRKKAAERRPQ  225



>emb|CBI18672.3| unnamed protein product [Vitis vinifera]
Length=503

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 68/99 (69%), Gaps = 17/99 (17%)
 Frame = -3

Query  721  KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPFMAPSPSFG  542
            +G+E+Y SEE IRLRS EMLEN++MQ +L+ F+MG        + G G        P+FG
Sbjct  416  QGLEDYFSEE-IRLRSSEMLENDEMQRMLKTFNMG-------VDTGMG--------PAFG  459

Query  541  YDEDRPRP-GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
            + +D      KAVVGWLK++AA+RWG FIRKKAAERRAQ
Sbjct  460  HSDDACYSYRKAVVGWLKLRAALRWGIFIRKKAAERRAQ  498



>gb|KJB27327.1| hypothetical protein B456_004G291200 [Gossypium raimondii]
Length=610

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 70/117 (60%), Gaps = 18/117 (15%)
 Frame = -3

Query  742  DWSNTRD-KGVEEYLSEEEIRLRSHEMLENEDMQHLLRLFSMGGHASVNIPEDGFGFTPF  566
            DWS  R   G E++ +EE IRLRS EMLE +DMQ LL+ F +G          GFG    
Sbjct  495  DWSRPRTGHGFEDFFAEE-IRLRSSEMLETDDMQRLLKTFGVGVGMGA-----GFGHPDE  548

Query  565  MAPSPSFGYDE--DRPRP---------GKAVVGWLKIKAAMRWGFFIRKKAAERRAQ  428
             + + +  YD   D P P         GKAVVGWLK+KAA+RWG FIRKKAAERRAQ
Sbjct  549  SSYAYTIPYDHQMDHPYPYVPERGKGSGKAVVGWLKLKAALRWGIFIRKKAAERRAQ  605



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420