BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022F23

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009600021.1|  PREDICTED: solanesyl diphosphate synthase 3,...    345   2e-114   Nicotiana tomentosiformis
ref|XP_009600023.1|  PREDICTED: solanesyl diphosphate synthase 3,...    345   2e-114   Nicotiana tomentosiformis
ref|XP_009793552.1|  PREDICTED: solanesyl diphosphate synthase 3,...    343   6e-114   Nicotiana sylvestris
ref|XP_009793551.1|  PREDICTED: solanesyl diphosphate synthase 3,...    343   7e-114   Nicotiana sylvestris
ref|XP_009600020.1|  PREDICTED: solanesyl diphosphate synthase 3,...    344   1e-113   Nicotiana tomentosiformis
ref|XP_006579913.1|  PREDICTED: solanesyl diphosphate synthase 3,...    340   3e-113   Glycine max [soybeans]
ref|XP_009793550.1|  PREDICTED: solanesyl diphosphate synthase 3,...    343   4e-113   Nicotiana sylvestris
gb|AHL84161.1|  geranyl pyrophosphate synthase                          343   6e-113   Nicotiana tabacum [American tobacco]
ref|XP_006600931.1|  PREDICTED: solanesyl diphosphate synthase 3,...    338   1e-112   Glycine max [soybeans]
ref|XP_006364882.1|  PREDICTED: solanesyl diphosphate synthase 3,...    341   2e-112   Solanum tuberosum [potatoes]
gb|KHN21417.1|  Solanesyl diphosphate synthase 3, chloroplastic/m...    340   7e-112   Glycine soja [wild soybean]
ref|XP_006579912.1|  PREDICTED: solanesyl diphosphate synthase 3,...    340   7e-112   Glycine max [soybeans]
ref|XP_006600930.1|  PREDICTED: solanesyl diphosphate synthase 3,...    339   9e-112   Glycine max [soybeans]
ref|NP_001234089.1|  geranyl pyrophosphate synthase                     339   1e-111   Solanum lycopersicum
ref|XP_003550028.1|  PREDICTED: solanesyl diphosphate synthase 3,...    338   6e-111   Glycine max [soybeans]
gb|AGL91647.1|  geranyl diphosphate synthase                            335   5e-110   Catharanthus roseus [chatas]
gb|KDO75394.1|  hypothetical protein CISIN_1g014276mg                   330   2e-109   Citrus sinensis [apfelsine]
emb|CAC16851.1|  geranyl diphosphate synthase                           330   2e-109   Citrus sinensis [apfelsine]
emb|CDP04262.1|  unnamed protein product                                334   2e-109   Coffea canephora [robusta coffee]
ref|XP_006468070.1|  PREDICTED: solanesyl diphosphate synthase 3,...    330   2e-109   Citrus sinensis [apfelsine]
ref|XP_011096620.1|  PREDICTED: solanesyl diphosphate synthase 3,...    330   4e-109   Sesamum indicum [beniseed]
gb|ACC77966.1|  geranyl pyrophosphate synthase                          333   4e-109   Catharanthus roseus [chatas]
gb|EYU29662.1|  hypothetical protein MIMGU_mgv1a007049mg                333   6e-109   Erythranthe guttata [common monkey flower]
ref|XP_006448987.1|  hypothetical protein CICLE_v10015336mg             327   3e-108   
gb|KDO75385.1|  hypothetical protein CISIN_1g014276mg                   330   3e-108   Citrus sinensis [apfelsine]
ref|XP_006468067.1|  PREDICTED: solanesyl diphosphate synthase 3,...    331   3e-108   Citrus sinensis [apfelsine]
ref|XP_006468065.1|  PREDICTED: solanesyl diphosphate synthase 3,...    331   3e-108   Citrus sinensis [apfelsine]
emb|CAC20852.1|  geranyl diphosphat synthase                            330   4e-108   Quercus robur [English oak]
ref|XP_006468069.1|  PREDICTED: solanesyl diphosphate synthase 3,...    330   4e-108   Citrus sinensis [apfelsine]
ref|XP_006468068.1|  PREDICTED: solanesyl diphosphate synthase 3,...    330   5e-108   Citrus sinensis [apfelsine]
ref|XP_006468064.1|  PREDICTED: solanesyl diphosphate synthase 3,...    330   6e-108   Citrus sinensis [apfelsine]
ref|XP_011096618.1|  PREDICTED: solanesyl diphosphate synthase 3,...    330   7e-108   Sesamum indicum [beniseed]
gb|KDO75389.1|  hypothetical protein CISIN_1g014276mg                   330   8e-108   Citrus sinensis [apfelsine]
ref|XP_006468066.1|  PREDICTED: solanesyl diphosphate synthase 3,...    330   9e-108   Citrus sinensis [apfelsine]
ref|XP_007024980.1|  Geranyl diphosphate synthase 1 isoform 2           326   1e-107   Theobroma cacao [chocolate]
ref|XP_004509097.1|  PREDICTED: solanesyl diphosphate synthase 3,...    328   2e-107   Cicer arietinum [garbanzo]
ref|XP_010324777.1|  PREDICTED: geranyl pyrophosphate synthase is...    328   3e-107   
gb|AAN86061.1|  geranylgeranyl diphosphate synthase                     328   3e-107   Citrus unshiu [satsuma mandarin]
ref|XP_007155874.1|  hypothetical protein PHAVU_003G239100g             328   4e-107   Phaseolus vulgaris [French bean]
ref|XP_006448990.1|  hypothetical protein CICLE_v10015336mg             328   7e-107   
ref|XP_006448988.1|  hypothetical protein CICLE_v10015336mg             327   8e-107   Citrus clementina [clementine]
ref|XP_006448989.1|  hypothetical protein CICLE_v10015336mg             327   1e-106   Citrus clementina [clementine]
ref|XP_006448991.1|  hypothetical protein CICLE_v10015336mg             327   1e-106   Citrus clementina [clementine]
gb|AEM42978.1|  geranyl diphosphate synthase                            327   1e-106   Siraitia grosvenorii [arhat fruit]
ref|XP_010056940.1|  PREDICTED: solanesyl diphosphate synthase 3,...    326   2e-106   Eucalyptus grandis [rose gum]
ref|XP_010056939.1|  PREDICTED: solanesyl diphosphate synthase 3,...    326   2e-106   
ref|XP_010661168.1|  PREDICTED: solanesyl diphosphate synthase 3,...    322   3e-106   Vitis vinifera
ref|XP_007024979.1|  Geranyl diphosphate synthase 1 isoform 1           325   4e-106   
gb|KHG25316.1|  Solanesyl diphosphate synthase 3, chloroplastic/m...    324   5e-106   Gossypium arboreum [tree cotton]
gb|KEH31511.1|  geranylgeranyl pyrophosphate synthase                   325   8e-106   Medicago truncatula
ref|XP_007211736.1|  hypothetical protein PRUPE_ppa006211mg             324   1e-105   Prunus persica
gb|AIG15448.1|  geranyl diphosphate synthase 2                          323   2e-105   Azadirachta indica [Indian-lilac]
gb|KCW73855.1|  hypothetical protein EUGRSUZ_E02451                     326   2e-105   Eucalyptus grandis [rose gum]
ref|XP_004511880.1|  PREDICTED: solanesyl diphosphate synthase 3,...    323   3e-105   Cicer arietinum [garbanzo]
ref|XP_008439594.1|  PREDICTED: solanesyl diphosphate synthase 3,...    323   5e-105   Cucumis melo [Oriental melon]
gb|KJB07795.1|  hypothetical protein B456_001G118100                    315   6e-105   Gossypium raimondii
gb|AAR08151.1|  geranyl diphosphate synthase                            319   6e-105   Vitis vinifera
ref|XP_008225576.1|  PREDICTED: solanesyl diphosphate synthase 3,...    323   8e-105   
ref|XP_006410610.1|  hypothetical protein EUTSA_v10016708mg             318   1e-104   Eutrema salsugineum [saltwater cress]
ref|XP_008787644.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    318   1e-104   Phoenix dactylifera
ref|XP_002268229.2|  PREDICTED: solanesyl diphosphate synthase 3,...    321   2e-104   Vitis vinifera
ref|XP_009143756.1|  PREDICTED: solanesyl diphosphate synthase 3,...    317   4e-104   Brassica rapa
gb|KHG26431.1|  Solanesyl-diphosphate synthase 1, mitochondrial         320   7e-104   Gossypium arboreum [tree cotton]
ref|XP_010940826.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    316   1e-103   Elaeis guineensis
gb|KJB07794.1|  hypothetical protein B456_001G118100                    314   2e-103   Gossypium raimondii
ref|XP_004134571.1|  PREDICTED: solanesyl diphosphate synthase 3,...    318   2e-103   
gb|AAC26705.1|  putative trans-prenyltransferase                        314   2e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KJB69878.1|  hypothetical protein B456_011G047900                    325   3e-103   Gossypium raimondii
ref|XP_002530137.1|  geranylgeranyl pyrophosphate synthase, putative    318   4e-103   Ricinus communis
ref|NP_850234.1|  geranyl diphosphate synthase 1                        314   5e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KJB07793.1|  hypothetical protein B456_001G118100                    314   6e-103   Gossypium raimondii
ref|XP_004293518.1|  PREDICTED: solanesyl diphosphate synthase 3,...    318   7e-103   Fragaria vesca subsp. vesca
ref|XP_008787643.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    317   8e-103   Phoenix dactylifera
ref|XP_006410611.1|  hypothetical protein EUTSA_v10016708mg             317   1e-102   Eutrema salsugineum [saltwater cress]
gb|AFJ52721.1|  geranyl diphosphate synthase                            317   1e-102   Mangifera indica
pdb|3APZ|A  Chain A, Apo Form Of Arabidopsis Medium/long-chain Le...    314   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132994.1|  PREDICTED: solanesyl diphosphate synthase 3,...    316   2e-102   Brassica rapa
emb|CDX79569.1|  BnaC03g19050D                                          316   2e-102   
ref|XP_008371792.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    312   2e-102   
ref|XP_009143755.1|  PREDICTED: solanesyl diphosphate synthase 3,...    316   3e-102   Brassica rapa
ref|XP_010940821.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    315   3e-102   Elaeis guineensis
ref|XP_010516612.1|  PREDICTED: solanesyl diphosphate synthase 3,...    311   4e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010549511.1|  PREDICTED: solanesyl diphosphate synthase 3,...    315   5e-102   Tarenaya hassleriana [spider flower]
gb|KDP38011.1|  hypothetical protein JCGZ_04654                         314   1e-101   Jatropha curcas
ref|XP_010504929.1|  PREDICTED: solanesyl diphosphate synthase 3,...    310   1e-101   Camelina sativa [gold-of-pleasure]
gb|KJB07790.1|  hypothetical protein B456_001G118100                    313   2e-101   Gossypium raimondii
ref|XP_009360937.1|  PREDICTED: solanesyl diphosphate synthase 3,...    313   2e-101   Pyrus x bretschneideri [bai li]
gb|KJB07789.1|  hypothetical protein B456_001G118100                    313   2e-101   Gossypium raimondii
emb|CDX84296.1|  BnaC04g10580D                                          313   2e-101   
emb|CDY17271.1|  BnaA05g09170D                                          313   2e-101   Brassica napus [oilseed rape]
ref|NP_001031483.1|  geranyl diphosphate synthase 1                     313   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371791.1|  PREDICTED: solanesyl diphosphate synthase 3,...    311   3e-101   
gb|AAM13005.1|  putative trans-prenyltransferase                        313   3e-101   Arabidopsis thaliana [mouse-ear cress]
pdb|3AQ0|A  Chain A, Ligand-bound Form Of Arabidopsis Medium/long...    310   3e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CAC16849.1|  geranyl diphosphate synthase                           313   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011009605.1|  PREDICTED: solanesyl diphosphate synthase 3,...    310   4e-101   Populus euphratica
ref|XP_002308360.2|  hypothetical protein POPTR_0006s13760g             311   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_010670605.1|  PREDICTED: solanesyl diphosphate synthase 3,...    306   1e-100   
ref|XP_008371790.1|  PREDICTED: solanesyl diphosphate synthase 3,...    311   1e-100   
ref|XP_008371630.1|  PREDICTED: solanesyl diphosphate synthase 3,...    311   1e-100   
ref|XP_010540598.1|  PREDICTED: solanesyl diphosphate synthase 3,...    311   2e-100   Tarenaya hassleriana [spider flower]
ref|XP_008784837.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    306   2e-100   
dbj|BAK05302.1|  predicted protein                                      311   3e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010516611.1|  PREDICTED: solanesyl diphosphate synthase 3,...    310   3e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006293470.1|  hypothetical protein CARUB_v10023285mg             310   3e-100   Capsella rubella
ref|XP_002879508.1|  hypothetical protein ARALYDRAFT_902550             310   4e-100   Arabidopsis lyrata subsp. lyrata
gb|EMT24094.1|  Putative hexaprenyl pyrophosphate synthetase, mit...    309   5e-100   
ref|XP_010509730.1|  PREDICTED: solanesyl diphosphate synthase 3,...    310   6e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010504928.1|  PREDICTED: solanesyl diphosphate synthase 3,...    310   7e-100   Camelina sativa [gold-of-pleasure]
ref|XP_008784836.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    306   7e-100   
ref|XP_010670597.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    306   7e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007016033.1|  Geranyl diphosphate synthase 1, putative iso...    305   8e-100   
ref|XP_011009597.1|  PREDICTED: solanesyl diphosphate synthase 3,...    310   8e-100   Populus euphratica
ref|XP_011039904.1|  PREDICTED: solanesyl diphosphate synthase 3,...    306   1e-99    Populus euphratica
ref|XP_007016032.1|  Geranyl diphosphate synthase 1 isoform 2           305   2e-99    
gb|AEZ55677.1|  geranyl diphosphate synthase                            308   3e-99    Salvia miltiorrhiza [Chinese salvia]
ref|XP_009384198.1|  PREDICTED: LOW QUALITY PROTEIN: solanesyl-di...    308   4e-99    
ref|XP_011039903.1|  PREDICTED: solanesyl diphosphate synthase 3,...    306   9e-99    Populus euphratica
gb|EPS58436.1|  geranyl pyrophosphate synthase                          305   2e-98    Genlisea aurea
ref|XP_010670594.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    306   2e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007016031.1|  Geranyl diphosphate synthase 1 isoform 1           305   3e-98    
gb|KDP37498.1|  hypothetical protein JCGZ_05937                         305   5e-98    Jatropha curcas
ref|XP_010240683.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    300   1e-97    Brachypodium distachyon [annual false brome]
ref|XP_010549508.1|  PREDICTED: solanesyl diphosphate synthase 3,...    303   1e-97    Tarenaya hassleriana [spider flower]
ref|XP_004966210.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    301   3e-97    Setaria italica
ref|XP_010549506.1|  PREDICTED: solanesyl diphosphate synthase 3,...    303   3e-97    Tarenaya hassleriana [spider flower]
ref|XP_004966209.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    301   1e-96    Setaria italica
ref|XP_010275055.1|  PREDICTED: solanesyl diphosphate synthase 3,...    300   4e-96    Nelumbo nucifera [Indian lotus]
ref|XP_003563402.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    300   4e-96    Brachypodium distachyon [annual false brome]
ref|XP_002438852.1|  hypothetical protein SORBIDRAFT_10g027240          300   6e-96    Sorghum bicolor [broomcorn]
ref|XP_006378524.1|  geranyl diphosphate synthase family protein        290   1e-95    
ref|XP_006836349.1|  hypothetical protein AMTR_s00092p00100450          298   2e-95    
ref|XP_008643448.1|  PREDICTED: uncharacterized protein LOC100279...    298   2e-95    Zea mays [maize]
gb|AFW68982.1|  hypothetical protein ZEAMMB73_415581                    298   2e-95    
ref|XP_006657250.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    296   6e-95    Oryza brachyantha
ref|NP_001145807.1|  decaprenyl-diphosphate synthase subunit 1 is...    296   9e-95    Zea mays [maize]
ref|NP_001058362.1|  Os06g0678200                                       295   4e-94    
gb|EEE66217.1|  hypothetical protein OsJ_22362                          294   2e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008371815.1|  PREDICTED: solanesyl diphosphate synthase 3,...    293   5e-93    
ref|XP_007024983.1|  Geranyl diphosphate synthase 1, putative iso...    290   8e-93    
ref|XP_007024982.1|  Geranyl diphosphate synthase 1, putative iso...    290   1e-92    
ref|XP_010228271.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    285   3e-91    Brachypodium distachyon [annual false brome]
ref|XP_006659203.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    284   7e-91    
ref|XP_010549509.1|  PREDICTED: solanesyl diphosphate synthase 3,...    285   2e-90    Tarenaya hassleriana [spider flower]
gb|EEC83035.1|  hypothetical protein OsI_28120                          278   8e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_006468063.1|  PREDICTED: solanesyl diphosphate synthase 3,...    272   1e-85    Citrus sinensis [apfelsine]
ref|XP_006448992.1|  hypothetical protein CICLE_v10015559mg             270   4e-85    Citrus clementina [clementine]
ref|XP_004972656.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    263   6e-83    
gb|ACA21459.1|  geranyl diphosphate synthase 3                          266   7e-83    Picea abies
gb|AEG47694.1|  geranylgeranyl diphosphate synthase                     263   1e-82    Allium sativum
ref|XP_004972655.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    262   4e-82    
ref|XP_004972654.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    262   8e-82    Setaria italica
ref|XP_004972652.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    262   3e-81    
ref|XP_004972641.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    259   9e-81    
gb|KDO75397.1|  hypothetical protein CISIN_1g0181562mg                  249   1e-79    Citrus sinensis [apfelsine]
ref|XP_004972653.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    248   6e-76    
gb|AFK35985.1|  unknown                                                 232   2e-73    Lotus japonicus
ref|XP_010549510.1|  PREDICTED: solanesyl diphosphate synthase 3,...    237   4e-72    Tarenaya hassleriana [spider flower]
ref|XP_010275057.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    224   2e-67    Nelumbo nucifera [Indian lotus]
ref|XP_010275056.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    223   5e-67    Nelumbo nucifera [Indian lotus]
ref|XP_002975135.1|  geranyl diphosphate synthase                       222   7e-67    
ref|XP_010090457.1|  Solanesyl diphosphate synthase 3                   230   1e-66    
ref|XP_008644892.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    215   2e-64    
ref|XP_008644890.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    215   6e-64    
ref|XP_008644891.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    215   6e-64    
ref|XP_007024981.1|  Geranyl diphosphate synthase 1 isoform 3           211   8e-63    
ref|XP_002977539.1|  hypothetical protein SELMODRAFT_271252             212   2e-62    Selaginella moellendorffii
gb|KEH31512.1|  geranylgeranyl pyrophosphate synthase                   211   4e-61    Medicago truncatula
ref|XP_001753309.1|  predicted protein                                  205   1e-60    
ref|XP_002443995.1|  hypothetical protein SORBIDRAFT_07g005530          204   2e-59    
ref|XP_003078851.1|  geranyl diphosphat synthase (ISS)                  198   4e-58    
gb|ABD77587.1|  geranyl diphosphate synthase                            189   7e-57    Vitis vinifera
ref|XP_001417536.1|  predicted protein                                  196   8e-57    Ostreococcus lucimarinus CCE9901
emb|CEF97630.1|  Polyprenyl synthetase                                  198   1e-56    Ostreococcus tauri
gb|EMT09081.1|  Decaprenyl-diphosphate synthase subunit 1               198   2e-56    
ref|XP_010651670.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    187   3e-56    
ref|XP_010648078.1|  PREDICTED: solanesyl-diphosphate synthase 1,...    184   3e-54    Vitis vinifera
ref|XP_002505261.1|  predicted protein                                  183   4e-52    Micromonas commoda
gb|KDO75396.1|  hypothetical protein CISIN_1g014276mg                   179   3e-51    Citrus sinensis [apfelsine]
ref|XP_001762604.1|  predicted protein                                  181   3e-51    
ref|XP_003060355.1|  predicted protein                                  178   3e-50    Micromonas pusilla CCMP1545
gb|KDO75395.1|  hypothetical protein CISIN_1g014276mg                   179   3e-50    Citrus sinensis [apfelsine]
ref|XP_002948178.1|  hypothetical protein VOLCADRAFT_88541              174   7e-48    Volvox carteri f. nagariensis
dbj|BAF98299.1|  geranyl-diphosphate synthase                           171   3e-47    Hevea brasiliensis [jebe]
ref|XP_005651593.1|  terpenoid synthase                                 171   2e-46    Coccomyxa subellipsoidea C-169
dbj|BAF98298.1|  geranyl-diphosphate synthase                           167   8e-46    Hevea brasiliensis [jebe]
ref|XP_001691069.1|  geranyl diphosphate synthase                       167   3e-45    Chlamydomonas reinhardtii
gb|KJB68301.1|  hypothetical protein B456_010G237700                    158   8e-45    Gossypium raimondii
gb|ESA00262.1|  hypothetical protein GLOINDRAFT_69405                   167   1e-44    
ref|XP_005708177.1|  geranyl diphosphate synthase                       166   1e-44    Galdieria sulphuraria
ref|XP_007511824.1|  predicted protein                                  164   1e-43    Bathycoccus prasinos
ref|WP_019501792.1|  hypothetical protein                               160   2e-43    Pseudanabaena sp. PCC 6802
ref|WP_009786611.1|  prenyltransferase                                  160   2e-43    Lyngbya sp. PCC 8106
ref|WP_006625848.1|  MULTISPECIES: prenyltransferase                    160   3e-43    Arthrospira
ref|WP_026097328.1|  prenyltransferase                                  160   3e-43    Geitlerinema sp. PCC 7105
ref|WP_006618860.1|  solanesyl diphosphate synthase                     160   3e-43    Arthrospira platensis
gb|EWC47979.1|  mitochondrial putative hexaprenyl pyrophosphate s...    163   4e-43    Drechslerella stenobrocha 248
emb|CEP10497.1|  hypothetical protein                                   162   4e-43    Parasitella parasitica
emb|CBN74415.1|  geranyl-diphosphate synthase                           163   6e-43    Ectocarpus siliculosus
gb|ABD01445.1|  solanesyl diphosphate synthase                          159   6e-43    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_011431085.1|  prenyltransferase                                  159   6e-43    Synechococcus
gb|EIE78042.1|  hypothetical protein RO3G_02746                         162   6e-43    Rhizopus delemar RA 99-880
emb|CEG63109.1|  hypothetical protein RMATCC62417_00312                 162   7e-43    Rhizopus microsporus
ref|XP_004363243.1|  trans-prenyltransferase                            162   7e-43    Cavenderia fasciculata
ref|WP_041436149.1|  prenyltransferase                                  159   8e-43    Synechococcus sp. JA-2-3B'a(2-13)
gb|EPB89085.1|  hypothetical protein HMPREF1544_04076                   162   1e-42    Mucor circinelloides f. circinelloides 1006PhL
emb|CAD42868.1|  solanesyl pyrophosphate synthase                       161   1e-42    Mucor circinelloides f. lusitanicus
dbj|GAN11332.1|  hexaprenyl pyrophosphate synthetase                    161   2e-42    Mucor ambiguus
ref|WP_027841051.1|  prenyltransferase                                  158   2e-42    Mastigocoleus testarum
ref|WP_015200298.1|  solanesyl diphosphate synthase                     158   2e-42    Calothrix parietina
gb|AFW68984.1|  hypothetical protein ZEAMMB73_641528                    157   3e-42    
ref|XP_005845989.1|  hypothetical protein CHLNCDRAFT_58364              162   3e-42    Chlorella variabilis
emb|CDS13928.1|  hypothetical protein LRAMOSA06101                      160   3e-42    Lichtheimia ramosa
ref|WP_017320646.1|  prenyltransferase                                  157   4e-42    cyanobacterium PCC 7702
ref|WP_006635785.1|  prenyltransferase                                  157   4e-42    Microcoleus vaginatus
ref|WP_015170979.1|  solanesyl diphosphate synthase                     157   5e-42    Geitlerinema sp. PCC 7407
ref|WP_035155048.1|  prenyltransferase                                  157   6e-42    Calothrix sp. 336/3
ref|WP_015177997.1|  solanesyl diphosphate synthase                     156   7e-42    Oscillatoria nigro-viridis
gb|AFW68985.1|  hypothetical protein ZEAMMB73_641528                    155   8e-42    
ref|WP_023066251.1|  solanesyl diphosphate synthase                     156   1e-41    Lyngbya aestuarii
ref|WP_017288916.1|  prenyltransferase                                  156   1e-41    Leptolyngbya boryana
emb|CDH51283.1|  hexaprenyl pyrophosphate synthetase                    159   1e-41    Lichtheimia corymbifera JMRC:FSU:9682
emb|CCA17241.1|  conserved hypothetical protein                         159   1e-41    Albugo laibachii Nc14
gb|KFH72490.1|  hypothetical protein MVEG_02780                         159   1e-41    Mortierella verticillata NRRL 6337
ref|WP_023173513.1|  solanesyl diphosphate synthase                     155   2e-41    Gloeobacter kilaueensis
ref|XP_002594697.1|  hypothetical protein BRAFLDRAFT_240454             155   2e-41    Branchiostoma floridae
ref|XP_002594699.1|  hypothetical protein BRAFLDRAFT_240460             155   2e-41    Branchiostoma floridae
ref|XP_003292910.1|  hypothetical protein DICPUDRAFT_157686             158   2e-41    Dictyostelium purpureum
emb|CCI43550.1|  unnamed protein product                                156   3e-41    Albugo candida
ref|WP_017717726.1|  prenyltransferase                                  155   3e-41    Oscillatoria sp. PCC 10802
ref|WP_006278494.1|  prenyltransferase                                  154   4e-41    Cylindrospermopsis
ref|WP_036002195.1|  prenyltransferase                                  154   4e-41    [Leptolyngbya] sp. JSC-1
gb|ACJ76979.1|  geranyl diphosphate synthase                            151   5e-41    Linum usitatissimum
ref|WP_015117724.1|  solanesyl diphosphate synthase                     154   6e-41    Rivularia sp. PCC 7116
ref|XP_002738102.1|  PREDICTED: decaprenyl-diphosphate synthase s...    155   8e-41    Saccoglossus kowalevskii
ref|WP_037218231.1|  prenyltransferase                                  154   8e-41    
ref|WP_006511604.1|  solanesyl diphosphate synthase                     154   8e-41    Xenococcus sp. PCC 7305
emb|CCI43551.1|  unnamed protein product                                156   8e-41    Albugo candida
emb|CCX16500.1|  Similar to Probable hexaprenyl pyrophosphate syn...    156   9e-41    Pyronema omphalodes CBS 100304
gb|KFX49430.1|  putative hexaprenyl pyrophosphate synthase, mitoc...    152   1e-40    Talaromyces marneffei PM1
emb|CCI43552.1|  unnamed protein product                                156   1e-40    Albugo candida
dbj|GAM22902.1|  hypothetical protein SAMD00019534_060770               155   1e-40    Acytostelium subglobosum LB1
gb|EFA78653.1|  hypothetical protein PPL_08108                          155   1e-40    Heterostelium album PN500
ref|WP_022604134.1|  solanesyl diphosphate synthase                     153   1e-40    Rubidibacter lacunae
ref|WP_015223417.1|  solanesyl diphosphate synthase                     153   1e-40    
ref|WP_009631776.1|  solanesyl diphosphate synthase                     153   2e-40    Synechocystis sp. PCC 7509
ref|WP_006194857.1|  prenyltransferase                                  152   2e-40    Nodularia spumigena
ref|XP_002426574.1|  Decaprenyl-diphosphate synthase subunit, put...    151   2e-40    Pediculus humanus corporis [human body lice]
ref|NP_001072229.1|  prenyl (decaprenyl) diphosphate synthase, su...    152   2e-40    Xenopus tropicalis [western clawed frog]
ref|XP_008558928.1|  PREDICTED: decaprenyl-diphosphate synthase s...    154   2e-40    
gb|EFZ18648.1|  hypothetical protein SINV_14286                         148   2e-40    
ref|WP_006102917.1|  prenyltransferase                                  152   3e-40    Coleofasciculus chthonoplastes
ref|XP_002185039.1|  predicted protein                                  152   3e-40    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_027402282.1|  prenyltransferase                                  152   3e-40    Aphanizomenon flos-aquae
ref|XP_002413673.1|  geranylgeranyl pyrophosphate synthase/polypr...    148   3e-40    Ixodes scapularis [blacklegged tick]
gb|KIE13240.1|  prenyltransferase                                       152   4e-40    Tolypothrix bouteillei VB521301
ref|WP_016879091.1|  prenyltransferase                                  152   4e-40    Chlorogloeopsis fritschii
ref|XP_006005296.1|  PREDICTED: decaprenyl-diphosphate synthase s...    152   4e-40    
ref|WP_015152743.1|  solanesyl diphosphate synthase                     152   5e-40    Cyanobacteria [blue-green bacteria]
gb|AHB33635.1|  geranyl diphosphate synthase                            148   6e-40    Nigella sativa [black-caraway]
ref|XP_008613312.1|  hypothetical protein SDRG_09173                    154   6e-40    Saprolegnia diclina VS20
ref|WP_017746684.1|  prenyltransferase                                  151   6e-40    Scytonema hofmannii
ref|XP_001527979.1|  hexaprenyl pyrophosphate synthetase, mitocho...    154   7e-40    Lodderomyces elongisporus NRRL YB-4239
ref|XP_011124351.1|  hypothetical protein AOL_s00097g216                154   7e-40    Arthrobotrys oligospora ATCC 24927
ref|WP_008233376.1|  Solanesyl diphosphate synthase                     151   7e-40    Richelia intracellularis
ref|WP_028083499.1|  prenyltransferase                                  151   8e-40    Dolichospermum circinale
ref|WP_026735076.1|  prenyltransferase                                  150   1e-39    Fischerella sp. PCC 9605
ref|XP_003968183.1|  PREDICTED: decaprenyl-diphosphate synthase s...    153   1e-39    
ref|WP_039715512.1|  prenyltransferase                                  150   1e-39    
ref|XP_011111758.1|  hypothetical protein H072_5955                     154   1e-39    
ref|WP_015212813.1|  solanesyl diphosphate synthase                     150   1e-39    Anabaena cylindrica
ref|WP_015225072.1|  solanesyl diphosphate synthase                     150   1e-39    Halothece sp. PCC 7418
ref|XP_009273486.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   2e-39    Aptenodytes forsteri
ref|XP_005906532.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   2e-39    Bos mutus
ref|XP_005932179.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   2e-39    Haplochromis burtoni
ref|WP_017294884.1|  hypothetical protein                               150   2e-39    Geminocystis herdmanii
ref|WP_016865073.1|  prenyltransferase                                  150   2e-39    Fischerella muscicola
ref|XP_006139834.1|  PREDICTED: decaprenyl-diphosphate synthase s...    152   2e-39    
ref|WP_016517315.1|  Heptaprenyl diphosphate synthase component 2       150   2e-39    Microcystis aeruginosa
emb|CAG05473.1|  unnamed protein product                                152   2e-39    
ref|WP_002767149.1|  prenyltransferase                                  150   3e-39    
ref|XP_010016922.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   3e-39    
ref|XP_006063273.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   3e-39    
gb|KFQ53333.1|  Decaprenyl-diphosphate synthase subunit 1               148   3e-39    
tpg|DAA23563.1|  TPA: prenyl diphosphate synthase, subunit 1            152   3e-39    
gb|KFO88925.1|  Decaprenyl-diphosphate synthase subunit 1               148   3e-39    
ref|XP_009327394.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   3e-39    
ref|XP_002152564.1|  hexaprenyl pyrophosphate synthetase Coq1, pu...    152   3e-39    
gb|KHN80395.1|  Decaprenyl-diphosphate synthase subunit 1               152   3e-39    
gb|KFX49431.1|  putative hexaprenyl pyrophosphate synthase, mitoc...    152   3e-39    
ref|NP_001093801.1|  decaprenyl-diphosphate synthase subunit 1          151   3e-39    
ref|WP_002785711.1|  prenyltransferase                                  149   3e-39    
ref|XP_007875295.1|  hypothetical protein PNEG_03229                    152   3e-39    
ref|XP_005730523.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   3e-39    
ref|XP_008490937.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   4e-39    
ref|XP_006634187.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   4e-39    
ref|WP_015228234.1|  solanesyl diphosphate synthase                     149   4e-39    
emb|CBN82151.1|  Decaprenyl-diphosphate synthase subunit 1              151   4e-39    
ref|WP_012630183.1|  prenyltransferase                                  149   4e-39    
ref|XP_010133130.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   4e-39    
ref|WP_002784493.1|  Prenyl transferase                                 149   4e-39    
ref|XP_005449097.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   4e-39    
ref|XP_009273485.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   4e-39    
ref|XP_005932177.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   4e-39    
ref|WP_002775476.1|  prenyltransferase                                  149   5e-39    
ref|XP_005730522.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   5e-39    
ref|WP_002733070.1|  solanesyl diphosphate synthase                     149   5e-39    
ref|XP_006625167.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   5e-39    
ref|XP_006799308.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   5e-39    
ref|XP_004551944.1|  PREDICTED: decaprenyl-diphosphate synthase s...    151   5e-39    
ref|WP_009626336.1|  solanesyl diphosphate synthase                     149   6e-39    
ref|XP_008870257.1|  solanesyl diphosphate synthase                     150   6e-39    
dbj|GAM43730.1|  Coq1 homolog                                           151   7e-39    
ref|XP_010005263.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   7e-39    
ref|XP_009327392.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   7e-39    
ref|XP_009040626.1|  hypothetical protein AURANDRAFT_32168              148   7e-39    
ref|XP_396188.3|  PREDICTED: decaprenyl-diphosphate synthase subu...    145   8e-39    
ref|WP_002801789.1|  prenyltransferase                                  148   8e-39    
ref|XP_007780777.1|  hexaprenyl pyrophosphate synthase, mitochond...    151   8e-39    
ref|XP_010751066.1|  PREDICTED: decaprenyl-diphosphate synthase s...    150   9e-39    
ref|XP_009061578.1|  hypothetical protein LOTGIDRAFT_219858             150   9e-39    
gb|ENN72690.1|  hypothetical protein YQE_10785                          145   1e-38    
ref|WP_009458040.1|  MULTISPECIES: prenyltransferase                    148   1e-38    
ref|XP_006259691.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   1e-38    
ref|WP_017319262.1|  prenyltransferase                                  148   1e-38    
ref|XP_010287400.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-38    
ref|XP_005233935.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   1e-38    
gb|KFQ76997.1|  Decaprenyl-diphosphate synthase subunit 1               146   1e-38    
ref|WP_015124430.1|  solanesyl diphosphate synthase                     148   1e-38    
ref|WP_011244051.1|  prenyltransferase                                  148   1e-38    
ref|XP_009567606.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   1e-38    
ref|WP_008198915.1|  prenyltransferase                                  148   1e-38    
ref|WP_009556969.1|  solanesyl diphosphate synthase                     148   1e-38    
gb|KFP00057.1|  Decaprenyl-diphosphate synthase subunit 1               149   1e-38    
ref|WP_015080667.1|  solanesyl diphosphate synthase                     148   1e-38    
gb|KFM04785.1|  Decaprenyl-diphosphate synthase subunit 1               149   1e-38    
ref|XP_007526883.1|  PREDICTED: decaprenyl-diphosphate synthase s...    150   1e-38    
ref|XP_009584028.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   1e-38    
ref|WP_026102771.1|  prenyltransferase                                  147   2e-38    
ref|XP_004081222.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   2e-38    
ref|XP_008637466.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   2e-38    
ref|XP_005687924.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   2e-38    
ref|XP_004933931.1|  PREDICTED: decaprenyl-diphosphate synthase s...    144   2e-38    
ref|XP_002166810.2|  PREDICTED: decaprenyl-diphosphate synthase s...    143   2e-38    
ref|WP_011378426.1|  MULTISPECIES: prenyltransferase                    147   2e-38    
ref|XP_006498254.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   2e-38    
gb|KDO29097.1|  hypothetical protein SPRG_06153                         150   2e-38    
gb|KFU96657.1|  Decaprenyl-diphosphate synthase subunit 1               148   2e-38    
ref|XP_001217401.1|  decaprenyl-diphosphate synthase subunit 1          150   2e-38    
ref|WP_002749205.1|  solanesyl diphosphate synthase                     147   2e-38    
ref|XP_005153141.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   2e-38    
ref|XP_010765891.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   2e-38    
ref|WP_002761730.1|  prenyltransferase                                  147   2e-38    
ref|XP_009968387.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   2e-38    
ref|WP_010994273.1|  prenyltransferase                                  147   2e-38    
ref|XP_007058546.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   2e-38    
ref|XP_005111077.1|  PREDICTED: decaprenyl-diphosphate synthase s...    150   2e-38    
ref|XP_010902019.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   2e-38    
ref|XP_009295511.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   2e-38    
ref|XP_010074382.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   2e-38    
gb|KFU98523.1|  Decaprenyl-diphosphate synthase subunit 1               145   2e-38    
ref|XP_009863110.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   2e-38    
ref|XP_004314309.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   2e-38    
gb|KFW70669.1|  Decaprenyl-diphosphate synthase subunit 1               148   2e-38    
ref|XP_009295510.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   2e-38    
ref|XP_006025427.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   2e-38    
ref|XP_010902017.1|  PREDICTED: decaprenyl-diphosphate synthase s...    149   3e-38    
gb|EJK49857.1|  hypothetical protein THAOC_31224                        150   3e-38    
ref|NP_001017656.1|  decaprenyl-diphosphate synthase subunit 1          149   3e-38    
ref|WP_039748206.1|  prenyltransferase                                  147   3e-38    
ref|WP_017327928.1|  hypothetical protein                               147   3e-38    
ref|XP_003738162.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   3e-38    
ref|XP_002189942.2|  PREDICTED: decaprenyl-diphosphate synthase s...    147   3e-38    
ref|WP_026722200.1|  prenyltransferase                                  147   3e-38    
ref|WP_015187302.1|  solanesyl diphosphate synthase                     147   3e-38    
ref|XP_009084131.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   3e-38    
ref|WP_015161190.1|  solanesyl diphosphate synthase                     147   4e-38    
ref|XP_011400157.1|  Decaprenyl-diphosphate synthase                    147   4e-38    
ref|XP_010339548.1|  PREDICTED: decaprenyl-diphosphate synthase s...    144   4e-38    
ref|XP_005162562.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   4e-38    
ref|XP_005423926.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   4e-38    
gb|EGI60261.1|  Decaprenyl-diphosphate synthase subunit 1               147   4e-38    
ref|WP_015112413.1|  solanesyl diphosphate synthase                     146   4e-38    
emb|CDQ89357.1|  unnamed protein product                                148   4e-38    
ref|XP_781598.3|  PREDICTED: decaprenyl-diphosphate synthase subu...    145   4e-38    
ref|XP_005972179.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   4e-38    
gb|KFW12082.1|  Decaprenyl-diphosphate synthase subunit 1               147   5e-38    
ref|WP_011318292.1|  prenyltransferase                                  146   5e-38    
ref|XP_010152687.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   5e-38    
ref|WP_006516684.1|  solanesyl diphosphate synthase                     146   5e-38    
ref|XP_008210205.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   5e-38    
ref|XP_003222159.2|  PREDICTED: decaprenyl-diphosphate synthase s...    148   5e-38    
ref|XP_005480395.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   5e-38    
gb|AAL68276.1|  RE18374p                                                144   5e-38    
ref|XP_011159100.1|  PREDICTED: decaprenyl-diphosphate synthase s...    148   5e-38    
ref|WP_015127194.1|  solanesyl diphosphate synthase                     146   6e-38    
gb|EHJ73898.1|  hypothetical protein KGM_09593                          148   6e-38    
ref|XP_641356.1|  hypothetical protein DDB_G0280293                     149   6e-38    
ref|XP_010160531.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   6e-38    
ref|XP_008928331.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   6e-38    
gb|EJW88485.1|  polyprenyl synthetase                                   145   6e-38    
gb|EFA81752.1|  trans-prenyltransferase                                 149   6e-38    
ref|XP_005252496.1|  PREDICTED: decaprenyl-diphosphate synthase s...    144   6e-38    
gb|KIJ81028.1|  prenyltransferase                                       146   7e-38    
ref|XP_008485914.1|  PREDICTED: decaprenyl-diphosphate synthase s...    142   7e-38    
ref|WP_015191899.1|  solanesyl diphosphate synthase                     146   7e-38    
ref|XP_010125783.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   7e-38    
gb|AAD24462.1|AF118855_1  trans-prenyltransferase                       146   7e-38    
ref|XP_004014256.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   7e-38    
ref|XP_008829970.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   7e-38    
gb|EZA48064.1|  Decaprenyl-diphosphate synthase subunit                 146   8e-38    
emb|CCJ29207.1|  unnamed protein product                                147   8e-38    
gb|ELK16993.1|  Decaprenyl-diphosphate synthase subunit 1               145   8e-38    
ref|XP_009950855.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   8e-38    
gb|KFP58630.1|  Decaprenyl-diphosphate synthase subunit 1               147   8e-38    
ref|XP_009819667.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   8e-38    
ref|XP_006115331.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   8e-38    
ref|XP_001824458.1|  hexaprenyl pyrophosphate synthase                  148   8e-38    
ref|WP_009343446.1|  prenyltransferase                                  145   9e-38    
ref|XP_009912407.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   9e-38    
gb|KFP84422.1|  Decaprenyl-diphosphate synthase subunit 1               146   9e-38    
ref|XP_008938599.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   9e-38    
ref|XP_001270631.1|  hexaprenyl pyrophosphate synthetase Coq1, pu...    148   9e-38    
gb|EOA97970.1|  Decaprenyl-diphosphate synthase subunit 1               146   9e-38    
ref|XP_010339546.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   9e-38    
ref|XP_005518788.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   9e-38    
ref|WP_006529606.1|  solanesyl diphosphate synthase                     145   1e-37    
ref|XP_007167446.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_005040742.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_009896856.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_004537885.1|  PREDICTED: decaprenyl-diphosphate synthase s...    144   1e-37    
gb|EMC77842.1|  Decaprenyl-diphosphate synthase subunit 1               146   1e-37    
ref|XP_418592.4|  PREDICTED: decaprenyl-diphosphate synthase subu...    146   1e-37    
ref|XP_009677905.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   1e-37    
ref|XP_009943402.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_005857036.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_009072544.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_008210204.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   1e-37    
ref|XP_005024225.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_010307275.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_011062768.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   1e-37    
ref|WP_011610049.1|  prenyltransferase                                  145   1e-37    
ref|XP_006100321.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|WP_026100406.1|  prenyltransferase                                  145   1e-37    
ref|XP_011505543.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   1e-37    
gb|KFZ66166.1|  Decaprenyl-diphosphate synthase subunit 1               146   1e-37    
ref|XP_009632836.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_004691381.1|  PREDICTED: LOW QUALITY PROTEIN: decaprenyl-d...    147   1e-37    
ref|XP_009499252.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_009677903.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
gb|ELK25145.1|  Decaprenyl-diphosphate synthase subunit 1               146   1e-37    
ref|XP_002290353.1|  predicted protein                                  145   1e-37    
ref|XP_008161086.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_003135935.1|  polyprenyl synthetase                              146   1e-37    
ref|XP_006498252.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
emb|CDQ67243.1|  unnamed protein product                                147   1e-37    
ref|XP_009888863.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
ref|XP_005513868.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   1e-37    
gb|KFV08510.1|  Decaprenyl-diphosphate synthase subunit 1               145   2e-37    
gb|AAI07274.2|  Pdss1 protein                                           146   2e-37    
ref|XP_009698135.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   2e-37    
ref|XP_501989.1|  YALI0C18755p                                          147   2e-37    
ref|XP_008210202.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   2e-37    
ref|XP_004425342.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   2e-37    
gb|AAI07275.2|  Pdss1 protein                                           146   2e-37    
gb|EDL83936.1|  rCG40823, isoform CRA_b                                 147   2e-37    
ref|XP_005837037.1|  geranylgeranyl pyrophosphate synthase              146   2e-37    
ref|XP_004275933.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   2e-37    
gb|EDL08142.1|  prenyl (solanesyl) diphosphate synthase, subunit 1      146   2e-37    
ref|XP_009823053.1|  hypothetical protein H257_01501                    147   2e-37    
ref|XP_007471429.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   2e-37    
dbj|GAL95476.1|  solanesyl diphosphate synthase                         145   2e-37    
gb|AAI58696.1|  Unknown (protein for IMAGE:9025778)                     146   2e-37    
dbj|BAK62531.1|  decaprenyl-diphosphate synthase subunit 1              144   2e-37    
ref|WP_012306211.1|  MULTISPECIES: prenyltransferase                    145   2e-37    
ref|XP_003771901.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   2e-37    
ref|XP_009467315.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   2e-37    
ref|XP_005320451.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   2e-37    
ref|XP_009478768.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   2e-37    
ref|XP_001602352.2|  PREDICTED: decaprenyl-diphosphate synthase s...    147   2e-37    
ref|XP_007471430.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   2e-37    
ref|XP_004275932.1|  PREDICTED: decaprenyl-diphosphate synthase s...    147   2e-37    
ref|XP_009975830.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   2e-37    
ref|NP_062374.2|  decaprenyl-diphosphate synthase subunit 1             146   2e-37    
ref|XP_001263839.1|  hexaprenyl pyrophosphate synthetase Coq1, pu...    147   2e-37    
gb|EFX81004.1|  hypothetical protein DAPPUDRAFT_318059                  146   2e-37    
ref|XP_005290959.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   2e-37    
ref|XP_010224535.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   2e-37    
ref|WP_015204259.1|  solanesyl diphosphate synthase                     144   2e-37    
ref|XP_011348717.1|  PREDICTED: decaprenyl-diphosphate synthase s...    146   2e-37    
gb|EFB17871.1|  hypothetical protein PANDA_017357                       145   3e-37    
ref|XP_006933389.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   3e-37    
ref|XP_011233411.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   3e-37    
ref|XP_001898591.1|  Polyprenyl synthetase family protein               145   3e-37    
ref|XP_006993556.1|  PREDICTED: decaprenyl-diphosphate synthase s...    145   3e-37    
gb|ETN70092.1|  hypothetical protein NECAME_01040                       140   3e-37    
ref|WP_044105959.1|  prenyltransferase                                  144   3e-37    
ref|XP_001762387.1|  predicted protein                                  145   3e-37    
dbj|BAP17279.1|  solanesyl diphosphate synthase                         144   3e-37    
ref|XP_010588968.1|  PREDICTED: LOW QUALITY PROTEIN: decaprenyl-d...    146   3e-37    



>ref|XP_009600021.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Nicotiana tomentosiformis]
Length=372

 Score =   345 bits (885),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSD+RCSM+YYMQKTYYKTASLISNSCKAIALLAG TAEVS++AF+YGKNLG
Sbjct  192  GETMQMTTSSDERCSMDYYMQKTYYKTASLISNSCKAIALLAGHTAEVSMLAFDYGKNLG  251

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+PQLR VVD+GFDDP NV
Sbjct  252  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFPQLRTVVDRGFDDPVNV  311

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQRTRELA KHANLAS A+DSLPESDDEDVQRSRRALVELTQRVITRT
Sbjct  312  EIALDYLGKSRGIQRTRELARKHANLASAAVDSLPESDDEDVQRSRRALVELTQRVITRT  371

Query  216  K  214
            K
Sbjct  372  K  372



>ref|XP_009600023.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X3 [Nicotiana tomentosiformis]
Length=364

 Score =   345 bits (884),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSD+RCSM+YYMQKTYYKTASLISNSCKAIALLAG TAEVS++AF+YGKNLG
Sbjct  184  GETMQMTTSSDERCSMDYYMQKTYYKTASLISNSCKAIALLAGHTAEVSMLAFDYGKNLG  243

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+PQLR VVD+GFDDP NV
Sbjct  244  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFPQLRTVVDRGFDDPVNV  303

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQRTRELA KHANLAS A+DSLPESDDEDVQRSRRALVELTQRVITRT
Sbjct  304  EIALDYLGKSRGIQRTRELARKHANLASAAVDSLPESDDEDVQRSRRALVELTQRVITRT  363

Query  216  K  214
            K
Sbjct  364  K  364



>ref|XP_009793552.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X3 [Nicotiana sylvestris]
Length=364

 Score =   343 bits (881),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMTTSSD+RCSMEYYMQKTYYKTASLISNSCKAIALLAG TAEVS++AF+YGKNLG
Sbjct  184  GEIMQMTTSSDERCSMEYYMQKTYYKTASLISNSCKAIALLAGHTAEVSMLAFDYGKNLG  243

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+PQLR VVD+GFDDP NV
Sbjct  244  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFPQLRTVVDRGFDDPVNV  303

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQRTRELA KHANLAS A+D+LPESDDEDVQRSRRALVELTQRVITRT
Sbjct  304  EIALDYLGKSRGIQRTRELARKHANLASAAVDALPESDDEDVQRSRRALVELTQRVITRT  363

Query  216  K  214
            K
Sbjct  364  K  364



>ref|XP_009793551.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Nicotiana sylvestris]
Length=372

 Score =   343 bits (881),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMTTSSD+RCSMEYYMQKTYYKTASLISNSCKAIALLAG TAEVS++AF+YGKNLG
Sbjct  192  GEIMQMTTSSDERCSMEYYMQKTYYKTASLISNSCKAIALLAGHTAEVSMLAFDYGKNLG  251

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+PQLR VVD+GFDDP NV
Sbjct  252  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFPQLRTVVDRGFDDPVNV  311

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQRTRELA KHANLAS A+D+LPESDDEDVQRSRRALVELTQRVITRT
Sbjct  312  EIALDYLGKSRGIQRTRELARKHANLASAAVDALPESDDEDVQRSRRALVELTQRVITRT  371

Query  216  K  214
            K
Sbjct  372  K  372



>ref|XP_009600020.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
Length=415

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSD+RCSM+YYMQKTYYKTASLISNSCKAIALLAG TAEVS++AF+YGKNLG
Sbjct  235  GETMQMTTSSDERCSMDYYMQKTYYKTASLISNSCKAIALLAGHTAEVSMLAFDYGKNLG  294

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+PQLR VVD+GFDDP NV
Sbjct  295  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFPQLRTVVDRGFDDPVNV  354

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQRTRELA KHANLAS A+DSLPESDDEDVQRSRRALVELTQRVITRT
Sbjct  355  EIALDYLGKSRGIQRTRELARKHANLASAAVDSLPESDDEDVQRSRRALVELTQRVITRT  414

Query  216  K  214
            K
Sbjct  415  K  415



>ref|XP_006579913.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Glycine max]
Length=322

 Score =   340 bits (872),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYYMQKTYYKTASLISNSCKAIA+LAGQTAEV+++AFEYGKNLG
Sbjct  142  GETMQMTTTSDQRCSMEYYMQKTYYKTASLISNSCKAIAILAGQTAEVAMLAFEYGKNLG  201

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR +VD+GF++P NV
Sbjct  202  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRTIVDEGFENPANV  261

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLGKSRGIQRTRELA +HANLA+ AIDSLPESDDEDV++SR+AL++LT RVITRT
Sbjct  262  DLALEYLGKSRGIQRTRELAVEHANLAAAAIDSLPESDDEDVRKSRKALIDLTHRVITRT  321

Query  216  K  214
            K
Sbjct  322  K  322



>ref|XP_009793550.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Nicotiana sylvestris]
Length=415

 Score =   343 bits (880),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMTTSSD+RCSMEYYMQKTYYKTASLISNSCKAIALLAG TAEVS++AF+YGKNLG
Sbjct  235  GEIMQMTTSSDERCSMEYYMQKTYYKTASLISNSCKAIALLAGHTAEVSMLAFDYGKNLG  294

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+PQLR VVD+GFDDP NV
Sbjct  295  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFPQLRTVVDRGFDDPVNV  354

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQRTRELA KHANLAS A+D+LPESDDEDVQRSRRALVELTQRVITRT
Sbjct  355  EIALDYLGKSRGIQRTRELARKHANLASAAVDALPESDDEDVQRSRRALVELTQRVITRT  414

Query  216  K  214
            K
Sbjct  415  K  415



>gb|AHL84161.1| geranyl pyrophosphate synthase [Nicotiana tabacum]
Length=415

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMTTSSD+RCSMEYYMQKTYYKTASLISNSCKAIALLAG TAEVS++AF+YGKNLG
Sbjct  235  GEIMQMTTSSDERCSMEYYMQKTYYKTASLISNSCKAIALLAGHTAEVSMLAFDYGKNLG  294

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+PQLR VVD+GFDDP NV
Sbjct  295  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFPQLRTVVDRGFDDPVNV  354

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQRTRELA KHANLAS A+D+LPESDDEDVQRSRRALVELTQRVITRT
Sbjct  355  EIALDYLGKSRGIQRTRELARKHANLASAAVDALPESDDEDVQRSRRALVELTQRVITRT  414

Query  216  K  214
            K
Sbjct  415  K  415



>ref|XP_006600931.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X3 [Glycine max]
Length=322

 Score =   338 bits (868),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYYMQKTYYKTASLISNSCKAIA+LAGQTAEV+++AFEYGKNLG
Sbjct  142  GETMQMTTTSDQRCSMEYYMQKTYYKTASLISNSCKAIAILAGQTAEVAMLAFEYGKNLG  201

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR +VD+GF++P NV
Sbjct  202  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRAIVDEGFENPANV  261

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLGKSRGIQRTRELA +HANLA+ AIDSLPE+DDEDV++SR+AL++LT RVITRT
Sbjct  262  DLALEYLGKSRGIQRTRELAVEHANLAAAAIDSLPENDDEDVRKSRKALIDLTHRVITRT  321

Query  216  K  214
            K
Sbjct  322  K  322



>ref|XP_006364882.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=415

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSD+RCSMEYYMQKTYYKTASLISNSCKAIALLAG TAEVSV+AF+YGKNLG
Sbjct  235  GETMQMTTSSDERCSMEYYMQKTYYKTASLISNSCKAIALLAGHTAEVSVLAFDYGKNLG  294

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+PQLR +VD+GFDDP NV
Sbjct  295  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFPQLRTLVDRGFDDPVNV  354

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQRTRELA KHA+LAS AIDSLPESDDE+VQRSRRALVELT RVITRT
Sbjct  355  EIALDYLGKSRGIQRTRELARKHASLASAAIDSLPESDDEEVQRSRRALVELTHRVITRT  414

Query  216  K  214
            K
Sbjct  415  K  415



>gb|KHN21417.1| Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Glycine soja]
Length=420

 Score =   340 bits (872),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYYMQKTYYKTASLISNSCKAIA+LAGQTAEV+++AFEYGKNLG
Sbjct  240  GETMQMTTTSDQRCSMEYYMQKTYYKTASLISNSCKAIAILAGQTAEVAMLAFEYGKNLG  299

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR +VD+GF++P NV
Sbjct  300  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRTIVDEGFENPANV  359

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLGKSRGIQRTRELA +HANLA+ AIDSLPESDDEDV++SR+AL++LT RVITRT
Sbjct  360  DLALEYLGKSRGIQRTRELAVEHANLAAAAIDSLPESDDEDVRKSRKALIDLTHRVITRT  419

Query  216  K  214
            K
Sbjct  420  K  420



>ref|XP_006579912.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Glycine max]
Length=420

 Score =   340 bits (872),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYYMQKTYYKTASLISNSCKAIA+LAGQTAEV+++AFEYGKNLG
Sbjct  240  GETMQMTTTSDQRCSMEYYMQKTYYKTASLISNSCKAIAILAGQTAEVAMLAFEYGKNLG  299

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR +VD+GF++P NV
Sbjct  300  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRTIVDEGFENPANV  359

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLGKSRGIQRTRELA +HANLA+ AIDSLPESDDEDV++SR+AL++LT RVITRT
Sbjct  360  DLALEYLGKSRGIQRTRELAVEHANLAAAAIDSLPESDDEDVRKSRKALIDLTHRVITRT  419

Query  216  K  214
            K
Sbjct  420  K  420



>ref|XP_006600930.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Glycine max]
Length=393

 Score =   339 bits (869),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYYMQKTYYKTASLISNSCKAIA+LAGQTAEV+++AFEYGKNLG
Sbjct  213  GETMQMTTTSDQRCSMEYYMQKTYYKTASLISNSCKAIAILAGQTAEVAMLAFEYGKNLG  272

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR +VD+GF++P NV
Sbjct  273  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRAIVDEGFENPANV  332

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLGKSRGIQRTRELA +HANLA+ AIDSLPE+DDEDV++SR+AL++LT RVITRT
Sbjct  333  DLALEYLGKSRGIQRTRELAVEHANLAAAAIDSLPENDDEDVRKSRKALIDLTHRVITRT  392

Query  216  K  214
            K
Sbjct  393  K  393



>ref|NP_001234089.1| geranyl pyrophosphate synthase [Solanum lycopersicum]
 gb|ABB88703.1| geranyl pyrophosphate synthase [Solanum lycopersicum]
Length=415

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSD+RCSMEYYMQKTYYKTASLISNSCKAIALLAG +AEVSV+AF+YGKNLG
Sbjct  235  GETMQMTTSSDERCSMEYYMQKTYYKTASLISNSCKAIALLAGHSAEVSVLAFDYGKNLG  294

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+PQLR +VD+GFDDP NV
Sbjct  295  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFPQLRTLVDRGFDDPVNV  354

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQRTRELA KHA+LAS AIDSLPESDDE+VQRSRRALVELT RVITRT
Sbjct  355  EIALDYLGKSRGIQRTRELARKHASLASAAIDSLPESDDEEVQRSRRALVELTHRVITRT  414

Query  216  K  214
            K
Sbjct  415  K  415



>ref|XP_003550028.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Glycine max]
 gb|KHN27059.1| Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Glycine soja]
Length=419

 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYYMQKTYYKTASLISNSCKAIA+LAGQTAEV+++AFEYGKNLG
Sbjct  239  GETMQMTTTSDQRCSMEYYMQKTYYKTASLISNSCKAIAILAGQTAEVAMLAFEYGKNLG  298

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR +VD+GF++P NV
Sbjct  299  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRAIVDEGFENPANV  358

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLGKSRGIQRTRELA +HANLA+ AIDSLPE+DDEDV++SR+AL++LT RVITRT
Sbjct  359  DLALEYLGKSRGIQRTRELAVEHANLAAAAIDSLPENDDEDVRKSRKALIDLTHRVITRT  418

Query  216  K  214
            K
Sbjct  419  K  419



>gb|AGL91647.1| geranyl diphosphate synthase [Catharanthus roseus]
Length=420

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQT+EV+++A+EYGKNLG
Sbjct  240  GETMQMTTTSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTSEVAMLAYEYGKNLG  299

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFA+EE+P+LR VVD+GF++P NV
Sbjct  300  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAIEEFPELRAVVDEGFENPYNV  359

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLAL YLGKSRGIQRTRELA KHANLASDAIDSLP +DDE V RSRRALVELTQRVITR 
Sbjct  360  DLALHYLGKSRGIQRTRELAIKHANLASDAIDSLPVTDDEHVLRSRRALVELTQRVITRR  419

Query  216  K  214
            K
Sbjct  420  K  420



>gb|KDO75394.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=322

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  142  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  201

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  202  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  261

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  262  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  321

Query  216  K  214
            K
Sbjct  322  K  322



>emb|CAC16851.1| geranyl diphosphate synthase [Citrus sinensis]
Length=321

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  141  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  201  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  261  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>emb|CDP04262.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S+QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEV+++A++YGKNLG
Sbjct  248  GETMQMTTTSEQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAYDYGKNLG  307

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDI HGI+TAPILFA+EE+P+LR +VD+GFD+P NV
Sbjct  308  LAFQLIDDVLDFTGTSASLGKGSLSDISHGIITAPILFAIEEFPELRSIVDRGFDNPTNV  367

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLGKS+GI+RTRELAT HANLAS AIDSLPESDDE+V +SRRALVELTQRVITRT
Sbjct  368  DLALEYLGKSKGIERTRELATMHANLASAAIDSLPESDDENVLKSRRALVELTQRVITRT  427

Query  216  K  214
            K
Sbjct  428  K  428



>ref|XP_006468070.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X7 [Citrus sinensis]
 gb|KDO75390.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
 gb|KDO75391.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
 gb|KDO75392.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
 gb|KDO75393.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=321

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  141  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  201  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  261  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_011096620.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Sesamum indicum]
Length=321

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRC+MEYYMQKTYYKTASLISNSCKAIALLAGQTAEVS++A+EYGKNLG
Sbjct  141  GETMQMTTTSDQRCNMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSILAYEYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTS +LGKGSLSDIRHGI+TAPILFAMEE+P+LR VV++GFD   NV
Sbjct  201  LAYQLIDDVLDFTGTSTSLGKGSLSDIRHGIITAPILFAMEEFPELRTVVNEGFDSSANV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D ALEYLGKSRGIQRTRELA KHA+LAS AIDS PE++DE+VQRSRRALVELT RVITRT
Sbjct  261  DRALEYLGKSRGIQRTRELAAKHASLASAAIDSFPENNDENVQRSRRALVELTHRVITRT  320

Query  216  K  214
            K
Sbjct  321  K  321



>gb|ACC77966.1| geranyl pyrophosphate synthase [Catharanthus roseus]
 gb|AHA82035.1| geranyl pyrophosphate synthase [Catharanthus roseus]
Length=420

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYYMQKTYY TASLISNSCKAIALLAGQT+EV+++A+EYGKNLG
Sbjct  240  GETMQMTTTSDQRCSMEYYMQKTYYMTASLISNSCKAIALLAGQTSEVAMLAYEYGKNLG  299

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFA+EE+P+LR VVD+GF++P NV
Sbjct  300  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAIEEFPELRAVVDEGFENPYNV  359

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLAL YLGKSRGIQRTRELA KHANLASDAIDSLP +DDE V RSRRALVELTQRVITR 
Sbjct  360  DLALHYLGKSRGIQRTRELAIKHANLASDAIDSLPVTDDEHVLRSRRALVELTQRVITRR  419

Query  216  K  214
            K
Sbjct  420  K  420



>gb|EYU29662.1| hypothetical protein MIMGU_mgv1a007049mg [Erythranthe guttata]
Length=421

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCK+IALLAGQT+EVSV+A++YGKNLG
Sbjct  241  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKSIALLAGQTSEVSVLAYDYGKNLG  300

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTS +LGKGSLSDIRHGIVTAPILFAMEE+P+LRDVVD+GFD+  NV
Sbjct  301  LAFQLIDDVLDFTGTSTSLGKGSLSDIRHGIVTAPILFAMEEFPELRDVVDEGFDNSANV  360

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLG+S+GI+RTRELA KHA+LAS A+DS PE+DDEDVQRSRRALVELT RVI RT
Sbjct  361  DLALEYLGRSKGIERTRELAAKHASLASAAVDSFPENDDEDVQRSRRALVELTHRVINRT  420

Query  216  K  214
            K
Sbjct  421  K  421



>ref|XP_006448987.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
 gb|ESR62227.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
Length=321

 Score =   327 bits (839),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  141  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDI+HGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  201  LAYQLIDDVLDFTGTSASLGKGSLSDIQHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AID LPE++DEDV++SRRAL++LT RVITR 
Sbjct  261  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDCLPENNDEDVRKSRRALLDLTHRVITRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>gb|KDO75385.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=395

 Score =   330 bits (846),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  215  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  274

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  275  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  334

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  335  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  394

Query  216  K  214
            K
Sbjct  395  K  395



>ref|XP_006468067.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X4 [Citrus sinensis]
Length=425

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  245  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  304

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  305  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  364

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  365  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  424

Query  216  K  214
            K
Sbjct  425  K  425



>ref|XP_006468065.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=427

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  247  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  306

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  307  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  366

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  367  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  426

Query  216  K  214
            K
Sbjct  427  K  427



>emb|CAC20852.1| geranyl diphosphat synthase [Quercus robur]
Length=416

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+ +QRCSMEYYMQKTYYKTASLISNSCKAIALL GQT+EV+++A+EYGKNLG
Sbjct  236  GETMQMTTTCEQRCSMEYYMQKTYYKTASLISNSCKAIALLGGQTSEVAMLAYEYGKNLG  295

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR+VVD+GFDDP NV
Sbjct  296  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLREVVDRGFDDPANV  355

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+AL+YLGKSRGIQR RELA KHAN+A++AIDSLPES+DEDV++SRRAL++LT+RVITRT
Sbjct  356  DVALDYLGKSRGIQRARELAKKHANIAAEAIDSLPESNDEDVRKSRRALLDLTERVITRT  415

Query  216  K  214
            K
Sbjct  416  K  416



>ref|XP_006468069.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X6 [Citrus sinensis]
 gb|KDO75386.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=419

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  239  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  298

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  299  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  358

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  359  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  418

Query  216  K  214
            K
Sbjct  419  K  419



>ref|XP_006468068.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X5 [Citrus sinensis]
 gb|KDO75387.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=421

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  241  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  300

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  301  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  360

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  361  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  420

Query  216  K  214
            K
Sbjct  421  K  421



>ref|XP_006468064.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=432

 Score =   330 bits (847),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  252  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  311

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  312  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  371

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  372  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  431

Query  216  K  214
            K
Sbjct  432  K  432



>ref|XP_011096618.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Sesamum indicum]
Length=423

 Score =   330 bits (846),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRC+MEYYMQKTYYKTASLISNSCKAIALLAGQTAEVS++A+EYGKNLG
Sbjct  243  GETMQMTTTSDQRCNMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSILAYEYGKNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTS +LGKGSLSDIRHGI+TAPILFAMEE+P+LR VV++GFD   NV
Sbjct  303  LAYQLIDDVLDFTGTSTSLGKGSLSDIRHGIITAPILFAMEEFPELRTVVNEGFDSSANV  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D ALEYLGKSRGIQRTRELA KHA+LAS AIDS PE++DE+VQRSRRALVELT RVITRT
Sbjct  363  DRALEYLGKSRGIQRTRELAAKHASLASAAIDSFPENNDENVQRSRRALVELTHRVITRT  422

Query  216  K  214
            K
Sbjct  423  K  423



>gb|KDO75389.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=427

 Score =   330 bits (846),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  247  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  306

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  307  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  366

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  367  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  426

Query  216  K  214
            K
Sbjct  427  K  427



>ref|XP_006468066.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X3 [Citrus sinensis]
 gb|KDO75388.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=426

 Score =   330 bits (846),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  246  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  305

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  306  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  365

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV +SRRAL++LT RVITR 
Sbjct  366  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVTKSRRALLDLTHRVITRN  425

Query  216  K  214
            K
Sbjct  426  K  426



>ref|XP_007024980.1| Geranyl diphosphate synthase 1 isoform 2 [Theobroma cacao]
 gb|EOY27602.1| Geranyl diphosphate synthase 1 isoform 2 [Theobroma cacao]
Length=321

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSS+QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AFEYGK+LG
Sbjct  141  GETMQMTTSSEQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVAMLAFEYGKHLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDI+HGIVTAPILFAMEE+PQL  +V QGFD+P NV
Sbjct  201  LAFQLIDDVLDFTGTSASLGKGSLSDIQHGIVTAPILFAMEEFPQLHAIVYQGFDNPENV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS GIQRTRELA KHANLA+ AI+SLPES+DE V++SRRALV+LTQRVI R 
Sbjct  261  DIALEYLGKSDGIQRTRELAMKHANLAAAAIESLPESNDEQVRKSRRALVDLTQRVIMRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_004509097.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Cicer arietinum]
Length=416

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYYM+KTYYKTASLISNSCKAIA+LAGQTAEV++ AFEYGKNLG
Sbjct  236  GETMQMTTTSDQRCSMEYYMEKTYYKTASLISNSCKAIAILAGQTAEVAMFAFEYGKNLG  295

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR++V++GF++P NV
Sbjct  296  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLREIVEEGFENPDNV  355

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++ALEYLGKSRG+Q+T+ELA KHANLA++AIDSLPESDDE+V++SR+ALV+LT  VITRT
Sbjct  356  NIALEYLGKSRGLQKTKELAVKHANLAAEAIDSLPESDDEEVRKSRKALVDLTHIVITRT  415

Query  216  K  214
            K
Sbjct  416  K  416



>ref|XP_010324777.1| PREDICTED: geranyl pyrophosphate synthase isoform X1 [Solanum 
lycopersicum]
Length=431

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 175/197 (89%), Gaps = 16/197 (8%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNL-  580
            GETMQMTTSSD+RCSMEYYMQKTYYKTASLISNSCKAIALLAG +AEVSV+AF+YGKNL 
Sbjct  235  GETMQMTTSSDERCSMEYYMQKTYYKTASLISNSCKAIALLAGHSAEVSVLAFDYGKNLV  294

Query  579  ---------------GLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYP  445
                           GLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL+AMEE+P
Sbjct  295  CIIFCCESYLILFMQGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILYAMEEFP  354

Query  444  QLRDVVDQGFDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQR  265
            QLR +VD+GFDDP NV++AL+YLGKSRGIQRTRELA KHA+LAS AIDSLPESDDE+VQR
Sbjct  355  QLRTLVDRGFDDPVNVEIALDYLGKSRGIQRTRELARKHASLASAAIDSLPESDDEEVQR  414

Query  264  SRRALVELTQRVITRTK  214
            SRRALVELT RVITRTK
Sbjct  415  SRRALVELTHRVITRTK  431



>gb|AAN86061.1| geranylgeranyl diphosphate synthase [Citrus unshiu]
Length=426

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  246  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  305

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDI+HGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  306  LAYQLIDDVLDFTGTSASLGKGSLSDIQHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  365

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AIDSLPE++DEDV++SRRAL++LT RVITR 
Sbjct  366  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDSLPENNDEDVRKSRRALLDLTHRVITRN  425

Query  216  K  214
            K
Sbjct  426  K  426



>ref|XP_007155874.1| hypothetical protein PHAVU_003G239100g [Phaseolus vulgaris]
 gb|ESW27868.1| hypothetical protein PHAVU_003G239100g [Phaseolus vulgaris]
Length=419

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQ+CSMEYYMQKTYYKTASLISNSCKAIA+LAGQT EV+++AFEYGKNLG
Sbjct  239  GETMQMTTTSDQQCSMEYYMQKTYYKTASLISNSCKAIAILAGQTTEVAILAFEYGKNLG  298

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSL+DI+HGIVTAPILFAMEE+PQLR +VD+GF++P N+
Sbjct  299  LAFQLIDDVLDFTGTSASLGKGSLTDIQHGIVTAPILFAMEEFPQLRAIVDEGFENPANI  358

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YLGKSRGIQRTRELA +HANLA+ AIDSLP+SDDE+V+RSR+AL++LT RVITRT
Sbjct  359  ELALDYLGKSRGIQRTRELAVEHANLAAAAIDSLPDSDDEEVRRSRKALIDLTHRVITRT  418

Query  216  K  214
            K
Sbjct  419  K  419



>ref|XP_006448990.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
 gb|ESR62230.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
Length=427

 Score =   328 bits (840),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  247  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  306

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDI+HGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  307  LAYQLIDDVLDFTGTSASLGKGSLSDIQHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  366

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AID LPE++DEDV++SRRAL++LT RVITR 
Sbjct  367  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDCLPENNDEDVRKSRRALLDLTHRVITRN  426

Query  216  K  214
            K
Sbjct  427  K  427



>ref|XP_006448988.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
 gb|ESR62228.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
Length=419

 Score =   327 bits (839),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  239  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  298

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDI+HGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  299  LAYQLIDDVLDFTGTSASLGKGSLSDIQHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  358

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AID LPE++DEDV++SRRAL++LT RVITR 
Sbjct  359  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDCLPENNDEDVRKSRRALLDLTHRVITRN  418

Query  216  K  214
            K
Sbjct  419  K  419



>ref|XP_006448989.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
 gb|ESR62229.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
Length=421

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  241  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  300

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDI+HGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  301  LAYQLIDDVLDFTGTSASLGKGSLSDIQHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  360

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AID LPE++DEDV++SRRAL++LT RVITR 
Sbjct  361  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDCLPENNDEDVRKSRRALLDLTHRVITRN  420

Query  216  K  214
            K
Sbjct  421  K  421



>ref|XP_006448991.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
 gb|ESR62231.1| hypothetical protein CICLE_v10015336mg [Citrus clementina]
Length=426

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  246  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  305

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDI+HGI+TAPILFAMEE+PQLR VV+QGF+D  NV
Sbjct  306  LAYQLIDDVLDFTGTSASLGKGSLSDIQHGIITAPILFAMEEFPQLRTVVEQGFEDSSNV  365

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQ+TRELA KHANLA+ AID LPE++DEDV++SRRAL++LT RVITR 
Sbjct  366  DIALEYLGKSRGIQKTRELAVKHANLAAAAIDCLPENNDEDVRKSRRALLDLTHRVITRN  425

Query  216  K  214
            K
Sbjct  426  K  426



>gb|AEM42978.1| geranyl diphosphate synthase [Siraitia grosvenorii]
Length=423

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQR SMEYYMQKTYYKTASLISNSCKA+ALLAGQTAEV+++A+EYGKNLG
Sbjct  243  GETMQMTTTSDQRYSMEYYMQKTYYKTASLISNSCKAVALLAGQTAEVAILAYEYGKNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+LFAMEE+PQLR VV++GFD+P N+
Sbjct  303  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPLLFAMEEFPQLRTVVERGFDNPENI  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+A+++LGKSRGIQR RELA KHANLA++AIDSLPE+DDEDV++SR+ALV+LTQRV+TRT
Sbjct  363  DIAMDFLGKSRGIQRARELAAKHANLAAEAIDSLPENDDEDVRKSRKALVDLTQRVVTRT  422

Query  216  K  214
            K
Sbjct  423  K  423



>ref|XP_010056940.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Eucalyptus grandis]
Length=417

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+SSDQ CSMEYYMQKTYYKTASLISNSCKAIA+LAGQT EV+++A+EYG+NLG
Sbjct  237  GETMQMTSSSDQHCSMEYYMQKTYYKTASLISNSCKAIAILAGQTTEVAMLAYEYGRNLG  296

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAP+LFAMEE+PQLR VVD+GFDDP NV
Sbjct  297  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPMLFAMEEFPQLRTVVDRGFDDPANV  356

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLG+SRGIQR RELA KHA LA+ AIDSLPESDDEDV++SRRALV+LT  VITR 
Sbjct  357  DLALEYLGRSRGIQRARELAKKHAELAATAIDSLPESDDEDVRKSRRALVDLTHIVITRN  416

Query  216  K  214
            K
Sbjct  417  K  417



>ref|XP_010056939.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Eucalyptus grandis]
Length=418

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+SSDQ CSMEYYMQKTYYKTASLISNSCKAIA+LAGQT EV+++A+EYG+NLG
Sbjct  238  GETMQMTSSSDQHCSMEYYMQKTYYKTASLISNSCKAIAILAGQTTEVAMLAYEYGRNLG  297

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAP+LFAMEE+PQLR VVD+GFDDP NV
Sbjct  298  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPMLFAMEEFPQLRTVVDRGFDDPANV  357

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLG+SRGIQR RELA KHA LA+ AIDSLPESDDEDV++SRRALV+LT  VITR 
Sbjct  358  DLALEYLGRSRGIQRARELAKKHAELAATAIDSLPESDDEDVRKSRRALVDLTHIVITRN  417

Query  216  K  214
            K
Sbjct  418  K  418



>ref|XP_010661168.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Vitis vinifera]
Length=321

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+QR SMEYY+QKTYYKTASLISNSCKAIALLAGQTAEVS++AFEYGKNLG
Sbjct  141  GETMQMTSTSEQRVSMEYYLQKTYYKTASLISNSCKAIALLAGQTAEVSMLAFEYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFA+EE+PQL  VV +G D+P ++
Sbjct  201  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAIEEFPQLDAVVKRGLDNPADI  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLAL+YLGKSRGIQRTRELA KHANLA++AIDSLPES DEDV RSRRAL++LT RVITRT
Sbjct  261  DLALDYLGKSRGIQRTRELAMKHANLAAEAIDSLPESGDEDVLRSRRALIDLTHRVITRT  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_007024979.1| Geranyl diphosphate synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY27601.1| Geranyl diphosphate synthase 1 isoform 1 [Theobroma cacao]
Length=418

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSS+QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AFEYGK+LG
Sbjct  238  GETMQMTTSSEQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVAMLAFEYGKHLG  297

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDI+HGIVTAPILFAMEE+PQL  +V QGFD+P NV
Sbjct  298  LAFQLIDDVLDFTGTSASLGKGSLSDIQHGIVTAPILFAMEEFPQLHAIVYQGFDNPENV  357

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS GIQRTRELA KHANLA+ AI+SLPES+DE V++SRRALV+LTQRVI R 
Sbjct  358  DIALEYLGKSDGIQRTRELAMKHANLAAAAIESLPESNDEQVRKSRRALVDLTQRVIMRN  417

Query  216  K  214
            K
Sbjct  418  K  418



>gb|KHG25316.1| Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
-like protein [Gossypium arboreum]
Length=388

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSS+QRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  208  GETMQMTTSSEQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAMLAFEYGKNLG  267

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDI+ GIVTAPILFAMEE+PQL  +V QGFD+P N+
Sbjct  268  LAFQLIDDVLDFTGTSASLGKGSLSDIQQGIVTAPILFAMEEFPQLHAIVYQGFDNPENI  327

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++ALEYLGKS GI+RT+ELA KHANLA+ AIDSLPES+DE+V RSRRALV+LTQRVITR 
Sbjct  328  EIALEYLGKSHGIERTKELAMKHANLAAAAIDSLPESNDENVIRSRRALVDLTQRVITRN  387

Query  216  K  214
            K
Sbjct  388  K  388



>gb|KEH31511.1| geranylgeranyl pyrophosphate synthase [Medicago truncatula]
Length=417

 Score =   325 bits (832),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMTT+SDQRCSMEYYM+KTYYKTASLISNSCKAIA+LAGQTAEV+V+AFEYGKNLG
Sbjct  237  GEIMQMTTTSDQRCSMEYYMEKTYYKTASLISNSCKAIAILAGQTAEVAVLAFEYGKNLG  296

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDI+HGIVTAPILFAMEE+PQLR +V++GF++P NV
Sbjct  297  LAFQLIDDVLDFTGTSASLGKGSLSDIQHGIVTAPILFAMEEFPQLRAIVEEGFENPENV  356

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKSRGIQ+T+ELA KHA+LA++AIDSLPE+D+E+V++SR+ALVELTQ VITRT
Sbjct  357  NIALDYLGKSRGIQKTKELAMKHASLAAEAIDSLPENDNEEVRKSRKALVELTQIVITRT  416

Query  216  K  214
            K
Sbjct  417  K  417



>ref|XP_007211736.1| hypothetical protein PRUPE_ppa006211mg [Prunus persica]
 gb|EMJ12935.1| hypothetical protein PRUPE_ppa006211mg [Prunus persica]
Length=422

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYY+QKTY+KTASLISNSCKAIA+LAG TAEV+++AFEYGKNLG
Sbjct  242  GETMQMTTTSDQRCSMEYYIQKTYFKTASLISNSCKAIAILAGHTAEVAMLAFEYGKNLG  301

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTS +LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGFD+P NV
Sbjct  302  LAFQLIDDVLDFTGTSTSLGKGSLSDIRHGIITAPILFAMEEFPQLRAVVEQGFDNPANV  361

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YLG+S GI RTRELATKHANLA+ AI+SLPES+DEDV+RSRRAL++LT  VITRT
Sbjct  362  ELALDYLGRSHGIHRTRELATKHANLAASAIESLPESEDEDVRRSRRALLDLTHIVITRT  421

Query  216  K  214
            K
Sbjct  422  K  422



>gb|AIG15448.1| geranyl diphosphate synthase 2 [Azadirachta indica]
Length=420

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+++QR SM+YYMQKTYYKTASLISNSCKAIALLAGQT EV+++AF+YGKNLG
Sbjct  240  GETMQMTTTAEQRRSMDYYMQKTYYKTASLISNSCKAIALLAGQTTEVAMLAFDYGKNLG  299

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+P+LR VVD+GFDDP NV
Sbjct  300  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPELRKVVDKGFDDPSNV  359

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQRTRELA KHANLA+ A+DSLPES+D+DV++SRRAL++L QRVITR 
Sbjct  360  DIALEYLGKSRGIQRTRELAQKHANLATVALDSLPESNDDDVKKSRRALLDLAQRVITRN  419

Query  216  K  214
            K
Sbjct  420  K  420



>gb|KCW73855.1| hypothetical protein EUGRSUZ_E02451 [Eucalyptus grandis]
Length=495

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+SSDQ CSMEYYMQKTYYKTASLISNSCKAIA+LAGQT EV+++A+EYG+NLG
Sbjct  315  GETMQMTSSSDQHCSMEYYMQKTYYKTASLISNSCKAIAILAGQTTEVAMLAYEYGRNLG  374

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAP+LFAMEE+PQLR VVD+GFDDP NV
Sbjct  375  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPMLFAMEEFPQLRTVVDRGFDDPANV  434

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLG+SRGIQR RELA KHA LA+ AIDSLPESDDEDV++SRRALV+LT  VITR 
Sbjct  435  DLALEYLGRSRGIQRARELAKKHAELAATAIDSLPESDDEDVRKSRRALVDLTHIVITRN  494

Query  216  K  214
            K
Sbjct  495  K  495



>ref|XP_004511880.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Cicer arietinum]
Length=425

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+T+SDQR SMEYYMQKTYYKTASLISNSCKAIA+LAGQTA+V+++AF+YGKNLG
Sbjct  245  GETMQMSTTSDQRFSMEYYMQKTYYKTASLISNSCKAIAILAGQTADVAMLAFDYGKNLG  304

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTS +LGKGSLSDIRHGIVTAPILFAMEE+PQLR VV++GFD+  NV
Sbjct  305  LAFQLIDDVLDFTGTSTSLGKGSLSDIRHGIVTAPILFAMEEFPQLRAVVEEGFDNQENV  364

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
             LALEYLGKS GI+RTRELA KHANLA+ AIDSLPE+DDE+VQRSRRALV+LT RVITRT
Sbjct  365  HLALEYLGKSSGIERTRELAIKHANLAAAAIDSLPENDDEEVQRSRRALVDLTHRVITRT  424

Query  216  K  214
            K
Sbjct  425  K  425



>ref|XP_008439594.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Cucumis melo]
Length=423

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQR SMEYYMQKTYYKTASLISNSCK++ALLAGQTAEV+++A+EYGKNLG
Sbjct  243  GETMQMTTTSDQRYSMEYYMQKTYYKTASLISNSCKSVALLAGQTAEVAMLAYEYGKNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDI HGI+TAP+LFAMEE+PQLR VV++GFD+P NV
Sbjct  303  LAYQLIDDVLDFTGTSASLGKGSLSDIHHGIITAPLLFAMEEFPQLRTVVERGFDNPENV  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++A+EYLGKSRGIQR RELA  HANLA++AIDSLPE++DEDV++SRRALV+LTQRVITRT
Sbjct  363  NIAMEYLGKSRGIQRARELAAMHANLAAEAIDSLPENNDEDVRKSRRALVDLTQRVITRT  422

Query  216  K  214
            K
Sbjct  423  K  423



>gb|KJB07795.1| hypothetical protein B456_001G118100 [Gossypium raimondii]
Length=221

 Score =   315 bits (808),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+S++R SMEYYMQKTY KTASL+SNSCK++ALLAG T  ++++AFEYGKNLG
Sbjct  41   GETMQLTTASNKRFSMEYYMQKTYNKTASLMSNSCKSVALLAGHTTVIAMLAFEYGKNLG  100

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEEYPQLR VVD+GFD+P NV
Sbjct  101  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEYPQLRAVVDKGFDNPANV  160

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGI+RT+ELA KHANLA+ AI+SLP+SDDEDV +SR+AL++LTQRVITR 
Sbjct  161  DMALEYLGKSRGIERTKELAMKHANLAAAAIESLPQSDDEDVIKSRQALIDLTQRVITRN  220

Query  216  K  214
            K
Sbjct  221  K  221



>gb|AAR08151.1| geranyl diphosphate synthase [Vitis vinifera]
Length=321

 Score =   319 bits (817),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+QR SMEYY+QKTYYKTASLISNSCKAIALLAGQTAEVS++AFEYGKNLG
Sbjct  141  GETMQMTSTSEQRVSMEYYLQKTYYKTASLISNSCKAIALLAGQTAEVSMLAFEYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD LDFTGTSA+LGKGSLSDIRHGI+TAPILFA+EE+PQL  VV +G D+P ++
Sbjct  201  LAFQLIDDXLDFTGTSASLGKGSLSDIRHGIITAPILFAIEEFPQLDAVVKRGLDNPADI  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLAL+YLG+SRGIQRTRELA KHANLA++AIDSLPES DEDV RSRRAL++LT RVITRT
Sbjct  261  DLALDYLGRSRGIQRTRELAMKHANLAAEAIDSLPESGDEDVLRSRRALIDLTHRVITRT  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_008225576.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Prunus mume]
Length=455

 Score =   323 bits (828),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSMEYY+QKTY+KTASLISNSCKAIA+LAG TAEV+++AFEYGKNLG
Sbjct  275  GETMQMTTTSDQRCSMEYYIQKTYFKTASLISNSCKAIAILAGHTAEVAMLAFEYGKNLG  334

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV+QGFD+P NV
Sbjct  335  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRAVVEQGFDNPANV  394

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YLG+S GI RTRELATKHANLA+ AI+SLPES+DEDV+RSRRAL++LT  VITR 
Sbjct  395  ELALDYLGRSHGIHRTRELATKHANLAASAIESLPESEDEDVRRSRRALLDLTHIVITRI  454

Query  216  K  214
            K
Sbjct  455  K  455



>ref|XP_006410610.1| hypothetical protein EUTSA_v10016708mg [Eutrema salsugineum]
 gb|ESQ52063.1| hypothetical protein EUTSA_v10016708mg [Eutrema salsugineum]
Length=321

 Score =   318 bits (816),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT++++QR SM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  141  GEVMQMTSTTEQRHSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAMLAFEYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR V+DQ  DDP NV
Sbjct  201  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRKVIDQLEDDPTNV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++ALEYLGKS GIQRTRELA +HANLA+ AI SLPE+DDEDV+RSRRAL++LT RVITR 
Sbjct  261  EIALEYLGKSNGIQRTRELAMEHANLAAAAIGSLPETDDEDVKRSRRALIDLTHRVITRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_008787644.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
Length=321

 Score =   318 bits (816),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S+QR SMEYY+QKTYYKTASLISNSCKAIALLAGQTAEVSV+A++YG+NLG
Sbjct  141  GETMQMTTTSEQRSSMEYYLQKTYYKTASLISNSCKAIALLAGQTAEVSVLAYDYGRNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQL +VVD+GFD P +V
Sbjct  201  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLHEVVDRGFDSPSDV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+AL+YLGKSRGI+RTRELA +HAN A +AID+LPESDDEDV  SRRALV+LT RVITRT
Sbjct  261  DIALDYLGKSRGIERTRELAAEHANRAVEAIDALPESDDEDVLISRRALVDLTHRVITRT  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_002268229.2| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Vitis vinifera]
 emb|CBI40000.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+QR SMEYY+QKTYYKTASLISNSCKAIALLAGQTAEVS++AFEYGKNLG
Sbjct  242  GETMQMTSTSEQRVSMEYYLQKTYYKTASLISNSCKAIALLAGQTAEVSMLAFEYGKNLG  301

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFA+EE+PQL  VV +G D+P ++
Sbjct  302  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAIEEFPQLDAVVKRGLDNPADI  361

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLAL+YLGKSRGIQRTRELA KHANLA++AIDSLPES DEDV RSRRAL++LT RVITRT
Sbjct  362  DLALDYLGKSRGIQRTRELAMKHANLAAEAIDSLPESGDEDVLRSRRALIDLTHRVITRT  421

Query  216  K  214
            K
Sbjct  422  K  422



>ref|XP_009143756.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Brassica rapa]
Length=322

 Score =   317 bits (812),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+++DQR SM+YYMQKTYYKTASLISNSCKAIALLAGQ+AEV+ +AFEYG+NLG
Sbjct  142  GETMQMTSTTDQRHSMDYYMQKTYYKTASLISNSCKAIALLAGQSAEVATLAFEYGRNLG  201

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VVDQ   DP NV
Sbjct  202  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVDQLEKDPTNV  261

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQRTRELA +HANLA+ AI SLPE+DDEDV+RSRRAL++LT RVI+R 
Sbjct  262  DIALEYLGKSKGIQRTRELAIEHANLAAAAIGSLPETDDEDVKRSRRALIDLTHRVISRN  321

Query  216  K  214
            K
Sbjct  322  K  322



>gb|KHG26431.1| Solanesyl-diphosphate synthase 1, mitochondrial [Gossypium arboreum]
Length=420

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+S++R SMEYYMQKTY KTASL+SNSCK++ALLAG TAE++++AFEYGKNLG
Sbjct  240  GETMQLTTASNKRFSMEYYMQKTYNKTASLMSNSCKSVALLAGHTAEIAMLAFEYGKNLG  299

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEEYPQLR VVD+GFD+P NV
Sbjct  300  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEYPQLRAVVDKGFDNPANV  359

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGI+RT+ELA KHANLA+ AIDSLP+SDDEDV +SR+AL++LTQRVITR 
Sbjct  360  DIALEYLGKSRGIERTKELAMKHANLAAAAIDSLPQSDDEDVIKSRQALIDLTQRVITRN  419

Query  216  K  214
            K
Sbjct  420  K  420



>ref|XP_010940826.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X2 [Elaeis guineensis]
Length=321

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+T+S+QRCSMEYY+QKTYYKTASLISNSCKAIALLAGQTAEVS++A+EYG+NLG
Sbjct  141  GETMQMSTTSEQRCSMEYYLQKTYYKTASLISNSCKAIALLAGQTAEVSMLAYEYGRNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTS +LGKGSLSDIRHGIVTAPILFA+EE+PQLR++V++GFD+P +V
Sbjct  201  LAFQLIDDVLDFTGTSVSLGKGSLSDIRHGIVTAPILFAIEEFPQLRELVERGFDNPNDV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D AL+YLGKSRGIQRT+ELA +HAN A  AI++LP SDDED+Q SRRALV+LT RVITRT
Sbjct  261  DAALDYLGKSRGIQRTKELAQEHANRAVKAIEALPYSDDEDIQMSRRALVDLTHRVITRT  320

Query  216  K  214
            K
Sbjct  321  K  321



>gb|KJB07794.1| hypothetical protein B456_001G118100 [Gossypium raimondii]
Length=294

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+S++R SMEYYMQKTY KTASL+SNSCK++ALLAG T  ++++AFEYGKNLG
Sbjct  114  GETMQLTTASNKRFSMEYYMQKTYNKTASLMSNSCKSVALLAGHTTVIAMLAFEYGKNLG  173

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEEYPQLR VVD+GFD+P NV
Sbjct  174  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEYPQLRAVVDKGFDNPANV  233

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGI+RT+ELA KHANLA+ AI+SLP+SDDEDV +SR+AL++LTQRVITR 
Sbjct  234  DMALEYLGKSRGIERTKELAMKHANLAAAAIESLPQSDDEDVIKSRQALIDLTQRVITRN  293

Query  216  K  214
            K
Sbjct  294  K  294



>ref|XP_004134571.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 ref|XP_004158644.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Cucumis sativus]
 gb|KGN49423.1| hypothetical protein Csa_6G524610 [Cucumis sativus]
Length=423

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQR SMEYYMQKTYYKTASLISNSCK++ALLAGQTAEV+++A+EYGKNLG
Sbjct  243  GETMQMTTTSDQRYSMEYYMQKTYYKTASLISNSCKSVALLAGQTAEVAMLAYEYGKNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDI HGI+TAP+LFAMEE+PQLR VV++GFD+  NV
Sbjct  303  LAYQLIDDVLDFTGTSASLGKGSLSDIHHGIITAPLLFAMEEFPQLRTVVERGFDNTENV  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+A+EYLGKS GIQR RELA  HANLA++AIDSLPE++DEDV++SRRALV+LTQRVITRT
Sbjct  363  DIAMEYLGKSHGIQRARELAAMHANLAAEAIDSLPENNDEDVRKSRRALVDLTQRVITRT  422

Query  216  K  214
            K
Sbjct  423  K  423



>gb|AAC26705.1| putative trans-prenyltransferase [Arabidopsis thaliana]
Length=297

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T+S++QR SM+YYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYG+NLG
Sbjct  117  GETMEITSSTEQRYSMDYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLG  176

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVDQ   DPRNV
Sbjct  177  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVEKDPRNV  236

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  237  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  296

Query  216  K  214
            K
Sbjct  297  K  297



>gb|KJB69878.1| hypothetical protein B456_011G047900 [Gossypium raimondii]
Length=643

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSS+QRCSM+YY+QKTYYKTASLISNSCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  463  GETMQMTTSSEQRCSMDYYIQKTYYKTASLISNSCKAIALLAGQTAEVAMLAFEYGKNLG  522

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDI+ GIVTAPILFAMEE+PQL  +V QGFD+P N+
Sbjct  523  LAFQLIDDVLDFTGTSASLGKGSLSDIQQGIVTAPILFAMEEFPQLHAIVYQGFDNPENI  582

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++ALEYLGKS GIQRTRELA KHANLA+ AIDSLPES+DE+V RSRRALV+LTQRVITR 
Sbjct  583  EIALEYLGKSHGIQRTRELAMKHANLAAAAIDSLPESNDENVIRSRRALVDLTQRVITRN  642

Query  216  K  214
            K
Sbjct  643  K  643



>ref|XP_002530137.1| geranylgeranyl pyrophosphate synthase, putative [Ricinus communis]
 gb|EEF32253.1| geranylgeranyl pyrophosphate synthase, putative [Ricinus communis]
Length=417

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  237  GETMQMTSTSEQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVAMLAFEYGKNLG  296

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR VVD+GFD P NV
Sbjct  297  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRAVVDRGFDKPGNV  356

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQRTRELA KHANLA+ AIDSLPE+DDE+V++SRRALV+LTQRVITR 
Sbjct  357  DIALEYLGKSRGIQRTRELAAKHANLAAAAIDSLPETDDEEVRKSRRALVDLTQRVITRN  416

Query  216  K  214
            K
Sbjct  417  K  417



>ref|NP_850234.1| geranyl diphosphate synthase 1 [Arabidopsis thaliana]
 gb|AEC09000.1| geranyl diphosphate synthase 1 [Arabidopsis thaliana]
Length=321

 Score =   314 bits (804),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T+S++QR SM+YYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYG+NLG
Sbjct  141  GETMEITSSTEQRYSMDYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVDQ   DPRNV
Sbjct  201  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVEKDPRNV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  261  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>gb|KJB07793.1| hypothetical protein B456_001G118100 [Gossypium raimondii]
Length=321

 Score =   314 bits (804),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+S++R SMEYYMQKTY KTASL+SNSCK++ALLAG T  ++++AFEYGKNLG
Sbjct  141  GETMQLTTASNKRFSMEYYMQKTYNKTASLMSNSCKSVALLAGHTTVIAMLAFEYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEEYPQLR VVD+GFD+P NV
Sbjct  201  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEYPQLRAVVDKGFDNPANV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGI+RT+ELA KHANLA+ AI+SLP+SDDEDV +SR+AL++LTQRVITR 
Sbjct  261  DMALEYLGKSRGIERTKELAMKHANLAAAAIESLPQSDDEDVIKSRQALIDLTQRVITRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_004293518.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Fragaria vesca subsp. vesca]
Length=430

 Score =   318 bits (814),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT +DQRCSMEYY++KTYYKTASLISNSCKAIA+LAG T EV+++AF+YGKNLG
Sbjct  250  GETMQMTTEADQRCSMEYYIEKTYYKTASLISNSCKAIAILAGHTTEVAMLAFDYGKNLG  309

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR VV+QGFD+P NV
Sbjct  310  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRAVVEQGFDNPANV  369

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YLGKS GIQRTRELA KHA+LA++AI+SLPES DEDV RSRRAL++LT  VITRT
Sbjct  370  EIALDYLGKSNGIQRTRELARKHASLAAEAIESLPESHDEDVLRSRRALLDLTHIVITRT  429

Query  216  K  214
            K
Sbjct  430  K  430



>ref|XP_008787643.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=419

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S+QR SMEYY+QKTYYKTASLISNSCKAIALLAGQTAEVSV+A++YG+NLG
Sbjct  239  GETMQMTTTSEQRSSMEYYLQKTYYKTASLISNSCKAIALLAGQTAEVSVLAYDYGRNLG  298

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQL +VVD+GFD P +V
Sbjct  299  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLHEVVDRGFDSPSDV  358

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+AL+YLGKSRGI+RTRELA +HAN A +AID+LPESDDEDV  SRRALV+LT RVITRT
Sbjct  359  DIALDYLGKSRGIERTRELAAEHANRAVEAIDALPESDDEDVLISRRALVDLTHRVITRT  418

Query  216  K  214
            K
Sbjct  419  K  419



>ref|XP_006410611.1| hypothetical protein EUTSA_v10016708mg [Eutrema salsugineum]
 gb|ESQ52064.1| hypothetical protein EUTSA_v10016708mg [Eutrema salsugineum]
Length=423

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT++++QR SM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  243  GEVMQMTSTTEQRHSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAMLAFEYGKNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR V+DQ  DDP NV
Sbjct  303  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRKVIDQLEDDPTNV  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++ALEYLGKS GIQRTRELA +HANLA+ AI SLPE+DDEDV+RSRRAL++LT RVITR 
Sbjct  363  EIALEYLGKSNGIQRTRELAMEHANLAAAAIGSLPETDDEDVKRSRRALIDLTHRVITRN  422

Query  216  K  214
            K
Sbjct  423  K  423



>gb|AFJ52721.1| geranyl diphosphate synthase [Mangifera indica]
Length=421

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQ+AEV+++AFE+GKNLG
Sbjct  241  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQSAEVAMLAFEFGKNLG  300

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR V+DQGF++P NV
Sbjct  301  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRAVIDQGFENPSNV  360

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQRTRELAT HANLA+ AID+LP++D+E+V++SRRAL++LTQRVITR 
Sbjct  361  DVALEYLGKSRGIQRTRELATNHANLAAAAIDALPKTDNEEVRKSRRALLDLTQRVITRN  420

Query  216  K  214
            K
Sbjct  421  K  421



>pdb|3APZ|A Chain A, Apo Form Of Arabidopsis Medium/long-chain Length Prenyl 
Pyrophosphate Synthase
 pdb|3APZ|B Chain B, Apo Form Of Arabidopsis Medium/long-chain Length Prenyl 
Pyrophosphate Synthase
Length=348

 Score =   314 bits (804),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T+S++QR SM+YYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYG+NLG
Sbjct  168  GETMEITSSTEQRYSMDYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLG  227

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVDQ   DPRNV
Sbjct  228  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVEKDPRNV  287

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  288  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  347

Query  216  K  214
            K
Sbjct  348  K  348



>ref|XP_009132994.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Brassica rapa]
 emb|CDX84638.1| BnaA03g15920D [Brassica napus]
Length=425

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+++DQR SM+YYMQKTYYKTASLISNSCKA+ALLAGQ+AEV+++AFEYGKNLG
Sbjct  245  GETMQMTSTTDQRHSMDYYMQKTYYKTASLISNSCKAVALLAGQSAEVAMLAFEYGKNLG  304

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR+VV Q   DP NV
Sbjct  305  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRNVVGQLEKDPTNV  364

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS GIQRTRELA +HANLA+ AI SLPE+DDEDV+RSRRAL++LT RVITR 
Sbjct  365  DIALEYLGKSNGIQRTRELAMEHANLAAAAIGSLPETDDEDVKRSRRALIDLTHRVITRN  424

Query  216  K  214
            K
Sbjct  425  K  425



>emb|CDX79569.1| BnaC03g19050D [Brassica napus]
Length=427

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+++DQR SM+YYMQKTYYKTASLISNSCKA+ALLAGQ+AEV+V+AFEYGKNLG
Sbjct  247  GETMQMTSTTDQRHSMDYYMQKTYYKTASLISNSCKAVALLAGQSAEVAVLAFEYGKNLG  306

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VV Q   DP NV
Sbjct  307  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRKVVGQLEKDPTNV  366

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS GIQRTR+LA +HANLA+ AI SLPE+DDEDV+RSRRALV+LT RVITR 
Sbjct  367  DIALEYLGKSNGIQRTRDLAMEHANLAAAAIGSLPETDDEDVKRSRRALVDLTHRVITRN  426

Query  216  K  214
            K
Sbjct  427  K  427



>ref|XP_008371792.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X3 [Malus domestica]
Length=321

 Score =   312 bits (800),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 171/182 (94%), Gaps = 1/182 (1%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+SDQRCSMEYY+QKTYYKTASLISNSCKAIA+LAG T EV+++A+EYGKNLG
Sbjct  140  GETMQITTTSDQRCSMEYYIQKTYYKTASLISNSCKAIAVLAGHTXEVAMLAYEYGKNLG  199

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFD-DPRN  400
            LAFQLIDDVLDF GTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR VV+QG D +P N
Sbjct  200  LAFQLIDDVLDFMGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRMVVEQGLDNNPAN  259

Query  399  VDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            ++LAL+YLG+SRGI RTRELATKHANLA+ AI+SLPES D++V++SRRAL++LTQ VITR
Sbjct  260  IELALDYLGRSRGIHRTRELATKHANLAAAAIESLPESKDKNVRKSRRALLDLTQVVITR  319

Query  219  TK  214
            TK
Sbjct  320  TK  321



>ref|XP_009143755.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Brassica rapa]
Length=421

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+++DQR SM+YYMQKTYYKTASLISNSCKAIALLAGQ+AEV+ +AFEYG+NLG
Sbjct  241  GETMQMTSTTDQRHSMDYYMQKTYYKTASLISNSCKAIALLAGQSAEVATLAFEYGRNLG  300

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VVDQ   DP NV
Sbjct  301  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVDQLEKDPTNV  360

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQRTRELA +HANLA+ AI SLPE+DDEDV+RSRRAL++LT RVI+R 
Sbjct  361  DIALEYLGKSKGIQRTRELAIEHANLAAAAIGSLPETDDEDVKRSRRALIDLTHRVISRN  420

Query  216  K  214
            K
Sbjct  421  K  421



>ref|XP_010940821.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X1 [Elaeis guineensis]
Length=418

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+T+S+QRCSMEYY+QKTYYKTASLISNSCKAIALLAGQTAEVS++A+EYG+NLG
Sbjct  238  GETMQMSTTSEQRCSMEYYLQKTYYKTASLISNSCKAIALLAGQTAEVSMLAYEYGRNLG  297

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTS +LGKGSLSDIRHGIVTAPILFA+EE+PQLR++V++GFD+P +V
Sbjct  298  LAFQLIDDVLDFTGTSVSLGKGSLSDIRHGIVTAPILFAIEEFPQLRELVERGFDNPNDV  357

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D AL+YLGKSRGIQRT+ELA +HAN A  AI++LP SDDED+Q SRRALV+LT RVITRT
Sbjct  358  DAALDYLGKSRGIQRTKELAQEHANRAVKAIEALPYSDDEDIQMSRRALVDLTHRVITRT  417

Query  216  K  214
            K
Sbjct  418  K  418



>ref|XP_010516612.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X2 [Camelina sativa]
Length=321

 Score =   311 bits (798),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T++++QR SMEYYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYGKNLG
Sbjct  141  GETMEITSTTEQRYSMEYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVD+   DP NV
Sbjct  201  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDRVEKDPTNV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  261  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_010549511.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=414

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+++S+QR SM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  234  GETMQMSSTSEQRHSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFEYGKNLG  293

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTS +LGKGSLSDI+HGI+TAPILFAMEE+PQL +VV QGFD+P NV
Sbjct  294  LAYQLIDDVLDFTGTSTSLGKGSLSDIQHGIITAPILFAMEEFPQLIEVVHQGFDNPNNV  353

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQRTRELA +HANLA+ AI SLPE+DDE+V+R RRAL++LT RVITR 
Sbjct  354  DIALEYLGKSRGIQRTRELALEHANLAAVAIRSLPETDDEEVKRCRRALIDLTHRVITRK  413

Query  216  K  214
            K
Sbjct  414  K  414



>gb|KDP38011.1| hypothetical protein JCGZ_04654 [Jatropha curcas]
Length=411

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+Q CSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  231  GETMQMTSTSEQCCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFEYGKNLG  290

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR VV+QGFD P NV
Sbjct  291  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRAVVEQGFDKPENV  350

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
             +ALEYLGKSRGIQRTRELA KHA  A++AIDSLPE+DDE+V++SRRAL++LTQRVITR 
Sbjct  351  RIALEYLGKSRGIQRTRELAAKHAKAAAEAIDSLPETDDEEVRKSRRALIDLTQRVITRN  410

Query  216  K  214
            K
Sbjct  411  K  411



>ref|XP_010504929.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=321

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T++++QR SMEYYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYGKNLG
Sbjct  141  GETMEITSTTEQRYSMEYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVD+   DP NV
Sbjct  201  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDRVEKDPTNV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+E+V+RSRRAL++LT RVITR 
Sbjct  261  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNENVKRSRRALIDLTHRVITRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>gb|KJB07790.1| hypothetical protein B456_001G118100 [Gossypium raimondii]
Length=420

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+S++R SMEYYMQKTY KTASL+SNSCK++ALLAG T  ++++AFEYGKNLG
Sbjct  240  GETMQLTTASNKRFSMEYYMQKTYNKTASLMSNSCKSVALLAGHTTVIAMLAFEYGKNLG  299

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEEYPQLR VVD+GFD+P NV
Sbjct  300  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEYPQLRAVVDKGFDNPANV  359

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGI+RT+ELA KHANLA+ AI+SLP+SDDEDV +SR+AL++LTQRVITR 
Sbjct  360  DMALEYLGKSRGIERTKELAMKHANLAAAAIESLPQSDDEDVIKSRQALIDLTQRVITRN  419

Query  216  K  214
            K
Sbjct  420  K  420



>ref|XP_009360937.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
[Pyrus x bretschneideri]
Length=422

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 171/182 (94%), Gaps = 1/182 (1%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSME+Y+QKTY+KTASLISNSCKAIA+LAG T EV+ +A+EYGKNLG
Sbjct  241  GETMQMTTTSDQRCSMEFYIQKTYFKTASLISNSCKAIAVLAGHTTEVATLAYEYGKNLG  300

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFD-DPRN  400
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR VV+QG D +P N
Sbjct  301  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRTVVEQGLDNNPAN  360

Query  399  VDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            ++LAL+YLG+SRGI RTRELATKHANLA+ AI+SLPES+DE+V++SRRAL++LT  VITR
Sbjct  361  IELALDYLGRSRGIHRTRELATKHANLAAAAIESLPESEDENVRKSRRALLDLTHIVITR  420

Query  219  TK  214
            TK
Sbjct  421  TK  422



>gb|KJB07789.1| hypothetical protein B456_001G118100 [Gossypium raimondii]
Length=419

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+S++R SMEYYMQKTY KTASL+SNSCK++ALLAG T  ++++AFEYGKNLG
Sbjct  239  GETMQLTTASNKRFSMEYYMQKTYNKTASLMSNSCKSVALLAGHTTVIAMLAFEYGKNLG  298

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEEYPQLR VVD+GFD+P NV
Sbjct  299  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEYPQLRAVVDKGFDNPANV  358

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGI+RT+ELA KHANLA+ AI+SLP+SDDEDV +SR+AL++LTQRVITR 
Sbjct  359  DMALEYLGKSRGIERTKELAMKHANLAAAAIESLPQSDDEDVIKSRQALIDLTQRVITRN  418

Query  216  K  214
            K
Sbjct  419  K  419



>emb|CDX84296.1| BnaC04g10580D [Brassica napus]
Length=420

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+++DQR SM+YYMQKTYYKTASLISNSCKAIALLAGQ+AEV+++AFEYG+NLG
Sbjct  240  GETMQMTSTTDQRHSMDYYMQKTYYKTASLISNSCKAIALLAGQSAEVAMLAFEYGRNLG  299

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VVDQ   DP NV
Sbjct  300  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVDQLEKDPTNV  359

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQRTRELA +HAN A+ AI SLPE+DDEDV+RSRRAL++LT RVI+R 
Sbjct  360  DIALEYLGKSKGIQRTRELAIEHANRAAAAIGSLPETDDEDVKRSRRALIDLTHRVISRN  419

Query  216  K  214
            K
Sbjct  420  K  420



>emb|CDY17271.1| BnaA05g09170D [Brassica napus]
Length=420

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+++DQR SM+YYMQKTYYKTASLISNSCKAIALLAGQ+AEV+ +AFEYG+NLG
Sbjct  240  GETMQMTSTTDQRHSMDYYMQKTYYKTASLISNSCKAIALLAGQSAEVATLAFEYGRNLG  299

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VVDQ   DP NV
Sbjct  300  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRTVVDQLEKDPTNV  359

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQRTRELA +HAN A+ AI SLPE+DDEDV+RSRRAL++LT RVI+R 
Sbjct  360  DIALEYLGKSKGIQRTRELAIEHANRAAAAIGSLPETDDEDVKRSRRALIDLTHRVISRN  419

Query  216  K  214
            K
Sbjct  420  K  420



>ref|NP_001031483.1| geranyl diphosphate synthase 1 [Arabidopsis thaliana]
 sp|Q5HZ00.1|SPS3_ARATH RecName: Full=Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial; 
AltName: Full=All-trans-nonaprenyl-diphosphate 
synthase 3 (geranylgeranyl-diphosphate specific); AltName: 
Full=Geranyl diphosphate synthase 1; AltName: Full=Trans-type 
polyprenyl pyrophosphate synthase; Short=AtPPPS; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAW39025.1| At2g34630 [Arabidopsis thaliana]
 gb|AEC09001.1| geranyl diphosphate synthase 1 [Arabidopsis thaliana]
Length=422

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T+S++QR SM+YYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYG+NLG
Sbjct  242  GETMEITSSTEQRYSMDYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLG  301

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVDQ   DPRNV
Sbjct  302  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVEKDPRNV  361

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  362  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  421

Query  216  K  214
            K
Sbjct  422  K  422



>ref|XP_008371791.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Malus domestica]
Length=374

 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 171/182 (94%), Gaps = 1/182 (1%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+SDQRCSMEYY+QKTYYKTASLISNSCKAIA+LAG T EV+++A+EYGKNLG
Sbjct  193  GETMQITTTSDQRCSMEYYIQKTYYKTASLISNSCKAIAVLAGHTXEVAMLAYEYGKNLG  252

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFD-DPRN  400
            LAFQLIDDVLDF GTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR VV+QG D +P N
Sbjct  253  LAFQLIDDVLDFMGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRMVVEQGLDNNPAN  312

Query  399  VDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            ++LAL+YLG+SRGI RTRELATKHANLA+ AI+SLPES D++V++SRRAL++LTQ VITR
Sbjct  313  IELALDYLGRSRGIHRTRELATKHANLAAAAIESLPESKDKNVRKSRRALLDLTQVVITR  372

Query  219  TK  214
            TK
Sbjct  373  TK  374



>gb|AAM13005.1| putative trans-prenyltransferase [Arabidopsis thaliana]
Length=423

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T+S++QR SM+YYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYG+NLG
Sbjct  243  GETMEITSSTEQRYSMDYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVDQ   DPRNV
Sbjct  303  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVEKDPRNV  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  363  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  422

Query  216  K  214
            K
Sbjct  423  K  423



>pdb|3AQ0|A Chain A, Ligand-bound Form Of Arabidopsis Medium/long-chain Length 
Prenyl Pyrophosphate Synthase (surface Polar Residue Mutant)
 pdb|3AQ0|B Chain B, Ligand-bound Form Of Arabidopsis Medium/long-chain Length 
Prenyl Pyrophosphate Synthase (surface Polar Residue Mutant)
 pdb|3AQ0|C Chain C, Ligand-bound Form Of Arabidopsis Medium/long-chain Length 
Prenyl Pyrophosphate Synthase (surface Polar Residue Mutant)
 pdb|3AQ0|D Chain D, Ligand-bound Form Of Arabidopsis Medium/long-chain Length 
Prenyl Pyrophosphate Synthase (surface Polar Residue Mutant)
 pdb|3AQ0|E Chain E, Ligand-bound Form Of Arabidopsis Medium/long-chain Length 
Prenyl Pyrophosphate Synthase (surface Polar Residue Mutant)
 pdb|3AQ0|F Chain F, Ligand-bound Form Of Arabidopsis Medium/long-chain Length 
Prenyl Pyrophosphate Synthase (surface Polar Residue Mutant)
 pdb|3AQ0|G Chain G, Ligand-bound Form Of Arabidopsis Medium/long-chain Length 
Prenyl Pyrophosphate Synthase (surface Polar Residue Mutant)
 pdb|3AQ0|H Chain H, Ligand-bound Form Of Arabidopsis Medium/long-chain Length 
Prenyl Pyrophosphate Synthase (surface Polar Residue Mutant)
Length=348

 Score =   310 bits (795),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T+S+  R SM+YYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYG+NLG
Sbjct  168  GETMEITSSTAARYSMDYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLG  227

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVDQ   DPRNV
Sbjct  228  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVAADPRNV  287

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  288  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  347

Query  216  K  214
            K
Sbjct  348  K  348



>emb|CAC16849.1| geranyl diphosphate synthase [Arabidopsis thaliana]
Length=422

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T+S++QR SM+YYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYG+NLG
Sbjct  242  GETMEITSSTEQRYSMDYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLG  301

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVDQ   DPRNV
Sbjct  302  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVEKDPRNV  361

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  362  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  421

Query  216  K  214
            K
Sbjct  422  K  422



>ref|XP_011009605.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Populus euphratica]
Length=328

 Score =   310 bits (793),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQT EV+++AFEYGKNLG
Sbjct  148  GETMQMTSTSEQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTTEVAMLAFEYGKNLG  207

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+LFAMEE+PQLR V+D GFD P N+
Sbjct  208  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPLLFAMEEFPQLRSVIDWGFDKPENI  267

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS GIQRTRELA KHA+LA+ AIDSLPE+DDE+V++SRRALV+L QRVITR 
Sbjct  268  DVALEYLGKSHGIQRTRELAAKHASLAAAAIDSLPETDDEEVRKSRRALVDLAQRVITRN  327

Query  216  K  214
            K
Sbjct  328  K  328



>ref|XP_002308360.2| hypothetical protein POPTR_0006s13760g [Populus trichocarpa]
 gb|EEE91883.2| hypothetical protein POPTR_0006s13760g [Populus trichocarpa]
Length=413

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQT EV+++AFEYGKNLG
Sbjct  233  GETMQMTSTSEQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTTEVAMLAFEYGKNLG  292

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQL  V+D+GFD P N+
Sbjct  293  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLCSVIDRGFDKPENI  352

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D ALEYLGKSRGIQRTRELA KHANLA+ AIDSLPE+DDE+V++SRRALV+LTQRVITR 
Sbjct  353  DAALEYLGKSRGIQRTRELAAKHANLAAAAIDSLPETDDEEVRKSRRALVDLTQRVITRN  412

Query  216  K  214
            K
Sbjct  413  K  413



>ref|XP_010670605.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S+QR +MEYYM+KTY+KTASLISNSCKAIALLAGQ+AE + +A++YGKNLG
Sbjct  81   GETMQMTTTSEQRLNMEYYMEKTYFKTASLISNSCKAIALLAGQSAEAATLAYDYGKNLG  140

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAP+LFA+EE+PQL +VV +GFD+P ++
Sbjct  141  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPLLFAIEEFPQLSEVVQRGFDNPADI  200

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLAL+YLG+S+GIQR ++LA KHANLA++AI+SLPE+DDEDV+RSRRALV+LT RVI RT
Sbjct  201  DLALDYLGRSQGIQRAKDLALKHANLAAEAIESLPENDDEDVRRSRRALVDLTHRVIKRT  260

Query  216  K  214
            K
Sbjct  261  K  261



>ref|XP_008371790.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Malus domestica]
Length=419

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 171/182 (94%), Gaps = 1/182 (1%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+SDQRCSMEYY+QKTYYKTASLISNSCKAIA+LAG T EV+++A+EYGKNLG
Sbjct  238  GETMQITTTSDQRCSMEYYIQKTYYKTASLISNSCKAIAVLAGHTXEVAMLAYEYGKNLG  297

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFD-DPRN  400
            LAFQLIDDVLDF GTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR VV+QG D +P N
Sbjct  298  LAFQLIDDVLDFMGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRMVVEQGLDNNPAN  357

Query  399  VDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            ++LAL+YLG+SRGI RTRELATKHANLA+ AI+SLPES D++V++SRRAL++LTQ VITR
Sbjct  358  IELALDYLGRSRGIHRTRELATKHANLAAAAIESLPESKDKNVRKSRRALLDLTQVVITR  417

Query  219  TK  214
            TK
Sbjct  418  TK  419



>ref|XP_008371630.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Malus domestica]
Length=422

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 170/182 (93%), Gaps = 1/182 (1%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+SDQRCSME+Y+QKTY+KTASLISNSCKAIA+LAG T EV+ +A+EYGKNLG
Sbjct  241  GETMQMTTTSDQRCSMEFYIQKTYFKTASLISNSCKAIAVLAGHTTEVATLAYEYGKNLG  300

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFD-DPRN  400
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR VV+QG D +P N
Sbjct  301  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRTVVEQGLDNNPAN  360

Query  399  VDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            ++LAL+YLG+SRGI RTRELATKHAN A+ AI+SLPES+DE+V++SRRAL++LT  VITR
Sbjct  361  IELALDYLGRSRGIHRTRELATKHANXAAAAIESLPESEDENVRKSRRALLDLTHIVITR  420

Query  219  TK  214
            TK
Sbjct  421  TK  422



>ref|XP_010540598.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=429

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+QR SM YYMQKTYYKTASLISNSCK+IA+LAGQT EV+++AFEYGKNLG
Sbjct  249  GETMQMTSTSEQRHSMNYYMQKTYYKTASLISNSCKSIAILAGQTTEVAMLAFEYGKNLG  308

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTS +LGKGSLSDIRHGI+TAPILFAMEEYPQL ++V QGFD+P N+
Sbjct  309  LAYQLIDDVLDFTGTSTSLGKGSLSDIRHGIITAPILFAMEEYPQLSEIVHQGFDNPANI  368

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++ALEYLGKSRGIQRTRELA +HANLA+ AI  LPE+DDEDV+R RRAL+++T RVITR 
Sbjct  369  NIALEYLGKSRGIQRTRELALEHANLAAAAIGDLPETDDEDVKRCRRALIDITHRVITRN  428

Query  216  K  214
            K
Sbjct  429  K  429



>ref|XP_008784837.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X2 [Phoenix dactylifera]
Length=288

 Score =   306 bits (784),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+T+S+QR SMEYY+QKTYYKTASLISNSCKAIALLAGQTAEVS++A+EYG+NLG
Sbjct  108  GETMQMSTTSEQRHSMEYYLQKTYYKTASLISNSCKAIALLAGQTAEVSMLAYEYGRNLG  167

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTS +LGKGSLSDIRHGI TAPILFA+EE+PQLR++VD+GFD P +V
Sbjct  168  LAYQLIDDVLDFTGTSTSLGKGSLSDIRHGIATAPILFAIEEFPQLRELVDRGFDKPEDV  227

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D AL+YLGKSRGIQRT+ELA +HA+ A +AI++LP SDDEDVQ SRRALV+LT+RVITRT
Sbjct  228  DAALDYLGKSRGIQRTKELAEEHASRAVEAIEALPCSDDEDVQVSRRALVDLTRRVITRT  287

Query  216  K  214
            K
Sbjct  288  K  288



>dbj|BAK05302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+TS +QR SMEYY+QKTYYKTASLISNSCKA+A+LAG TAEVSV+A+EYG+NLG
Sbjct  244  GETMQMSTSREQRRSMEYYLQKTYYKTASLISNSCKAVAILAGHTAEVSVLAYEYGRNLG  303

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+L+AMEE+PQL DVVDQGFD+P NV
Sbjct  304  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPMLYAMEEFPQLHDVVDQGFDNPANV  363

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++ALEYL KSRGI+RT+ELA +H NLA  AI+SLP+SDDEDV  SRRAL+++TQRVITRT
Sbjct  364  EIALEYLQKSRGIERTKELAQEHVNLAVKAIESLPDSDDEDVLISRRALIDITQRVITRT  423

Query  216  K  214
            K
Sbjct  424  K  424



>ref|XP_010516611.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Camelina sativa]
Length=423

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T++++QR SMEYYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYGKNLG
Sbjct  243  GETMEITSTTEQRYSMEYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGKNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVD+   DP NV
Sbjct  303  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDRVEKDPTNV  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  363  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  422

Query  216  K  214
            K
Sbjct  423  K  423



>ref|XP_006293470.1| hypothetical protein CARUB_v10023285mg [Capsella rubella]
 gb|EOA26368.1| hypothetical protein CARUB_v10023285mg [Capsella rubella]
Length=422

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T++++QR SM+YYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYGKNLG
Sbjct  242  GETMEITSTTEQRYSMDYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGKNLG  301

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVDQ   DP NV
Sbjct  302  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVEKDPTNV  361

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  362  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  421

Query  216  K  214
            K
Sbjct  422  K  422



>ref|XP_002879508.1| hypothetical protein ARALYDRAFT_902550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55767.1| hypothetical protein ARALYDRAFT_902550 [Arabidopsis lyrata subsp. 
lyrata]
Length=422

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T++++QR SM+YYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYGKNLG
Sbjct  242  GETMEITSTTEQRYSMDYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGKNLG  301

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFA+EE+PQLR+VVDQ   DPRNV
Sbjct  302  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAIEEFPQLREVVDQVEKDPRNV  361

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RV+TR 
Sbjct  362  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVLTRN  421

Query  216  K  214
            K
Sbjct  422  K  422



>gb|EMT24094.1| Putative hexaprenyl pyrophosphate synthetase, mitochondrial [Aegilops 
tauschii]
Length=407

 Score =   309 bits (792),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+TS +QR SMEYY+QKTYYKTASLISNSCKA+A+LAG TAEVSV+A+EYG+NLG
Sbjct  227  GETMQMSTSREQRRSMEYYLQKTYYKTASLISNSCKAVAILAGHTAEVSVLAYEYGRNLG  286

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+L+AMEE+PQL+DVVDQGFD+P NV
Sbjct  287  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPMLYAMEEFPQLQDVVDQGFDNPANV  346

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YL KSRGI+RT+ELA +H NLA  AI++LP+SDDEDV  SRRAL+++TQRVITRT
Sbjct  347  EIALDYLQKSRGIERTKELAQEHVNLAVKAIEALPDSDDEDVLISRRALIDITQRVITRT  406

Query  216  K  214
            K
Sbjct  407  K  407



>ref|XP_010509730.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=423

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T++++QR SMEYYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYGKNLG
Sbjct  243  GETMEITSTTEQRYSMEYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGKNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQL+DD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVD+   DP NV
Sbjct  303  LAFQLVDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDRVEKDPTNV  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+EDV+RSRRAL++LT RVITR 
Sbjct  363  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRALIDLTHRVITRN  422

Query  216  K  214
            K
Sbjct  423  K  423



>ref|XP_010504928.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=423

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETM++T++++QR SMEYYMQKTYYKTASLISNSCKA+A+L GQTAEV+V+AFEYGKNLG
Sbjct  243  GETMEITSTTEQRYSMEYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGKNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LDFTGTSA+LGKGSLSDIRHG++TAPILFAMEE+PQLR+VVD+   DP NV
Sbjct  303  LAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDRVEKDPTNV  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GIQR RELA +HANLA+ AI SLPE+D+E+V+RSRRAL++LT RVITR 
Sbjct  363  DIALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNENVKRSRRALIDLTHRVITRN  422

Query  216  K  214
            K
Sbjct  423  K  423



>ref|XP_008784836.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X1 [Phoenix dactylifera]
Length=321

 Score =   306 bits (784),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+T+S+QR SMEYY+QKTYYKTASLISNSCKAIALLAGQTAEVS++A+EYG+NLG
Sbjct  141  GETMQMSTTSEQRHSMEYYLQKTYYKTASLISNSCKAIALLAGQTAEVSMLAYEYGRNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTS +LGKGSLSDIRHGI TAPILFA+EE+PQLR++VD+GFD P +V
Sbjct  201  LAYQLIDDVLDFTGTSTSLGKGSLSDIRHGIATAPILFAIEEFPQLRELVDRGFDKPEDV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D AL+YLGKSRGIQRT+ELA +HA+ A +AI++LP SDDEDVQ SRRALV+LT+RVITRT
Sbjct  261  DAALDYLGKSRGIQRTKELAEEHASRAVEAIEALPCSDDEDVQVSRRALVDLTRRVITRT  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_010670597.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   306 bits (784),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S+QR +MEYYM+KTY+KTASLISNSCKAIALLAGQ+AE + +A++YGKNLG
Sbjct  146  GETMQMTTTSEQRLNMEYYMEKTYFKTASLISNSCKAIALLAGQSAEAATLAYDYGKNLG  205

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAP+LFA+EE+PQL +VV +GFD+P ++
Sbjct  206  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPLLFAIEEFPQLSEVVQRGFDNPADI  265

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLAL+YLG+S+GIQR ++LA KHANLA++AI+SLPE+DDEDV+RSRRALV+LT RVI RT
Sbjct  266  DLALDYLGRSQGIQRAKDLALKHANLAAEAIESLPENDDEDVRRSRRALVDLTHRVIKRT  325

Query  216  K  214
            K
Sbjct  326  K  326



>ref|XP_007016033.1| Geranyl diphosphate synthase 1, putative isoform 3 [Theobroma 
cacao]
 gb|EOY33652.1| Geranyl diphosphate synthase 1, putative isoform 3 [Theobroma 
cacao]
Length=288

 Score =   305 bits (780),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+S QR SM+YYMQKTY KTASLISNSCK+IA+LAG TAEV+++AFEYGKNLG
Sbjct  108  GETMQLTTASKQRFSMDYYMQKTYNKTASLISNSCKSIAILAGHTAEVAMLAFEYGKNLG  167

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+P+L  VVDQGF +P NV
Sbjct  168  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPELHAVVDQGFKNPANV  227

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+AL +LGKS GIQRT+ELA KHANLA+  I+SLPESDD +V RSR+AL++LTQRV+TR 
Sbjct  228  DIALGFLGKSSGIQRTKELAMKHANLAAQVIESLPESDDANVIRSRQALIDLTQRVLTRN  287

Query  216  K  214
            K
Sbjct  288  K  288



>ref|XP_011009597.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Populus euphratica]
Length=440

 Score =   310 bits (794),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQT EV+++AFEYGKNLG
Sbjct  260  GETMQMTSTSEQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTTEVAMLAFEYGKNLG  319

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+LFAMEE+PQLR V+D GFD P N+
Sbjct  320  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPLLFAMEEFPQLRSVIDWGFDKPENI  379

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS GIQRTRELA KHA+LA+ AIDSLPE+DDE+V++SRRALV+L QRVITR 
Sbjct  380  DVALEYLGKSHGIQRTRELAAKHASLAAAAIDSLPETDDEEVRKSRRALVDLAQRVITRN  439

Query  216  K  214
            K
Sbjct  440  K  440



>ref|XP_011039904.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Populus euphratica]
Length=321

 Score =   306 bits (783),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+Q CSMEYYMQKTYYKTASLISNSCKAIALLAGQT EV+++AFEYGKNLG
Sbjct  141  GETMQMTSTSEQLCSMEYYMQKTYYKTASLISNSCKAIALLAGQTTEVAMLAFEYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQL  V+DQGFD P N+
Sbjct  201  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLHSVIDQGFDKPENI  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D AL+YL KSRGIQRTRELA KHANLA+ AIDSLPE+DDE+V+++RRALV+LTQRVITR 
Sbjct  261  DAALDYLWKSRGIQRTRELAAKHANLAAAAIDSLPETDDEEVRKTRRALVDLTQRVITRN  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_007016032.1| Geranyl diphosphate synthase 1 isoform 2 [Theobroma cacao]
 gb|EOY33651.1| Geranyl diphosphate synthase 1 isoform 2 [Theobroma cacao]
Length=302

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+S QR SM+YYMQKTY KTASLISNSCK+IA+LAG TAEV+++AFEYGKNLG
Sbjct  122  GETMQLTTASKQRFSMDYYMQKTYNKTASLISNSCKSIAILAGHTAEVAMLAFEYGKNLG  181

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+P+L  VVDQGF +P NV
Sbjct  182  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPELHAVVDQGFKNPANV  241

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+AL +LGKS GIQRT+ELA KHANLA+  I+SLPESDD +V RSR+AL++LTQRV+TR 
Sbjct  242  DIALGFLGKSSGIQRTKELAMKHANLAAQVIESLPESDDANVIRSRQALIDLTQRVLTRN  301

Query  216  K  214
            K
Sbjct  302  K  302



>gb|AEZ55677.1| geranyl diphosphate synthase [Salvia miltiorrhiza]
 gb|AGE45642.1| solanesyl diphosphate synthase 2 [Salvia miltiorrhiza]
Length=424

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S+QRCSMEYYM+KTYYKTASLI NSCK+IAL+AGQTAEVS +A+EYGKNLG
Sbjct  244  GETMQMTTTSEQRCSMEYYMEKTYYKTASLICNSCKSIALIAGQTAEVSNLAYEYGKNLG  303

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ+IDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFA+EEYP+LR +VDQGF+   NV
Sbjct  304  LAFQIIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAIEEYPELRKIVDQGFEKSSNV  363

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D ALE L KS GIQR RELA KHA LAS AID+LPE++DE VQRS RALVELT  VITRT
Sbjct  364  DRALEILSKSSGIQRARELAAKHARLASAAIDALPENEDEVVQRSMRALVELTHIVITRT  423

Query  216  K  214
            K
Sbjct  424  K  424



>ref|XP_009384198.1| PREDICTED: LOW QUALITY PROTEIN: solanesyl-diphosphate synthase 
1, mitochondrial [Musa acuminata subsp. malaccensis]
Length=419

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT S+QR SM+YY+QKTYYKTASLIS+SCKAIALLAG TAEVS +A++YG+NLG
Sbjct  239  GETMQMTTKSEQRRSMDYYLQKTYYKTASLISSSCKAIALLAGHTAEVSKLAYDYGRNLG  298

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQL+DD+LDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+P+L  VVD+GFDDP NV
Sbjct  299  LAFQLVDDILDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPELHVVVDRGFDDPANV  358

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKS+GI+RTRELA +HAN A++AI++LPESDDEDV  SRRALV+LT RVI+RT
Sbjct  359  DVALEYLGKSQGIERTRELAAEHANYAAEAIEALPESDDEDVLVSRRALVDLTHRVISRT  418

Query  216  K  214
            K
Sbjct  419  K  419



>ref|XP_011039903.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Populus euphratica]
Length=413

 Score =   306 bits (785),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+Q CSMEYYMQKTYYKTASLISNSCKAIALLAGQT EV+++AFEYGKNLG
Sbjct  233  GETMQMTSTSEQLCSMEYYMQKTYYKTASLISNSCKAIALLAGQTTEVAMLAFEYGKNLG  292

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQL  V+DQGFD P N+
Sbjct  293  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLHSVIDQGFDKPENI  352

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D AL+YL KSRGIQRTRELA KHANLA+ AIDSLPE+DDE+V+++RRALV+LTQRVITR 
Sbjct  353  DAALDYLWKSRGIQRTRELAAKHANLAAAAIDSLPETDDEEVRKTRRALVDLTQRVITRN  412

Query  216  K  214
            K
Sbjct  413  K  413



>gb|EPS58436.1| geranyl pyrophosphate synthase [Genlisea aurea]
Length=393

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT+++D+RCSMEYYM+KT+YKTASLISNSCKAIALLAGQTAEVS +A+EYGKNLG
Sbjct  213  GETMQMTSTADKRCSMEYYMEKTFYKTASLISNSCKAIALLAGQTAEVSTLAYEYGKNLG  272

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+PQLR VVD+GF++  NV
Sbjct  273  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPQLRVVVDRGFENSDNV  332

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALEYLGKS GI+RTRELA KHA+LAS AI SLP++DDEDV RSRRALVELT RVITRT
Sbjct  333  DLALEYLGKSHGIERTRELAVKHASLASAAISSLPKNDDEDVMRSRRALVELTTRVITRT  392

Query  216  K  214
            K
Sbjct  393  K  393



>ref|XP_010670594.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=426

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S+QR +MEYYM+KTY+KTASLISNSCKAIALLAGQ+AE + +A++YGKNLG
Sbjct  246  GETMQMTTTSEQRLNMEYYMEKTYFKTASLISNSCKAIALLAGQSAEAATLAYDYGKNLG  305

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAP+LFA+EE+PQL +VV +GFD+P ++
Sbjct  306  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPLLFAIEEFPQLSEVVQRGFDNPADI  365

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLAL+YLG+S+GIQR ++LA KHANLA++AI+SLPE+DDEDV+RSRRALV+LT RVI RT
Sbjct  366  DLALDYLGRSQGIQRAKDLALKHANLAAEAIESLPENDDEDVRRSRRALVDLTHRVIKRT  425

Query  216  K  214
            K
Sbjct  426  K  426



>ref|XP_007016031.1| Geranyl diphosphate synthase 1 isoform 1 [Theobroma cacao]
 gb|EOY33650.1| Geranyl diphosphate synthase 1 isoform 1 [Theobroma cacao]
Length=417

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+S QR SM+YYMQKTY KTASLISNSCK+IA+LAG TAEV+++AFEYGKNLG
Sbjct  237  GETMQLTTASKQRFSMDYYMQKTYNKTASLISNSCKSIAILAGHTAEVAMLAFEYGKNLG  296

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPILFAMEE+P+L  VVDQGF +P NV
Sbjct  297  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAMEEFPELHAVVDQGFKNPANV  356

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+AL +LGKS GIQRT+ELA KHANLA+  I+SLPESDD +V RSR+AL++LTQRV+TR 
Sbjct  357  DIALGFLGKSSGIQRTKELAMKHANLAAQVIESLPESDDANVIRSRQALIDLTQRVLTRN  416

Query  216  K  214
            K
Sbjct  417  K  417



>gb|KDP37498.1| hypothetical protein JCGZ_05937 [Jatropha curcas]
Length=415

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++SDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAE +++AFEYGKNLG
Sbjct  235  GETMQMTSTSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEAAMLAFEYGKNLG  294

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+P+LR VV QGFD P NV
Sbjct  295  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPELRTVVQQGFDKPENV  354

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ LEYL KSRGIQRTRELA KHA LA+ AI SLPE+DDE+V++SRRALV+LT+RVITR 
Sbjct  355  DITLEYLRKSRGIQRTRELAAKHAKLAAAAIVSLPETDDEEVRKSRRALVDLTERVITRN  414

Query  216  K  214
            K
Sbjct  415  K  415



>ref|XP_010240683.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X2 [Brachypodium distachyon]
 ref|XP_010240685.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X2 [Brachypodium distachyon]
Length=321

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SMEYY+QKTYYKTASLISNSCK +ALLAG TA+VS++A+EYG+NLG
Sbjct  141  GETMQISTSREQRRSMEYYLQKTYYKTASLISNSCKCVALLAGHTADVSLLAYEYGRNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+L+AMEE+PQL +VVDQGFD+P NV
Sbjct  201  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPMLYAMEEFPQLHEVVDQGFDNPANV  260

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YL KS+GI+RT++LA +HANLA  AI++LP+SDDEDV  SRRAL+++TQRVITRT
Sbjct  261  ELALDYLQKSQGIERTKKLAQEHANLAIKAIEALPDSDDEDVLISRRALIDITQRVITRT  320

Query  216  K  214
            K
Sbjct  321  K  321



>ref|XP_010549508.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Tarenaya hassleriana]
Length=423

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+++S+QR  M+YYMQKTYYKTASLIS+SCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  243  GETMQMSSTSEQRHCMDYYMQKTYYKTASLISHSCKAIALLAGQTAEVAMLAFEYGKNLG  302

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVL FTGTS +LGKGSLSDI+HGI+TAPILFAMEE+PQL +VV QGFD+P NV
Sbjct  303  LAYQLIDDVLAFTGTSTSLGKGSLSDIQHGIITAPILFAMEEFPQLIEVVHQGFDNPNNV  362

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ LEYLGKSRGIQRTRELA +H NLA+ AI SLPE+DDE+V+R RRAL++LT RVITR 
Sbjct  363  DIVLEYLGKSRGIQRTRELALEHVNLAAVAIRSLPETDDEEVKRCRRALIDLTHRVITRK  422

Query  216  K  214
            K
Sbjct  423  K  423



>ref|XP_004966210.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X2 [Setaria italica]
Length=365

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SMEYY+QKTYYKTASLISNSCKA+A+LAG TAEVS++A+EYG+NLG
Sbjct  185  GETMQISTSREQRRSMEYYLQKTYYKTASLISNSCKAVAILAGHTAEVSMLAYEYGRNLG  244

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPIL+AMEE+PQL +VVD GF+DP NV
Sbjct  245  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILYAMEEFPQLHEVVDSGFEDPANV  304

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YL KSRGI+RT+ELA +HAN A  A+++LP+SDDEDV  SRRAL+++T+RVITRT
Sbjct  305  ELALDYLQKSRGIERTKELAREHANRAIKAVEALPDSDDEDVLTSRRALIDITERVITRT  364

Query  216  K  214
            K
Sbjct  365  K  365



>ref|XP_010549506.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Tarenaya hassleriana]
Length=434

 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+++S+QR  M+YYMQKTYYKTASLIS+SCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  254  GETMQMSSTSEQRHCMDYYMQKTYYKTASLISHSCKAIALLAGQTAEVAMLAFEYGKNLG  313

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVL FTGTS +LGKGSLSDI+HGI+TAPILFAMEE+PQL +VV QGFD+P NV
Sbjct  314  LAYQLIDDVLAFTGTSTSLGKGSLSDIQHGIITAPILFAMEEFPQLIEVVHQGFDNPNNV  373

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ LEYLGKSRGIQRTRELA +H NLA+ AI SLPE+DDE+V+R RRAL++LT RVITR 
Sbjct  374  DIVLEYLGKSRGIQRTRELALEHVNLAAVAIRSLPETDDEEVKRCRRALIDLTHRVITRK  433

Query  216  K  214
            K
Sbjct  434  K  434



>ref|XP_004966209.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X1 [Setaria italica]
Length=429

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SMEYY+QKTYYKTASLISNSCKA+A+LAG TAEVS++A+EYG+NLG
Sbjct  249  GETMQISTSREQRRSMEYYLQKTYYKTASLISNSCKAVAILAGHTAEVSMLAYEYGRNLG  308

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAPIL+AMEE+PQL +VVD GF+DP NV
Sbjct  309  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILYAMEEFPQLHEVVDSGFEDPANV  368

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YL KSRGI+RT+ELA +HAN A  A+++LP+SDDEDV  SRRAL+++T+RVITRT
Sbjct  369  ELALDYLQKSRGIERTKELAREHANRAIKAVEALPDSDDEDVLTSRRALIDITERVITRT  428

Query  216  K  214
            K
Sbjct  429  K  429



>ref|XP_010275055.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=418

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S +R SMEYY+QKTYYKTASLISNSCKAIALLAGQT EVS++A+EYG+NLG
Sbjct  238  GETMQMTTTSKERYSMEYYLQKTYYKTASLISNSCKAIALLAGQTTEVSMLAYEYGRNLG  297

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFA+EE+PQLR+VVD+GFD P +V
Sbjct  298  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAIEEFPQLREVVDRGFDKPSDV  357

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLAL+YLG+SRGIQR RELA KHANLA+ A+DS P+SDDEDV RSRRALV+LT RVITRT
Sbjct  358  DLALDYLGRSRGIQRARELAAKHANLAAAAVDSFPDSDDEDVLRSRRALVDLTHRVITRT  417

Query  216  K  214
            K
Sbjct  418  K  418



>ref|XP_003563402.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X1 [Brachypodium distachyon]
Length=426

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SMEYY+QKTYYKTASLISNSCK +ALLAG TA+VS++A+EYG+NLG
Sbjct  246  GETMQISTSREQRRSMEYYLQKTYYKTASLISNSCKCVALLAGHTADVSLLAYEYGRNLG  305

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+L+AMEE+PQL +VVDQGFD+P NV
Sbjct  306  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPMLYAMEEFPQLHEVVDQGFDNPANV  365

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YL KS+GI+RT++LA +HANLA  AI++LP+SDDEDV  SRRAL+++TQRVITRT
Sbjct  366  ELALDYLQKSQGIERTKKLAQEHANLAIKAIEALPDSDDEDVLISRRALIDITQRVITRT  425

Query  216  K  214
            K
Sbjct  426  K  426



>ref|XP_002438852.1| hypothetical protein SORBIDRAFT_10g027240 [Sorghum bicolor]
 gb|EER90219.1| hypothetical protein SORBIDRAFT_10g027240 [Sorghum bicolor]
Length=431

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SMEYY+QKTYYKTASLISNSCKA+A+LAG TAEVSV+A+EYG+NLG
Sbjct  251  GETMQISTSREQRRSMEYYLQKTYYKTASLISNSCKAVAILAGHTAEVSVLAYEYGRNLG  310

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHG++TAP+L+AMEE+PQL++VVD+GFD+P N+
Sbjct  311  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGVITAPMLYAMEEFPQLQEVVDRGFDNPANI  370

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YL KSRGI+RT+ELA +HA+ A  AI+SLP+SDDEDV  SRRAL+++T+RVITRT
Sbjct  371  EIALDYLRKSRGIERTKELAREHADRAVKAIESLPDSDDEDVLTSRRALIDITERVITRT  430

Query  216  K  214
            K
Sbjct  431  K  431



>ref|XP_006378524.1| geranyl diphosphate synthase family protein, partial [Populus 
trichocarpa]
 gb|ERP56321.1| geranyl diphosphate synthase family protein, partial [Populus 
trichocarpa]
Length=174

 Score =   290 bits (741),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = -3

Query  717  CSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLGLAFQLIDDVLDFT  538
            CSMEYYMQKTYYKTASLISNSCKAIALLAGQT EV+++AFEYGKNLGLA+QLIDDVLDFT
Sbjct  7    CSMEYYMQKTYYKTASLISNSCKAIALLAGQTTEVAMLAFEYGKNLGLAYQLIDDVLDFT  66

Query  537  GTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNVDLALEYLGKSRGI  358
            GTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR V+D GFD P N+D+ALEYLGKSRGI
Sbjct  67   GTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRSVIDWGFDKPENIDVALEYLGKSRGI  126

Query  357  QRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRTK  214
            QRTRELA KHANLA+ AIDSLPE+DDE+V++SRRALV+LTQRVITR K
Sbjct  127  QRTRELAAKHANLAAAAIDSLPETDDEEVRKSRRALVDLTQRVITRNK  174



>ref|XP_006836349.1| hypothetical protein AMTR_s00092p00100450 [Amborella trichopoda]
 gb|ERM99202.1| hypothetical protein AMTR_s00092p00100450 [Amborella trichopoda]
Length=429

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YY+QKTYYKTASLISNSCKAIALLAGQTAEVSV+A++YG+NLG
Sbjct  249  GETMQMTTSSDQRCSMDYYLQKTYYKTASLISNSCKAIALLAGQTAEVSVLAYDYGRNLG  308

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGT A+LGKGSLSDIRHGIVTAPILFAMEE+PQLR VVD+GF+DP NV
Sbjct  309  LAYQLIDDVLDFTGTCASLGKGSLSDIRHGIVTAPILFAMEEFPQLRMVVDKGFEDPDNV  368

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+AL+YLGKS+GIQRT++LA +HA+LA+ A+DSLP +++ED   SRRALV+LTQRVI+RT
Sbjct  369  DIALDYLGKSQGIQRTKDLAAEHASLAAAAVDSLPPTNNEDAIISRRALVDLTQRVISRT  428

Query  216  K  214
            K
Sbjct  429  K  429



>ref|XP_008643448.1| PREDICTED: uncharacterized protein LOC100279314 isoform X1 [Zea 
mays]
 ref|XP_008643449.1| PREDICTED: uncharacterized protein LOC100279314 isoform X1 [Zea 
mays]
 ref|XP_008643450.1| PREDICTED: uncharacterized protein LOC100279314 isoform X1 [Zea 
mays]
 gb|ACG33955.1| decaprenyl-diphosphate synthase subunit 1 [Zea mays]
 gb|AFW68980.1| decaprenyl-diphosphate synthase subunit 1 isoform 1 [Zea mays]
 gb|AFW68981.1| decaprenyl-diphosphate synthase subunit 1 isoform 2 [Zea mays]
Length=428

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SMEYY+QKTYYKTASLISNSCKA+A+LAG T EVSV+A+EYG+NLG
Sbjct  248  GETMQISTSREQRRSMEYYLQKTYYKTASLISNSCKAVAILAGHTTEVSVLAYEYGRNLG  307

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+L+AMEE+PQL++VVD+GFD+P NV
Sbjct  308  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPMLYAMEEFPQLQEVVDRGFDNPANV  367

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YL KSRGI++T+ELA +HA+ A  AI+SLP+SDDEDV  SRRAL+++T+RVITRT
Sbjct  368  EIALDYLQKSRGIEKTKELAREHADRAVKAIESLPDSDDEDVLTSRRALIDITERVITRT  427

Query  216  K  214
            K
Sbjct  428  K  428



>gb|AFW68982.1| hypothetical protein ZEAMMB73_415581 [Zea mays]
Length=426

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SMEYY+QKTYYKTASLISNSCKA+A+LAG T EVSV+A+EYG+NLG
Sbjct  246  GETMQISTSREQRRSMEYYLQKTYYKTASLISNSCKAVAILAGHTTEVSVLAYEYGRNLG  305

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+L+AMEE+PQL++VVD+GFD+P NV
Sbjct  306  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPMLYAMEEFPQLQEVVDRGFDNPANV  365

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YL KSRGI++T+ELA +HA+ A  AI+SLP+SDDEDV  SRRAL+++T+RVITRT
Sbjct  366  EIALDYLQKSRGIEKTKELAREHADRAVKAIESLPDSDDEDVLTSRRALIDITERVITRT  425

Query  216  K  214
            K
Sbjct  426  K  426



>ref|XP_006657250.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
[Oryza brachyantha]
Length=415

 Score =   296 bits (759),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SM+YY+QKTYYKTASLISNSCKA+A+LAG TA+VSV+A+EYG+NLG
Sbjct  235  GETMQISTSREQRRSMDYYLQKTYYKTASLISNSCKAVAILAGHTADVSVLAYEYGRNLG  294

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHG++TAP+L+AMEE+PQL +VVD+GFD+P NV
Sbjct  295  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGVITAPMLYAMEEFPQLHEVVDRGFDNPANV  354

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YL KSRGI++T+ELA +HAN A  AI++LP+SDDEDV  SRRAL+ +T+RVITRT
Sbjct  355  ELALDYLQKSRGIEKTKELAREHANRAIKAIEALPDSDDEDVLTSRRALINITERVITRT  414

Query  216  K  214
            K
Sbjct  415  K  415



>ref|NP_001145807.1| decaprenyl-diphosphate synthase subunit 1 isoform 1 [Zea mays]
 gb|ACL52630.1| unknown [Zea mays]
Length=428

 Score =   296 bits (759),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SMEYY+QKTYYKTASLISNSCKA+A+LAG T EVSV+A EYG+NLG
Sbjct  248  GETMQISTSREQRRSMEYYLQKTYYKTASLISNSCKAVAILAGHTTEVSVLAHEYGRNLG  307

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+L+AMEE+PQL++VVD+GFD+P NV
Sbjct  308  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPMLYAMEEFPQLQEVVDRGFDNPANV  367

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            ++AL+YL KSRGI++T+ELA +HA+ A  AI+SLP+SDDEDV  SRRAL+++T+RVITRT
Sbjct  368  EIALDYLQKSRGIEKTKELAREHADRAVKAIESLPDSDDEDVLTSRRALIDITERVITRT  427

Query  216  K  214
            K
Sbjct  428  K  428



>ref|NP_001058362.1| Os06g0678200 [Oryza sativa Japonica Group]
 sp|Q653T6.1|SPS1_ORYSJ RecName: Full=Solanesyl-diphosphate synthase 1, mitochondrial; 
Short=OsSPS1; AltName: Full=All-trans-nonaprenyl-diphosphate 
synthase 1 (geranyl-diphosphate specific); Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD45534.1| putative geranyl diphosphate synthase [Oryza sativa Japonica 
Group]
 dbj|BAD45931.1| putative geranyl diphosphat synthase [Oryza sativa Japonica Group]
 dbj|BAF20276.1| Os06g0678200 [Oryza sativa Japonica Group]
 gb|EAZ02082.1| hypothetical protein OsI_24162 [Oryza sativa Indica Group]
 dbj|BAG87000.1| unnamed protein product [Oryza sativa Japonica Group]
Length=430

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SM+YY+QKTYYKTASLISNSCKA+A+LAG TA+VS++A+EYG+NLG
Sbjct  250  GETMQISTSREQRRSMDYYLQKTYYKTASLISNSCKAVAILAGHTADVSMLAYEYGRNLG  309

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSL+DIRHGI+TAP+L+AMEE+PQL +VVD+GFD+P NV
Sbjct  310  LAFQLIDDVLDFTGTSASLGKGSLTDIRHGIITAPMLYAMEEFPQLHEVVDRGFDNPANV  369

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YL KSRGI++T+ELA +HAN A  AI++LP+SDDEDV  SRRAL+++T+RVITRT
Sbjct  370  ELALDYLQKSRGIEKTKELAREHANRAIKAIEALPDSDDEDVLTSRRALIDITERVITRT  429

Query  216  K  214
            K
Sbjct  430  K  430



>gb|EEE66217.1| hypothetical protein OsJ_22362 [Oryza sativa Japonica Group]
Length=463

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SM+YY+QKTYYKTASLISNSCKA+A+LAG TA+VS++A+EYG+NLG
Sbjct  283  GETMQISTSREQRRSMDYYLQKTYYKTASLISNSCKAVAILAGHTADVSMLAYEYGRNLG  342

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSL+DIRHGI+TAP+L+AMEE+PQL +VVD+GFD+P NV
Sbjct  343  LAFQLIDDVLDFTGTSASLGKGSLTDIRHGIITAPMLYAMEEFPQLHEVVDRGFDNPANV  402

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YL KSRGI++T+ELA +HAN A  AI++LP+SDDEDV  SRRAL+++T+RVITRT
Sbjct  403  ELALDYLQKSRGIEKTKELAREHANRAIKAIEALPDSDDEDVLTSRRALIDITERVITRT  462

Query  216  K  214
            K
Sbjct  463  K  463



>ref|XP_008371815.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Malus domestica]
Length=451

 Score =   293 bits (750),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 158/174 (91%), Gaps = 1/174 (1%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT SDQR SMEYYMQKTYYKTASLISNSCK+IA+LAG T EV+ +A+EYGKNLG
Sbjct  141  GETMQMTTKSDQRFSMEYYMQKTYYKTASLISNSCKSIAVLAGHTTEVAALAYEYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFD-DPRN  400
            LAFQLIDD+LDFTGTSA+LGK SLSDIRHGIVTAPILFAMEE+PQLR VV+Q  D +P N
Sbjct  201  LAFQLIDDLLDFTGTSASLGKASLSDIRHGIVTAPILFAMEEFPQLRTVVEQCLDNNPAN  260

Query  399  VDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELT  238
            ++LAL YLG+SRGI RTRELATKHANLA+ AI SLP+S+DE+V++SRRALV LT
Sbjct  261  IELALNYLGRSRGIHRTRELATKHANLAAAAIKSLPKSEDENVRKSRRALVHLT  314



>ref|XP_007024983.1| Geranyl diphosphate synthase 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY27605.1| Geranyl diphosphate synthase 1, putative isoform 2 [Theobroma 
cacao]
Length=388

 Score =   290 bits (743),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM  + +QRCSMEYYMQKTYYKTASLISNSCKAIALL+GQT  V+ +AFEYGKNLG
Sbjct  208  GETMQMAATIEQRCSMEYYMQKTYYKTASLISNSCKAIALLSGQTPGVAKLAFEYGKNLG  267

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+Q IDD+LDFTG+SA+LGKGSLSDIR GI+TAPILFA EE+PQL  V++QGFDDP NV
Sbjct  268  LAYQFIDDILDFTGSSASLGKGSLSDIRLGIITAPILFATEEFPQLHAVIEQGFDDPANV  327

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D ALEYL KSRGIQRTRELATKHA+LA+ AIDSLPES   DV++SR+AL+ LTQ +  R 
Sbjct  328  DTALEYLRKSRGIQRTRELATKHASLAAAAIDSLPESCSMDVRKSRQALINLTQILTARN  387

Query  216  K  214
            K
Sbjct  388  K  388



>ref|XP_007024982.1| Geranyl diphosphate synthase 1, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27604.1| Geranyl diphosphate synthase 1, putative isoform 1 [Theobroma 
cacao]
Length=394

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM  + +QRCSMEYYMQKTYYKTASLISNSCKAIALL+GQT  V+ +AFEYGKNLG
Sbjct  214  GETMQMAATIEQRCSMEYYMQKTYYKTASLISNSCKAIALLSGQTPGVAKLAFEYGKNLG  273

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+Q IDD+LDFTG+SA+LGKGSLSDIR GI+TAPILFA EE+PQL  V++QGFDDP NV
Sbjct  274  LAYQFIDDILDFTGSSASLGKGSLSDIRLGIITAPILFATEEFPQLHAVIEQGFDDPANV  333

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D ALEYL KSRGIQRTRELATKHA+LA+ AIDSLPES   DV++SR+AL+ LTQ +  R 
Sbjct  334  DTALEYLRKSRGIQRTRELATKHASLAAAAIDSLPESCSMDVRKSRQALINLTQILTARN  393

Query  216  K  214
            K
Sbjct  394  K  394



>ref|XP_010228271.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
[Brachypodium distachyon]
Length=342

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 163/181 (90%), Gaps = 5/181 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS +QR SMEYY+QKTYYKTASLISN+     +LAG TA+VS++A+EYG+NLG
Sbjct  167  GETMQISTSREQRRSMEYYLQKTYYKTASLISNT-----ILAGHTADVSLLAYEYGRNLG  221

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGI+TAP+L+AMEE+PQL DVVDQGFD+P NV
Sbjct  222  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPMLYAMEEFPQLHDVVDQGFDNPANV  281

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LAL+YL KSRGI+RT+ELA +H NLA  AI++LP+SDDEDV  SRRAL+++TQRVITR 
Sbjct  282  ELALDYLQKSRGIERTKELAQEHVNLAVKAIEALPDSDDEDVLISRRALIDITQRVITRI  341

Query  216  K  214
            K
Sbjct  342  K  342



>ref|XP_006659203.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
[Oryza brachyantha]
Length=342

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT +  QR SM+YY+QK+YYKTA+LISNSCKA+A+LAGQTAE +++A++YGK+LG
Sbjct  162  GEFMQMTITPAQRSSMDYYLQKSYYKTAALISNSCKAVAVLAGQTAEAAMLAYQYGKHLG  221

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +A+QLIDD+LDFTGTSA+LGKGSLSDI  GIVTAPILFAMEEYPQLR++V+QGFDDP NV
Sbjct  222  IAYQLIDDILDFTGTSASLGKGSLSDIHQGIVTAPILFAMEEYPQLREIVEQGFDDPSNV  281

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D A+EYLG+S+GI+RTR LA +HA LA+DAID LPES DE V  SR+AL +LTQ++I RT
Sbjct  282  DAAIEYLGRSQGIERTRLLAAEHAKLAADAIDGLPESKDESVLISRQALKDLTQKLIKRT  341

Query  216  K  214
            K
Sbjct  342  K  342



>ref|XP_010549509.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X1 [Tarenaya hassleriana]
Length=411

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 161/181 (89%), Gaps = 8/181 (4%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+++S+QR SM+YYMQKTYYKTASLIS+SCKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  239  GETMQMSSTSEQRLSMDYYMQKTYYKTASLISHSCKAIALLAGQTAEVAMLAFEYGKNLG  298

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLI+DVL FTGTS +L        +HGI+TAPILFAMEE+PQL +VV QGFD+P NV
Sbjct  299  LAYQLIEDVLAFTGTSTSL--------QHGIITAPILFAMEEFPQLIEVVHQGFDNPNNV  350

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQRTRELA +HANLA+ AI SLPE+DDE+V+R RRAL++LT RVITR 
Sbjct  351  DIALEYLGKSRGIQRTRELALEHANLAAVAIRSLPETDDEEVKRCRRALIDLTHRVITRK  410

Query  216  K  214
            K
Sbjct  411  K  411



>gb|EEC83035.1| hypothetical protein OsI_28120 [Oryza sativa Indica Group]
 gb|EEE68185.1| hypothetical protein OsJ_26326 [Oryza sativa Japonica Group]
Length=399

 Score =   278 bits (711),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQM  +  QRCSM+YY+QK+YYKTA+LISNSCKA+A+LAGQTAEV+ +A++YGK+LG
Sbjct  219  GEFMQMRITPIQRCSMDYYLQKSYYKTAALISNSCKAVAVLAGQTAEVATLAYQYGKHLG  278

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +A+QLIDD+LDFTGTSA+LGKGSLSDI  GIVTAPILFAMEEYPQLR +V+QGFDDP NV
Sbjct  279  IAYQLIDDILDFTGTSASLGKGSLSDIHQGIVTAPILFAMEEYPQLRVIVEQGFDDPSNV  338

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D AL YL +S+GI+RTR LA +HA LA+DAID+LPES D  V  SR+AL +LT+++I RT
Sbjct  339  DAALAYLARSKGIERTRLLAAEHAKLAADAIDALPESKDGSVLISRQALKDLTEKLIKRT  398

Query  216  K  214
            K
Sbjct  399  K  399



>ref|XP_006468063.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=387

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT + +QRCSME YMQKTY KTA+L+SNSCKA+A L+GQ  EV+ +AFEYGKNLG
Sbjct  207  GETMQMTATFEQRCSMECYMQKTYNKTAALVSNSCKAVAYLSGQREEVATLAFEYGKNLG  266

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDD+LDFTGTSA+LGK SL+D+R+GI+TAPILFAMEE+PQLR  ++   D+P N+
Sbjct  267  LAYQLIDDILDFTGTSASLGKASLTDLRNGIITAPILFAMEEFPQLRAFINSSSDNPANL  326

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ LEYLGKS GIQRT ELA KHA+LA+ AIDSLPE+ D D   +R ALV +TQ++ITR 
Sbjct  327  DVILEYLGKSHGIQRTTELALKHASLAAAAIDSLPETHDVDATNARTALVHITQKIITRN  386

Query  216  K  214
            K
Sbjct  387  K  387



>ref|XP_006448992.1| hypothetical protein CICLE_v10015559mg [Citrus clementina]
 gb|ESR62232.1| hypothetical protein CICLE_v10015559mg [Citrus clementina]
Length=387

 Score =   270 bits (691),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT + +QRCSME YMQKTY KTA+L+SNSCKA+A L+GQ  EV+ +AFEYG+NLG
Sbjct  207  GETMQMTATFEQRCSMECYMQKTYNKTAALVSNSCKAVAYLSGQREEVATLAFEYGRNLG  266

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDD+LDFTGTSA+LGK SL+D+R+GI+TAPILFAMEE+PQL   ++   D+P NV
Sbjct  267  LAYQLIDDILDFTGTSASLGKASLTDLRNGIITAPILFAMEEFPQLHAFINSSSDNPANV  326

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ LEYLGKS GIQRT ELA KHA+LA+ AIDSLPE+ D D   +R ALV +TQ++ITR 
Sbjct  327  DVILEYLGKSHGIQRTTELAVKHASLAAAAIDSLPETHDVDATNARTALVHITQKIITRN  386

Query  216  K  214
            K
Sbjct  387  K  387



>ref|XP_004972656.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X5 [Setaria italica]
Length=313

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQM+ +  QRCSM+YY+QKTYYKTA+LISNSCKAIA+LA QT EV  +A++YG++LG
Sbjct  133  GELMQMSITPAQRCSMDYYLQKTYYKTAALISNSCKAIAVLAEQTTEVQALAYQYGRHLG  192

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +A+QLIDD+LDFTGTSA+LGK SLSDI  GIVTAPILFAMEE+P+L ++V+QGFDDP NV
Sbjct  193  IAYQLIDDILDFTGTSASLGKASLSDIHQGIVTAPILFAMEEFPELHEIVEQGFDDPLNV  252

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              AL+YL KS+GI+RTR LA +HA LA+ AID LP+S+D+ V  SR+AL +L Q+ + RT
Sbjct  253  KTALKYLSKSQGIKRTRSLAAEHAKLAAGAIDDLPDSEDQVVLNSRQALKDLAQKFMRRT  312

Query  216  K  214
            K
Sbjct  313  K  313



>gb|ACA21459.1| geranyl diphosphate synthase 3 [Picea abies]
Length=427

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT +++QRCSMEYYMQKT+YKTASL++NSCKAIAL+AGQ AEV ++A++YG+NLG
Sbjct  247  GEIMQMTNTNEQRCSMEYYMQKTFYKTASLMANSCKAIALIAGQPAEVCMLAYDYGRNLG  306

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QL+DDVLDFTGT+A+LGKGSLSDIR GIVTAPILFA+EE+PQL DV+++ F  P ++
Sbjct  307  LAYQLLDDVLDFTGTTASLGKGSLSDIRQGIVTAPILFALEEFPQLHDVINRKFKKPGDI  366

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            DLALE+LGKS GI++ ++LA +HA LA+ +++S P S+ E V+  R+AL++L+++VITRT
Sbjct  367  DLALEFLGKSDGIRKAKQLAAQHAGLAAFSVESFPPSESEYVKLCRKALIDLSEKVITRT  426

Query  216  K  214
            +
Sbjct  427  R  427



>gb|AEG47694.1| geranylgeranyl diphosphate synthase [Allium sativum]
Length=357

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT +S ++CSM+YY+QKTYYKT SLISNSCKAIA+LAGQTAEVSV+A++YG+NLG
Sbjct  181  GETMQMTNNSKKKCSMDYYLQKTYYKTGSLISNSCKAIAILAGQTAEVSVLAYDYGRNLG  240

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDF G+SA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR++VD+GF +  +V
Sbjct  241  LAFQLIDDVLDFVGSSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRELVDRGFHENEDV  300

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRS  262
            D AL+YLG+S+GIQ+TR+LA +HA LA +AI++LP++D E+ + S
Sbjct  301  DAALDYLGRSQGIQKTRDLAQEHATLAVNAIEALPKTDSENARIS  345



>ref|XP_004972655.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X4 [Setaria italica]
Length=365

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQM+ +  QRCSM+YY+QKTYYKTA+LISNSCKAIA+LA QT EV  +A++YG++LG
Sbjct  185  GELMQMSITPAQRCSMDYYLQKTYYKTAALISNSCKAIAVLAEQTTEVQALAYQYGRHLG  244

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +A+QLIDD+LDFTGTSA+LGK SLSDI  GIVTAPILFAMEE+P+L ++V+QGFDDP NV
Sbjct  245  IAYQLIDDILDFTGTSASLGKASLSDIHQGIVTAPILFAMEEFPELHEIVEQGFDDPLNV  304

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              AL+YL KS+GI+RTR LA +HA LA+ AID LP+S+D+ V  SR+AL +L Q+ + RT
Sbjct  305  KTALKYLSKSQGIKRTRSLAAEHAKLAAGAIDDLPDSEDQVVLNSRQALKDLAQKFMRRT  364

Query  216  K  214
            K
Sbjct  365  K  365



>ref|XP_004972654.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X3 [Setaria italica]
Length=393

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQM+ +  QRCSM+YY+QKTYYKTA+LISNSCKAIA+LA QT EV  +A++YG++LG
Sbjct  213  GELMQMSITPAQRCSMDYYLQKTYYKTAALISNSCKAIAVLAEQTTEVQALAYQYGRHLG  272

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +A+QLIDD+LDFTGTSA+LGK SLSDI  GIVTAPILFAMEE+P+L ++V+QGFDDP NV
Sbjct  273  IAYQLIDDILDFTGTSASLGKASLSDIHQGIVTAPILFAMEEFPELHEIVEQGFDDPLNV  332

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              AL+YL KS+GI+RTR LA +HA LA+ AID LP+S+D+ V  SR+AL +L Q+ + RT
Sbjct  333  KTALKYLSKSQGIKRTRSLAAEHAKLAAGAIDDLPDSEDQVVLNSRQALKDLAQKFMRRT  392

Query  216  K  214
            K
Sbjct  393  K  393



>ref|XP_004972652.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X1 [Setaria italica]
Length=442

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQM+ +  QRCSM+YY+QKTYYKTA+LISNSCKAIA+LA QT EV  +A++YG++LG
Sbjct  262  GELMQMSITPAQRCSMDYYLQKTYYKTAALISNSCKAIAVLAEQTTEVQALAYQYGRHLG  321

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +A+QLIDD+LDFTGTSA+LGK SLSDI  GIVTAPILFAMEE+P+L ++V+QGFDDP NV
Sbjct  322  IAYQLIDDILDFTGTSASLGKASLSDIHQGIVTAPILFAMEEFPELHEIVEQGFDDPLNV  381

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              AL+YL KS+GI+RTR LA +HA LA+ AID LP+S+D+ V  SR+AL +L Q+ + RT
Sbjct  382  KTALKYLSKSQGIKRTRSLAAEHAKLAAGAIDDLPDSEDQVVLNSRQALKDLAQKFMRRT  441

Query  216  K  214
            K
Sbjct  442  K  442



>ref|XP_004972641.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X1 [Setaria italica]
Length=393

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQM+ +  QRCSM+YY+QKTYYKTA+LISNSCKAIA+LA QT EV  +A++YG++LG
Sbjct  213  GELMQMSITPAQRCSMDYYLQKTYYKTAALISNSCKAIAVLAEQTTEVQALAYQYGRHLG  272

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +A+QLIDD+LDFTGTSA+LGK SLSDIR GIVTAPILFAMEE+P++ ++V+QGFDDP NV
Sbjct  273  IAYQLIDDILDFTGTSASLGKASLSDIRQGIVTAPILFAMEEFPEVHEIVEQGFDDPLNV  332

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              AL+YL KS+GI+RTR LA +HA LA+ AID L +S+D+ V  SR+AL +L Q+ + RT
Sbjct  333  KTALKYLSKSQGIERTRSLAAEHAKLAASAIDDLLDSEDQVVLNSRQALKDLAQKFMRRT  392

Query  216  K  214
            K
Sbjct  393  K  393



>gb|KDO75397.1| hypothetical protein CISIN_1g0181562mg, partial [Citrus sinensis]
 gb|KDO75398.1| hypothetical protein CISIN_1g0181562mg, partial [Citrus sinensis]
 gb|KDO75399.1| hypothetical protein CISIN_1g0181562mg, partial [Citrus sinensis]
Length=166

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  711  MEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLGLAFQLIDDVLDFTGT  532
            ME YMQKTY KTA+L+SNSCKA+A L+GQ  EV+ +AFEYGKNLGLA+QLIDD+LDFTGT
Sbjct  1    MECYMQKTYNKTAALVSNSCKAVAYLSGQREEVATLAFEYGKNLGLAYQLIDDILDFTGT  60

Query  531  SATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNVDLALEYLGKSRGIQR  352
            SA+LGK SL+D+R+GI+TAPILFAMEE+PQLR  ++   D+P NVD+ LEYLGKS GIQR
Sbjct  61   SASLGKASLTDLRNGIITAPILFAMEEFPQLRAFINSSSDNPANVDVILEYLGKSHGIQR  120

Query  351  TRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRTK  214
            T ELA KHA+LA+ AIDSLPE+ D D   +R ALV +TQ++ITR K
Sbjct  121  TTELALKHASLAAAAIDSLPETHDVDATNARTALVHITQKIITRNK  166



>ref|XP_004972653.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X2 [Setaria italica]
Length=439

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQM+ +  QRCSM+YY+QKTYYKTA+LISNSCKAIA+LA QT EV  +A++YG++LG
Sbjct  262  GELMQMSITPAQRCSMDYYLQKTYYKTAALISNSCKAIAVLAEQTTEVQALAYQYGRHLG  321

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +A+QLIDD+LDFTGTSA+LGK SLSDI  GIVTAPILFAMEE+P+L ++V+QGFDDP NV
Sbjct  322  IAYQLIDDILDFTGTSASLGKASLSDIHQGIVTAPILFAMEEFPELHEIVEQGFDDPLNV  381

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSR  259
              AL+YL KS+GI+RTR LA +HA LA+ AID LP+S+D+ V  SR
Sbjct  382  KTALKYLSKSQGIKRTRSLAAEHAKLAAGAIDDLPDSEDQVVLNSR  427



>gb|AFK35985.1| unknown [Lotus japonicus]
Length=132

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  609  VMAFEYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDV  430
            ++AFEYGKNLGLAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+PQLR +
Sbjct  1    MLAFEYGKNLGLAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPQLRAI  60

Query  429  VDQGFDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRAL  250
            V+ GF++P NVDLALEYLGKSRGIQRT+ELA KHANLA+ AIDSLPES DE+V+RSR+AL
Sbjct  61   VEDGFENPENVDLALEYLGKSRGIQRTKELAMKHANLAAAAIDSLPESGDEEVRRSRKAL  120

Query  249  VELTQRVITRTK  214
            ++LT  VITRTK
Sbjct  121  IDLTHIVITRTK  132



>ref|XP_010549510.1| PREDICTED: solanesyl diphosphate synthase 3, chloroplastic/mitochondrial-like 
isoform X2 [Tarenaya hassleriana]
Length=392

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 142/181 (78%), Gaps = 27/181 (15%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQM+++S+QR S                   CKAIALLAGQTAEV+++AFEYGKNLG
Sbjct  239  GETMQMSSTSEQRLS-------------------CKAIALLAGQTAEVAMLAFEYGKNLG  279

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLI+DVL FTGTS +L        +HGI+TAPILFAMEE+PQL +VV QGFD+P NV
Sbjct  280  LAYQLIEDVLAFTGTSTSL--------QHGIITAPILFAMEEFPQLIEVVHQGFDNPNNV  331

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ALEYLGKSRGIQRTRELA +HANLA+ AI SLPE+DDE+V+R RRAL++LT RVITR 
Sbjct  332  DIALEYLGKSRGIQRTRELALEHANLAAVAIRSLPETDDEEVKRCRRALIDLTHRVITRK  391

Query  216  K  214
            K
Sbjct  392  K  392



>ref|XP_010275057.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X3 [Nelumbo nucifera]
Length=361

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S +R SMEYY+QKTYYKTASLISNSCKAIALLAGQT EVS++A+EYG+NLG
Sbjct  238  GETMQMTTTSKERYSMEYYLQKTYYKTASLISNSCKAIALLAGQTTEVSMLAYEYGRNLG  297

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFA+EE+PQLR+VVD+GFD P +V
Sbjct  298  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAIEEFPQLREVVDRGFDKPSDV  357

Query  396  DLAL  385
            DL L
Sbjct  358  DLIL  361



>ref|XP_010275056.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial isoform 
X2 [Nelumbo nucifera]
Length=369

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S +R SMEYY+QKTYYKTASLISNSCKAIALLAGQT EVS++A+EYG+NLG
Sbjct  238  GETMQMTTTSKERYSMEYYLQKTYYKTASLISNSCKAIALLAGQTTEVSMLAYEYGRNLG  297

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFA+EE+PQLR+VVD+GFD P +V
Sbjct  298  LAFQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAIEEFPQLREVVDRGFDKPSDV  357

Query  396  DL  391
            DL
Sbjct  358  DL  359



>ref|XP_002975135.1| geranyl diphosphate synthase [Selaginella moellendorffii]
 gb|EFJ23920.1| geranyl diphosphate synthase [Selaginella moellendorffii]
Length=342

 Score =   222 bits (566),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ T  +++  SM+YY+QKT+YKTASLI+NSCK IA+LAG   EV+ +AF+YG++LG
Sbjct  146  GEVMQWTVDAEKSSSMDYYLQKTFYKTASLIANSCKCIAILAGHPKEVAALAFDYGRHLG  205

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QL+DD+LDFTGT A+LGK +LSD+R GI TAP+L+A+EE+P L++++D+ F DP +V
Sbjct  206  LAYQLVDDLLDFTGTKASLGKPALSDLREGIATAPVLYALEEHPALQELIDRKFKDPGDV  265

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D AL+ +  S GI++T+ELA +HA+ A+DA+   P +  E     RRAL ELT++VITR+
Sbjct  266  DSALKMVLASSGIRKTKELAREHASKAADAVAGFPPTTSEKASLCRRALTELTEQVITRS  325



>ref|XP_010090457.1| Solanesyl diphosphate synthase 3 [Morus notabilis]
 gb|EXB39515.1| Solanesyl diphosphate synthase 3 [Morus notabilis]
Length=670

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ+TT+SDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQT EV+++AFEYGKNLG
Sbjct  237  GETMQITTTSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTTEVAMLAFEYGKNLG  296

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRHGIVTAPILFAMEE+P+LR VV++GFD+P NV
Sbjct  297  LAYQLIDDVLDFTGTSASLGKGSLSDIRHGIVTAPILFAMEEFPELRAVVEEGFDNPCNV  356

Query  396  D  394
            D
Sbjct  357  D  357


 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  390  ALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRTK  214
            ALEYLGKSRGIQ+ RELA KHAN A++AI+SLPESDDEDV+RSRRAL++LTQRVITRTK
Sbjct  612  ALEYLGKSRGIQKARELAIKHANRAAEAIESLPESDDEDVKRSRRALIDLTQRVITRTK  670



>ref|XP_008644892.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X3 [Zea mays]
Length=331

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS++Q+ SMEYY+QKTYYKT+SLISNSCKA+A+LAG TAEVSV+A+EYG+NLG
Sbjct  182  GETMQISTSTEQQRSMEYYLQKTYYKTSSLISNSCKAVAILAGHTAEVSVLAYEYGRNLG  241

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVL+FTGTSA+LG GSLS IRHGI+TAP+L+AMEE+PQL +VVD+GF +P NV
Sbjct  242  LAFQLIDDVLNFTGTSASLGNGSLSHIRHGIITAPMLYAMEEFPQLLEVVDRGFGNPANV  301

Query  396  DLALEYLGKSRGIQRTR  346
            ++ L   G++ G++  R
Sbjct  302  EMPLTISGRAMGLKGQR  318



>ref|XP_008644890.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X1 [Zea mays]
Length=358

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS++Q+ SMEYY+QKTYYKT+SLISNSCKA+A+LAG TAEVSV+A+EYG+NLG
Sbjct  209  GETMQISTSTEQQRSMEYYLQKTYYKTSSLISNSCKAVAILAGHTAEVSVLAYEYGRNLG  268

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVL+FTGTSA+LG GSLS IRHGI+TAP+L+AMEE+PQL +VVD+GF +P NV
Sbjct  269  LAFQLIDDVLNFTGTSASLGNGSLSHIRHGIITAPMLYAMEEFPQLLEVVDRGFGNPANV  328

Query  396  DLALEYLGKSRGIQRTR  346
            ++ L   G++ G++  R
Sbjct  329  EMPLTISGRAMGLKGQR  345



>ref|XP_008644891.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
isoform X2 [Zea mays]
Length=356

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS++Q+ SMEYY+QKTYYKT+SLISNSCKA+A+LAG TAEVSV+A+EYG+NLG
Sbjct  207  GETMQISTSTEQQRSMEYYLQKTYYKTSSLISNSCKAVAILAGHTAEVSVLAYEYGRNLG  266

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDDVL+FTGTSA+LG GSLS IRHGI+TAP+L+AMEE+PQL +VVD+GF +P NV
Sbjct  267  LAFQLIDDVLNFTGTSASLGNGSLSHIRHGIITAPMLYAMEEFPQLLEVVDRGFGNPANV  326

Query  396  DLALEYLGKSRGIQRTR  346
            ++ L   G++ G++  R
Sbjct  327  EMPLTISGRAMGLKGQR  343



>ref|XP_007024981.1| Geranyl diphosphate synthase 1 isoform 3, partial [Theobroma 
cacao]
 gb|EOY27603.1| Geranyl diphosphate synthase 1 isoform 3, partial [Theobroma 
cacao]
Length=310

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 125/148 (84%), Gaps = 6/148 (4%)
 Frame = -3

Query  645  IALLAG----QTAEVSVMAFEYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVT  478
            +A+LAG      A VS+ A +  +  GLAFQLIDDVLDFTGTSA+LGKGSLSDI+HGIVT
Sbjct  165  LAVLAGDFLLSRACVSLAALKNTE--GLAFQLIDDVLDFTGTSASLGKGSLSDIQHGIVT  222

Query  477  APILFAMEEYPQLRDVVDQGFDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDS  298
            APILFAMEE+PQL  +V QGFD+P NVD+ALEYLGKS GIQRTRELA KHANLA+ AI+S
Sbjct  223  APILFAMEEFPQLHAIVYQGFDNPENVDIALEYLGKSDGIQRTRELAMKHANLAAAAIES  282

Query  297  LPESDDEDVQRSRRALVELTQRVITRTK  214
            LPES+DE V++SRRALV+LTQRVI R K
Sbjct  283  LPESNDEQVRKSRRALVDLTQRVIMRNK  310



>ref|XP_002977539.1| hypothetical protein SELMODRAFT_271252 [Selaginella moellendorffii]
 gb|EFJ21543.1| hypothetical protein SELMODRAFT_271252 [Selaginella moellendorffii]
Length=402

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ T  +++  SM+YY+QKT+YKTASLI+NSCK IA+LAG   EV+ +AF+YG++LG
Sbjct  222  GEVMQWTVDAEKSSSMDYYLQKTFYKTASLIANSCKCIAILAGHPKEVAALAFDYGRHLG  281

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QL+DD+LDFTGT A+LGK +LSD+R GI TAP+L+A+EE+P L++++D+ F DP +V
Sbjct  282  LAYQLVDDLLDFTGTKASLGKPALSDLREGIATAPVLYALEEHPALQELIDRKFKDPGDV  341

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D AL+ +  S GI++T+ELA +HA+ A+DA+ + P +  +     RRAL ELT++VITR+
Sbjct  342  DSALKMVLASSGIRKTKELAREHASKAADAVAAFPPTASDKASLCRRALTELTEQVITRS  401

Query  216  K  214
            K
Sbjct  402  K  402



>gb|KEH31512.1| geranylgeranyl pyrophosphate synthase [Medicago truncatula]
Length=490

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = -3

Query  579  GLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRN  400
            GLAFQLIDDVLDFTGTSA+LGKGSLSDI+HGIVTAPILFAMEE+PQLR +V++GF++P N
Sbjct  369  GLAFQLIDDVLDFTGTSASLGKGSLSDIQHGIVTAPILFAMEEFPQLRAIVEEGFENPEN  428

Query  399  VDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            V++AL+YLGKSRGIQ+T+ELA KHA+LA++AIDSLPE+D+E+V++SR+ALVELTQ VITR
Sbjct  429  VNIALDYLGKSRGIQKTKELAMKHASLAAEAIDSLPENDNEEVRKSRKALVELTQIVITR  488

Query  219  TK  214
            TK
Sbjct  489  TK  490


 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMTT+SDQRCSMEYYM+KTYYKTASLISNSCKAIA+LAGQTAEV+V+AFEYGKNL 
Sbjct  237  GEIMQMTTTSDQRCSMEYYMEKTYYKTASLISNSCKAIAILAGQTAEVAVLAFEYGKNLV  296

Query  576  LAF  568
              F
Sbjct  297  CIF  299



>ref|XP_001753309.1| predicted protein [Physcomitrella patens]
 gb|EDQ81938.1| predicted protein [Physcomitrella patens]
Length=317

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ++       +M+YYMQKT+YKTASL++NSCKAIA+LAGQ  +V+++AF YG++LG
Sbjct  137  GEIMQLSVEDKDMSNMDYYMQKTFYKTASLMANSCKAIAVLAGQPEDVALLAFNYGRHLG  196

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QL+DD LD+TGT+ TLGK +LSD+  GIVTAP+LFA++E+P++  ++ + F    ++
Sbjct  197  LAYQLVDDALDYTGTTKTLGKPALSDLGQGIVTAPVLFALKEFPEMSKLIQRKFKTVTDI  256

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + A+E + +SRGI +T  LA +HA  A DAI +LP +    VQ+ RRAL+++  +VITR+
Sbjct  257  NQAVEMVKESRGIAQTHALAAEHARKAVDAIANLPPNPSLHVQQCRRALIDIAHQVITRS  316

Query  216  K  214
            K
Sbjct  317  K  317



>ref|XP_002443995.1| hypothetical protein SORBIDRAFT_07g005530 [Sorghum bicolor]
 gb|EES13490.1| hypothetical protein SORBIDRAFT_07g005530 [Sorghum bicolor]
Length=365

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 30/181 (17%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+T +  QRCSM+YY+QKTYYKTA+LISNSCKAIA+L+GQT EV  +A++YG++LG
Sbjct  215  GELMQLTITPAQRCSMDYYLQKTYYKTAALISNSCKAIAVLSGQTTEVQALAYQYGRHLG  274

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
                                          IVTAP+LFAMEE+PQLR++V+QGFDDP NV
Sbjct  275  ------------------------------IVTAPVLFAMEEFPQLREIVEQGFDDPSNV  304

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D+ L+YL KS+GI+RTR LA +HA LA+ AID LP S+D  V  SR+AL +LTQ+ + RT
Sbjct  305  DVVLKYLQKSQGIERTRLLAAEHAKLAAVAIDDLPASEDPVVLSSRQALKDLTQKFLRRT  364

Query  216  K  214
            K
Sbjct  365  K  365



>ref|XP_003078851.1| geranyl diphosphat synthase (ISS) [Ostreococcus tauri]
Length=298

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 132/181 (73%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT   +   SME+Y++KTYYKTASLI+NS KAIALL G   + + +A++YGKNLG
Sbjct  118  GEVMQMTAKPESLSSMEHYVKKTYYKTASLIANSSKAIALLGGHGEKSADLAYDYGKNLG  177

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ  DDVLDF G+ + LGK +L D++ GI TAP+LFA+EE+P+L+++V++ F    +V
Sbjct  178  LAFQFQDDVLDFIGSESILGKPTLGDLKEGIATAPVLFAVEEFPELQELVERRFKHSGDV  237

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              A E + KS+GI RT+ELA +H +LA  AID+LP S+     + RRAL EL +R + R+
Sbjct  238  QRAHELVKKSKGIARTQELAREHRDLAIAAIDALPVSESSYANKCRRALKELARRSVERS  297

Query  216  K  214
            K
Sbjct  298  K  298



>gb|ABD77587.1| geranyl diphosphate synthase [Vitis vinifera]
Length=112

 Score =   189 bits (479),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  549  LDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNVDLALEYLGK  370
            LDFTGTSA+LGKGSLSDIRHGI+TAPILFA+EE+PQL  VV +G D+P ++DLAL+YLGK
Sbjct  1    LDFTGTSASLGKGSLSDIRHGIITAPILFAIEEFPQLDAVVKRGLDNPADIDLALDYLGK  60

Query  369  SRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRTK  214
            SRGIQRTRELA KHANLA++AIDSLPES DEDV RSRRAL++LT RVITRTK
Sbjct  61   SRGIQRTRELAMKHANLAAEAIDSLPESGDEDVLRSRRALIDLTHRVITRTK  112



>ref|XP_001417536.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95829.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=332

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 129/181 (71%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT   +   SM++Y++KTYYKTASLI+NS KAIALL G   E + +A++YGKNLG
Sbjct  152  GEVMQMTAKPESLSSMDHYVKKTYYKTASLIANSSKAIALLGGHGEESAQLAYDYGKNLG  211

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ  DDVLDF G+ + LGK +L D++ GI TAP+LFA++E+P+L D+V++ F    +V
Sbjct  212  LAFQFQDDVLDFIGSESLLGKPTLGDLKEGIATAPVLFAVQEFPELSDLVERRFKHSGDV  271

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              A E +  S+GI RT+ELA +H +LA  AID LP S+ +     RRAL EL +R + R+
Sbjct  272  QRAHELVKSSQGIARTQELAREHCDLAIAAIDRLPASESKYAMHCRRALKELAKRAVERS  331

Query  216  K  214
            K
Sbjct  332  K  332



>emb|CEF97630.1| Polyprenyl synthetase [Ostreococcus tauri]
Length=434

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 132/181 (73%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT   +   SME+Y++KTYYKTASLI+NS KAIALL G   + + +A++YGKNLG
Sbjct  254  GEVMQMTAKPESLSSMEHYVKKTYYKTASLIANSSKAIALLGGHGEKSADLAYDYGKNLG  313

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ  DDVLDF G+ + LGK +L D++ GI TAP+LFA+EE+P+L+++V++ F    +V
Sbjct  314  LAFQFQDDVLDFIGSESILGKPTLGDLKEGIATAPVLFAVEEFPELQELVERRFKHSGDV  373

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              A E + KS+GI RT+ELA +H +LA  AID+LP S+     + RRAL EL +R + R+
Sbjct  374  QRAHELVKKSKGIARTQELAREHRDLAIAAIDALPVSESSYANKCRRALKELARRSVERS  433

Query  216  K  214
            K
Sbjct  434  K  434



>gb|EMT09081.1| Decaprenyl-diphosphate synthase subunit 1 [Aegilops tauschii]
Length=439

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT +  QRCSM+YY+QKTYYKTA+LISNSCKA+A+L+GQTAEV+ +A++YG++LG
Sbjct  159  GELMQMTVTPAQRCSMDYYLQKTYYKTAALISNSCKAVAVLSGQTAEVAGLAYQYGRHLG  218

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +A+QLIDD+LDFTGTSA+LGKGSLSDI  GIVTAP+LFAMEE+P+LR  V+ GF+DP +V
Sbjct  219  IAYQLIDDILDFTGTSASLGKGSLSDIHQGIVTAPVLFAMEEFPELRGSVEHGFNDPSDV  278



>ref|XP_010651670.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
[Vitis vinifera]
Length=110

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -3

Query  711  MEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLGLAFQLIDDVLDFTGT  532
            MEYY+QKTYYKTASLISNSCKA ALLAGQTAEVS++AFEY KNLGLAFQLIDDVLDFTGT
Sbjct  1    MEYYLQKTYYKTASLISNSCKASALLAGQTAEVSMLAFEYAKNLGLAFQLIDDVLDFTGT  60

Query  531  SATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNVDL  391
            SA+LGKGSLSDIR+GI+TAPILFA+EE+PQL  VV +G D+P ++DL
Sbjct  61   SASLGKGSLSDIRNGIITAPILFAIEEFPQLDAVVKRGLDNPADIDL  107



>ref|XP_010648078.1| PREDICTED: solanesyl-diphosphate synthase 1, mitochondrial-like 
[Vitis vinifera]
Length=168

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -3

Query  720  RCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLGLAFQLIDDVLDF  541
            R  MEYY+QKTYYKTASLISNS KA ALLAGQTAEVS++AFEY KNLGLAFQLID+VLDF
Sbjct  56   RSVMEYYLQKTYYKTASLISNSSKASALLAGQTAEVSMLAFEYAKNLGLAFQLIDNVLDF  115

Query  540  TGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNVDLA  388
            TGTSA+LGKGSLSDIR+GI+TAPILFA+EE+PQL  VV +G D+P ++DL 
Sbjct  116  TGTSASLGKGSLSDIRNGIITAPILFAIEEFPQLDAVVKRGLDNPADIDLV  166



>ref|XP_002505261.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66519.1| predicted protein [Micromonas sp. RCC299]
Length=327

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT   ++  S ++Y QKTY+KTASLI+NS KAI LL G   E +  A++YG++LG
Sbjct  147  GEVMQMTAKPERLMSFDHYFQKTYFKTASLIANSAKAIVLLGGHDTETASHAYDYGRHLG  206

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ  DDVLDF G+ + LGK +L D++ GI TAP+LFA EE+PQL  ++++ F    +V
Sbjct  207  LAFQFQDDVLDFVGSGSVLGKPTLGDLKEGIATAPVLFAAEEHPQLSALIERRFKHVGDV  266

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LA + + +S GI+RT+ELA +H+ LA  A+++LP  D     R R+ L EL    + R 
Sbjct  267  ELAHDLVKRSDGIERTKELAREHSALAVKAVEALPSIDCPHALRCRKGLKELAHMAVNRI  326

Query  216  K  214
            K
Sbjct  327  K  327



>gb|KDO75396.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=243

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  141  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  200

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAME  454
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRH I  + +  A E
Sbjct  201  LAYQLIDDVLDFTGTSASLGKGSLSDIRHVIYLSLLFIASE  241



>ref|XP_001762604.1| predicted protein [Physcomitrella patens]
 gb|EDQ72727.1| predicted protein, partial [Physcomitrella patens]
Length=340

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 129/181 (71%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+++      + +    KT+YKTASL++NSCK+IA+LAGQ  EV+  AF+YG++LG
Sbjct  160  GEIMQLSSEYKNMSNFDVISWKTFYKTASLMANSCKSIAVLAGQPEEVANRAFDYGRHLG  219

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LA+QL+DD L++TGT+ TLGK +LSD+  G+VTAP+LFA+ ++P++  ++   F    + 
Sbjct  220  LAYQLVDDALNYTGTTKTLGKSALSDLGQGVVTAPVLFALHQFPEMSKLIQLKFKTATDR  279

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + A+E + +S+G+ +T   AT HA  A DAI SLP +    VQ+ RRAL+E+  +VITR+
Sbjct  280  NQAVEMVKQSQGVAQTLAFATVHAQKAVDAIISLPPNSSLYVQQCRRALIEIAHQVITRS  339

Query  216  K  214
            K
Sbjct  340  K  340



>ref|XP_003060355.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55124.1| predicted protein [Micromonas pusilla CCMP1545]
Length=311

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT  +D+  S ++Y QKTY+KTASLI+NS KAI LL G     +  A++YG++LG
Sbjct  131  GEVMQMTAKADRLTSFDHYFQKTYFKTASLIANSAKAIVLLGGHDVTTAESAYQYGRHLG  190

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ  DDVLDFTGT + LGK +L D+R GI TAP+LFA EE+  L  ++++ F +  +V
Sbjct  191  LAFQFQDDVLDFTGTGSVLGKPTLGDLREGIATAPVLFAAEEHEGLGALIERRFKNVGDV  250

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + A +++ +S+GI+RT+ LA +H+  A  AI+SLP  D     R R+ L EL    + R 
Sbjct  251  ETAHDWVKRSKGIERTKALAREHSAEAVRAIESLPPIDCPHAMRCRKGLKELAYMAVNRI  310

Query  216  K  214
            K
Sbjct  311  K  311



>gb|KDO75395.1| hypothetical protein CISIN_1g014276mg [Citrus sinensis]
Length=348

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTTSSDQRCSM+YYMQKTYYKTASLISNSCKAIALLAGQTAEV+++AF+YGKNLG
Sbjct  246  GETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLG  305

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAME  454
            LA+QLIDDVLDFTGTSA+LGKGSLSDIRH I  + +  A E
Sbjct  306  LAYQLIDDVLDFTGTSASLGKGSLSDIRHVIYLSLLFIASE  346



>ref|XP_002948178.1| hypothetical protein VOLCADRAFT_88541 [Volvox carteri f. nagariensis]
 gb|EFJ50585.1| hypothetical protein VOLCADRAFT_88541 [Volvox carteri f. nagariensis]
Length=403

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 132/193 (68%), Gaps = 12/193 (6%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAE------------V  613
            GE MQMT +S+Q   +++Y+ KTY KTASL++NS ++IA+LAG   E            V
Sbjct  211  GEIMQMTATSEQLLDLDHYLAKTYCKTASLMANSSRSIAVLAGVPPEHVCGAVCGSGDVV  270

Query  612  SVMAFEYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRD  433
              MA+ YG++LGLAFQ++DD+LD TG+S+ LGK +L+D+R G+ TAP+LFA +E P+LR 
Sbjct  271  CDMAWSYGRHLGLAFQVVDDLLDLTGSSSVLGKPALNDLRSGLATAPVLFAAQEEPELRP  330

Query  432  VVDQGFDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRA  253
            ++ + F    +V LA+  + +++G++R  ELA  HA +A+D I  LP +  +  + +R A
Sbjct  331  LILRRFKQEGDVALAMTLIQRTQGLRRAEELAAHHAKIAADMIRCLPVAQSDHAEIAREA  390

Query  252  LVELTQRVITRTK  214
            L+++T +V+TR K
Sbjct  391  LIQITHKVLTRKK  403



>dbj|BAF98299.1| geranyl-diphosphate synthase [Hevea brasiliensis]
Length=328

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT +S+QRCSMEYYM+KTYYKTASLISNSCKAIALLAGQT EV+ +AFEYGKNLG
Sbjct  232  GETMQMTCTSEQRCSMEYYMKKTYYKTASLISNSCKAIALLAGQTTEVATLAFEYGKNLG  291

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGI  484
            LAFQLIDDVLDFTGT A+LGKGSLSDIRH I
Sbjct  292  LAFQLIDDVLDFTGTFASLGKGSLSDIRHVI  322



>ref|XP_005651593.1| terpenoid synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE27049.1| terpenoid synthase [Coccomyxa subellipsoidea C-169]
Length=427

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 133/181 (73%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE +QMT++ +   S+++Y +KT++KTASL++NS KA+A+L GQ  +VS +A++YG++LG
Sbjct  247  GEILQMTSTDEDLLSLDHYARKTFHKTASLMANSSKAVAILGGQPTDVSELAWQYGRHLG  306

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ +DD+LDFTG +  LGK +L+D+R G+ TAP++FA EE+PQLR +V + F    +V
Sbjct  307  LAFQFVDDILDFTGNTLQLGKPALNDLRSGLATAPVIFAAEEHPQLRQLVLRKFKSEGDV  366

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LA   +  S+GIQR R+LA +HA LA+ A+ S+P +  E     R+AL ++T +V+ R 
Sbjct  367  ELAQRLVFDSQGIQRARDLAAEHAALAAQAVASMPPAATEHASLCRQALTDITAKVLARK  426

Query  216  K  214
            K
Sbjct  427  K  427



>dbj|BAF98298.1| geranyl-diphosphate synthase [Hevea brasiliensis]
Length=330

 Score =   167 bits (423),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMT++S+QRCSM++YMQKTYYKTASLIS+SCKAIALLAGQT EV+++AFEYGK+LG
Sbjct  235  GETMQMTSTSEQRCSMDHYMQKTYYKTASLISDSCKAIALLAGQTTEVAMLAFEYGKSLG  294

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGI  484
            LAFQLIDDVLDFTGTSA+LGKGSLSDIRH I
Sbjct  295  LAFQLIDDVLDFTGTSASLGKGSLSDIRHVI  325



>ref|XP_001691069.1| geranyl diphosphate synthase [Chlamydomonas reinhardtii]
 gb|EDP05515.1| geranyl diphosphate synthase [Chlamydomonas reinhardtii]
Length=410

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 130/181 (72%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQMT +S+Q   +E+Y+ KTY KTASL++NS +++A+LAG   EV  MA+ YG++LG
Sbjct  230  GEIMQMTATSEQLLDLEHYLAKTYCKTASLMANSSRSVAVLAGAAPEVCDMAWSYGRHLG  289

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQ++DD+LD TG+S+ LGK +L+D+R G+ TAP+LFA +E P L+ ++ + F    +V
Sbjct  290  IAFQVVDDLLDLTGSSSVLGKPALNDMRSGLATAPVLFAAQEEPALQALILRRFKHDGDV  349

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              A+  + +++G++R  ELA +HA  A+D I  LP +  +  + +R AL+++T RV+TR 
Sbjct  350  TKAMSLIERTQGLRRAEELAAQHAKAAADMIRCLPTAQSDHAEIAREALIQITHRVLTRK  409

Query  216  K  214
            K
Sbjct  410  K  410



>gb|KJB68301.1| hypothetical protein B456_010G237700 [Gossypium raimondii]
Length=124

 Score =   158 bits (400),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 99/144 (69%), Gaps = 20/144 (14%)
 Frame = -3

Query  645  IALLAGQTAEVSVMAFEYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPIL  466
            +AL + QT EV++ AFEYGKNL   F       D TGTSA+LGKGSLSDIR GIVTAPIL
Sbjct  1    MALSSDQTPEVAMSAFEYGKNLACKFH------DVTGTSASLGKGSLSDIRQGIVTAPIL  54

Query  465  FAMEEYPQLRDVVDQGFDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPES  286
            FAMEE+P L+               ALEY+ KSRGIQ T ELA KHANL + AIDSLPES
Sbjct  55   FAMEEFPWLKS--------------ALEYVWKSRGIQMTTELAIKHANLVAAAIDSLPES  100

Query  285  DDEDVQRSRRALVELTQRVITRTK  214
             + DV +SR AL+ LT+ ++TR K
Sbjct  101  SNIDVTKSRHALINLTRILVTRNK  124



>gb|ESA00262.1| hypothetical protein GLOINDRAFT_69405 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52005.1| trans-hexaprenyltranstransferase [Rhizophagus irregularis DAOM 
197198w]
Length=478

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 123/182 (68%), Gaps = 7/182 (4%)
 Frame = -3

Query  756  GETMQM-TTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNL  580
            GE MQ+    S    + EYYM+KTY KTASL++  C+A ++L G T EVS +A+ YG+N+
Sbjct  303  GEFMQLKNVPSKGTATFEYYMEKTYMKTASLMAKGCRAASVLGGSTQEVSEIAYTYGRNI  362

Query  579  GLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRN  400
            GLAFQL+DD+LDF  +S  LGK + +D+R G+ TAP+L+A EEYP+L  ++ + F    +
Sbjct  363  GLAFQLVDDMLDFIVSSKELGKPAGADLRLGLATAPVLYAWEEYPELGPLIKRKFSQEGD  422

Query  399  VDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            V  A E + +S GI++T+ LA  H   A +AI  LPESD      +R AL++L+Q+++TR
Sbjct  423  VKKASELVYQSNGIEQTKLLAASHCQTAINAILKLPESD------ARNALIQLSQKILTR  476

Query  219  TK  214
             K
Sbjct  477  KK  478



>ref|XP_005708177.1| geranyl diphosphate synthase [Galdieria sulphuraria]
 gb|EME31657.1| geranyl diphosphate synthase [Galdieria sulphuraria]
Length=425

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 125/182 (69%), Gaps = 6/182 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQ-RCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNL  580
            GE +QMT   D  +  +E Y+QKT+ KTASLI+NSC+A+ALL+    E+  +AFEYG++L
Sbjct  249  GEVLQMTADEDNSKDKLEVYLQKTFLKTASLIANSCQAVALLSNCPKEIVQVAFEYGRHL  308

Query  579  GLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRN  400
            GLA+QL+DD LDFTGTS++LGK +L+DI  G +TAP+LFA+E++P++R+   + F  P +
Sbjct  309  GLAYQLVDDALDFTGTSSSLGKPALADIHQGTLTAPVLFAIEQFPEIREYAKRRFQYPDD  368

Query  399  VDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            +   L  + KS+GI+RT +LA +H  LA + I    +         R+AL+E+   V+TR
Sbjct  369  ISKTLGAVEKSKGIERTLDLAKEHCCLAKEGITQTLQDTS-----YRQALLEMADFVLTR  423

Query  219  TK  214
             +
Sbjct  424  KQ  425



>ref|XP_007511824.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17945.1| predicted protein [Bathycoccus prasinos]
Length=440

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 125/200 (63%), Gaps = 19/200 (10%)
 Frame = -3

Query  756  GETMQMTTSSDQ-------------------RCSMEYYMQKTYYKTASLISNSCKAIALL  634
            GE MQMT + D+                     S+E Y++K+YYKTASLI NS KA+ALL
Sbjct  241  GEVMQMTQAKDEDERSGSGSSSSSSSSSSSSSSSIERYIEKSYYKTASLIGNSAKAVALL  300

Query  633  AGQTAEVSVMAFEYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAME  454
             G ++E S +A  +G++LGLAFQ  DDVLD+ G S+ LGK +L D+R GI TAP+LFA E
Sbjct  301  GGHSSETSEIAERFGRHLGLAFQFRDDVLDYIGDSSLLGKPTLGDLREGIATAPVLFAAE  360

Query  453  EYPQLRDVVDQGFDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDED  274
            ++P+L  ++ + F +  +V+ A + + +S GI+   +LA +H NLA DA++ LP+ D E 
Sbjct  361  KFPELHSLIKRRFKEIGDVERAAKLVFESDGIEMASDLANEHRNLALDALEELPDIDCEF  420

Query  273  VQRSRRALVELTQRVITRTK  214
                R AL E+T R + R K
Sbjct  421  ANTCRAALREITNRAVDRKK  440



>ref|WP_019501792.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=323

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 126/179 (70%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q  T+ D   ++E Y++K++YKTASLI+ S KA  +L+G  +  +   F +G++ G
Sbjct  149  GEIRQSLTAFDCSLTLEDYLEKSFYKTASLIAGSSKAAGVLSGVNSMQAEQLFNFGRHFG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQ++DD+LDFT ++ TLGK + SD++ G +TAP+LFA+EEYPQL++++D GF++P ++
Sbjct  209  IAFQIVDDILDFTSSTETLGKPAGSDLQQGNLTAPVLFALEEYPQLQELIDGGFNEPGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
              AL  + KS GIQR+R+LA  HA LA +AI+ LP S        +++L+++T  ++ R
Sbjct  269  ANALALVQKSDGIQRSRDLAKTHAKLAVNAIEWLPTS------VHKQSLLDVTDYILER  321



>ref|WP_009786611.1| prenyltransferase [Lyngbya sp. PCC 8106]
 gb|EAW34883.1| solanesyl diphosphate synthase [Lyngbya sp. PCC 8106]
Length=323

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 120/179 (67%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+  Y++K+YYKTASL++NS KA  LL+G +AE++   + YG+NLG
Sbjct  149  GEIQQGLNRFDTGMSINAYLEKSYYKTASLVANSSKAAGLLSGVSAELAEDLYSYGQNLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG++ TLGK + SD++ G +TAP LF +EE P L  ++++ F    ++
Sbjct  209  LAFQIVDDILDFTGSTETLGKPAASDLKSGNLTAPTLFTLEETPSLEALIEREFAQEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + A+  + +S  IQR+RELA  HA LA + I   P+ D      SR+AL+EL+  V++R
Sbjct  269  EQAITLIKESSAIQRSRELAAHHAKLAVEHISKFPDCD------SRKALIELSDYVLSR  321



>ref|WP_006625848.1| MULTISPECIES: prenyltransferase [Arthrospira]
 emb|CCE16367.1| octaprenyl-diphosphate synthase (Octaprenyl pyrophosphate synthetase) 
(OPP synthetase) [Arthrospira sp. PCC 8005]
 gb|EKD06288.1| solanesyl diphosphate synthase [Arthrospira platensis C1]
 emb|CDM94978.1| octaprenyl-diphosphate synthase (Octaprenyl pyrophosphate synthetase) 
(OPP synthetase) [Arthrospira sp. PCC 8005]
Length=323

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 123/179 (69%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y++K+YYKTASLI+NS KA  LL+G +AE++   ++YG+N+G
Sbjct  149  GEIQQGLNRFDTSLSIEAYLEKSYYKTASLIANSSKAAGLLSGVSAELAEDLYKYGRNIG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG++ +LGK + SD++ G +TAP LFA+ E P L  ++D+ F    ++
Sbjct  209  LAFQIVDDILDFTGSTESLGKPAASDLKSGNLTAPTLFALAEKPFLETLIDREFAQDGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + A+  + +S GI+++RELA  HA +A + I  LP S+      SR+ALVEL   V++R
Sbjct  269  EQAIALIQESSGIEKSRELAIHHAQVAVEHIKQLPPSE------SRQALVELGDYVVSR  321



>ref|WP_026097328.1| prenyltransferase [Geitlerinema sp. PCC 7105]
Length=323

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 123/179 (69%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q  +  D   S+E Y++K+YYKTASLI+NS KA A+L+G + E++   + YG+++G
Sbjct  149  GEIQQGLSRFDADLSLEAYLEKSYYKTASLIANSSKAAAVLSGVSPEMANHLYYYGRDVG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTGT+ TLGK + SD+R G +TAP+L+A+EE P L  ++ + F +P ++
Sbjct  209  LAFQIVDDILDFTGTTETLGKPAASDLRSGNLTAPVLYALEEQPLLETLIAREFAEPDDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            D AL  + +S GI+R+R LA +H  LA + ++ LP S+      SR+AL  L   ++ R
Sbjct  269  DRALALIEESNGIERSRTLAAEHTRLAIEHLECLPASE------SRQALTNLADYILRR  321



>ref|WP_006618860.1| solanesyl diphosphate synthase [Arthrospira platensis]
 dbj|BAI93161.1| solanesyl diphosphate synthase [Arthrospira platensis NIES-39]
 gb|KDR57957.1| prenyltransferase [Arthrospira platensis str. Paraca]
Length=323

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 123/179 (69%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y++K+YYKTASLI+NS KA  LL+G +AE++   ++YG+N+G
Sbjct  149  GEIQQGLNRFDTSLSIEAYLEKSYYKTASLIANSSKAAGLLSGVSAELAEDLYKYGRNIG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG++ +LGK + SD++ G +TAP LFA+ E P L  ++D+ F    ++
Sbjct  209  LAFQIVDDILDFTGSTESLGKPAASDLKSGNLTAPTLFALAEKPFLETLIDREFAQDGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + A+  + +S GI ++RELA  HA +A + I+ LP S+      SR+ALVEL   V++R
Sbjct  269  EQAIALIQESSGIDKSRELAIHHAQVAVEHINQLPPSE------SRQALVELGDYVVSR  321



>gb|EWC47979.1| mitochondrial putative hexaprenyl pyrophosphate synthase [Drechslerella 
stenobrocha 248]
Length=491

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 119/168 (71%), Gaps = 6/168 (4%)
 Frame = -3

Query  717  CSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLGLAFQLIDDVLDFT  538
             + E+Y+QKTY K+ASLIS SC+A ALL G T EV+  A+ YGKNLGL+FQL+DD+LD+T
Sbjct  330  AAFEHYIQKTYLKSASLISKSCRAAALLGGSTREVADAAYIYGKNLGLSFQLVDDLLDYT  389

Query  537  GTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNVDLALEYLGKSRGI  358
             TS+ LGK + +D++ G+ TAP+LFA E+Y +L  ++++ F +P +VD A E + KS G+
Sbjct  390  VTSSELGKPAQADLKLGLATAPVLFAWEQYEELGPMINRKFAEPGDVDKAWEMVQKSNGL  449

Query  357  QRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRTK  214
            QRTRELA   +  A DAI S P+S+      ++  L ++ ++ +TR K
Sbjct  450  QRTRELAESFSRKAIDAISSFPDSE------AKEGLEQIARKGLTRKK  491



>emb|CEP10497.1| hypothetical protein [Parasitella parasitica]
Length=440

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 127/186 (68%), Gaps = 13/186 (7%)
 Frame = -3

Query  756  GETMQMTTSSD-------QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAF  598
            GE MQM  + +       +  + ++YM KTY KT SLI+ SCK+ A+L G T EV+ +A+
Sbjct  259  GEFMQMRNTKEGESGKVKKLSTFDHYMVKTYMKTGSLIAQSCKSSAILGGSTKEVATIAY  318

Query  597  EYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQG  418
            ++GKNLGLAFQL+DD+LDFT T+A LGK + +D++ G+ TAP+LFA EEYP+L  ++ + 
Sbjct  319  DFGKNLGLAFQLVDDMLDFTVTAAELGKPAGADLKLGLATAPVLFAWEEYPELEPLIKRK  378

Query  417  FDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELT  238
            F    + + A + + +S G+++T +LA  H  LA+DA+  LP SD      +R ALV++T
Sbjct  379  FSIQGDEEKARDLVYQSNGLKKTLDLAKTHCKLATDALYKLPASD------ARSALVQIT  432

Query  237  QRVITR  220
            ++++TR
Sbjct  433  EKLLTR  438



>emb|CBN74415.1| geranyl-diphosphate synthase [Ectocarpus siliculosus]
Length=513

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 117/180 (65%), Gaps = 6/180 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE +QM  + D   + EYY++K YYKT SL++NSCKA A+L     EV  +AFEYGK +G
Sbjct  339  GEVLQMRPTEDGGGAFEYYVRKNYYKTGSLMANSCKASAVLGQHDLEVQEVAFEYGKRVG  398

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQL+DD+LDF G + TLGK +L+D+R G+ TAP+L A E+ P L  ++ + F  P +V
Sbjct  399  LAFQLVDDILDFEGNTFTLGKPALNDLRQGLATAPVLLAAEQQPGLAKLISRKFRGPGDV  458

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D ALE + +S GI R +E+A   A  A  AI +L +S  ++      ALV+L  +++ R 
Sbjct  459  DEALELVHRSDGIARAKEVAVVQAEKAMSAILTLHDSPAQN------ALVQLAHKIVNRN  512



>gb|ABD01445.1| solanesyl diphosphate synthase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=320

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 125/179 (70%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q  T  D   SME Y+ K++YKTASL+S S KA  LL+G + EV+   F++G++LG
Sbjct  146  GEVRQSLTRFDPDVSMEDYLAKSFYKTASLMSGSSKAAGLLSGVSEEVADRLFDFGRDLG  205

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQ++DD+LDFT ++ TLGK   SD+  G +TAP+LFA+EE+PQ+R+++ +   +P+++
Sbjct  206  IAFQIVDDLLDFTASAETLGKPVGSDLIQGNLTAPVLFALEEFPQMRELILRELSNPQDL  265

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
              ALE++ +S GI R+R+LA  +A  A++A+ SLP+S       +RRAL ++   V+ R
Sbjct  266  KQALEWVYQSEGIPRSRQLARDYAQRAAEALYSLPDS------AARRALFQMVDYVLER  318



>ref|WP_011431085.1| prenyltransferase [Synechococcus sp. JA-3-3Ab]
 gb|ABD00412.1| solanesyl diphosphate synthase [Synechococcus sp. JA-3-3Ab]
Length=323

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 125/181 (69%), Gaps = 6/181 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q  T  D   S+E Y+ K++YKTASLIS S KA  LL+G + EV+   F++G++LG
Sbjct  149  GEVRQSLTRFDPDVSLEEYLAKSFYKTASLISGSSKAAGLLSGVSPEVADRLFDFGRDLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQ++DD+LDFT ++  LGK   SD+  G +TAP+LFA+EE+PQ+R+++ +   +P+++
Sbjct  209  IAFQIVDDLLDFTASAEMLGKPVGSDLIQGNLTAPVLFALEEFPQMRELILRELAEPQDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
              ALE++ +S GI R+RELA  +A  A++A++ LP+S       +RRAL ++   V+ R 
Sbjct  269  QQALEWVYQSNGIPRSRELARDYARRAAEALEVLPDS------VARRALFQMVDYVLERA  322

Query  216  K  214
            +
Sbjct  323  R  323



>gb|EIE78042.1| hypothetical protein RO3G_02746 [Rhizopus delemar RA 99-880]
Length=471

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 128/187 (68%), Gaps = 14/187 (7%)
 Frame = -3

Query  756  GETMQMTTSSDQRC--------SMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMA  601
            GE MQ+  + D +         + ++YM+KTY KT SLI+ SCKA A+L   T EV+ +A
Sbjct  289  GEFMQLKNTKDDKSFGKAKKLSTFDHYMEKTYMKTGSLIALSCKASAVLGDTTDEVATIA  348

Query  600  FEYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQ  421
            F++GKNLGLAFQLIDD+LDFT T+A LGK S +D++ G+ TAP+LFA EEYP+L  ++ +
Sbjct  349  FDFGKNLGLAFQLIDDMLDFTVTAAELGKPSGADLKLGLATAPVLFAWEEYPELEPLIKR  408

Query  420  GFDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVEL  241
             F +  + + A + + +S G+++T +LAT H   A ++++ LP SD      +R AL+++
Sbjct  409  KFSEKGDEERARDLVYRSDGLKKTLDLATLHCKYAIESLNKLPASD------ARSALIQI  462

Query  240  TQRVITR  220
            T++++TR
Sbjct  463  TEKLLTR  469



>emb|CEG63109.1| hypothetical protein RMATCC62417_00312 [Rhizopus microsporus]
Length=470

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 129/187 (69%), Gaps = 14/187 (7%)
 Frame = -3

Query  756  GETMQMTTSSDQR--------CSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMA  601
            GE MQ+  + D++         + ++YM+KTY KT SLI+ SCK+ A+L   T EV+ +A
Sbjct  288  GEFMQLRNTKDEQGTDKVKKLSTFDHYMKKTYMKTGSLIALSCKSSAVLGNVTDEVANVA  347

Query  600  FEYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQ  421
            F++GKNLGLAFQL+DD+LDFT T+A LGK + +D++ G+ TAP+LFA EEYP+L  ++ +
Sbjct  348  FDFGKNLGLAFQLVDDMLDFTVTAAELGKPAGADLKLGLATAPVLFAWEEYPELEPLIKR  407

Query  420  GFDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVEL  241
             F +  + + A + + KS G+++T +LAT H   A DA++ LP SD      +R AL+++
Sbjct  408  KFSEKGDEERARDLVYKSDGLKKTLDLATLHCGYAIDALNKLPSSD------ARSALIQI  461

Query  240  TQRVITR  220
            T++++TR
Sbjct  462  TEKLLTR  468



>ref|XP_004363243.1| trans-prenyltransferase [Dictyostelium fasciculatum]
 gb|EGG25392.1| trans-prenyltransferase [Dictyostelium fasciculatum]
Length=485

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 120/179 (67%), Gaps = 9/179 (5%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+ ++     S E Y++KTY KTASLISNSCKA ALL G+ A  + +AFE+GKNLG
Sbjct  314  GEFMQVKSN---ESSFEQYLRKTYLKTASLISNSCKATALLGGEDAHTANLAFEFGKNLG  370

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQLIDD+LD+T T+  LGK + +D+  G+ TAP+L+A  E+PQL D++ + F    +V
Sbjct  371  LAFQLIDDLLDYTSTTEVLGKQAFADLAQGLATAPVLYASIEHPQLLDMISRKFSADGDV  430

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + A   + KSRGI+ TR LAT++ N A + +   P+S+  DV      L+ L   ++TR
Sbjct  431  EEARSLVFKSRGIEMTRALATEYINKAIEILIQFPKSEARDV------LILLCHTIVTR  483



>ref|WP_041436149.1| prenyltransferase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=323

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 125/179 (70%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q  T  D   SME Y+ K++YKTASL+S S KA  LL+G + EV+   F++G++LG
Sbjct  149  GEVRQSLTRFDPDVSMEDYLAKSFYKTASLMSGSSKAAGLLSGVSEEVADRLFDFGRDLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQ++DD+LDFT ++ TLGK   SD+  G +TAP+LFA+EE+PQ+R+++ +   +P+++
Sbjct  209  IAFQIVDDLLDFTASAETLGKPVGSDLIQGNLTAPVLFALEEFPQMRELILRELSNPQDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
              ALE++ +S GI R+R+LA  +A  A++A+ SLP+S       +RRAL ++   V+ R
Sbjct  269  KQALEWVYQSEGIPRSRQLARDYAQRAAEALYSLPDS------AARRALFQMVDYVLER  321



>gb|EPB89085.1| hypothetical protein HMPREF1544_04076 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=469

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 128/186 (69%), Gaps = 13/186 (7%)
 Frame = -3

Query  756  GETMQMTTSSD-------QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAF  598
            GE MQ+  + +       +  + ++YM+KTY KT SLI+ SCKA A+L G T EV+ +A+
Sbjct  288  GEFMQLRNTKEGESGKVKKLSTFDHYMEKTYMKTGSLIAQSCKASAVLGGSTKEVANIAY  347

Query  597  EYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQG  418
            ++GKNLGLAFQL+DD+LDFT T+A LGK + +D++ G+ TAP+LFA EEYP+L  ++ + 
Sbjct  348  DFGKNLGLAFQLVDDMLDFTVTAAELGKPAGADLKLGLATAPVLFAWEEYPELEPLIKRK  407

Query  417  FDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELT  238
            F    + + A + + +S G+++T +LA  H  LA+DA+  LP SD      +R ALV++T
Sbjct  408  FSVKGDEEKARDLVYQSDGLKKTLDLAQIHCKLATDALYKLPSSD------ARSALVQIT  461

Query  237  QRVITR  220
            ++++TR
Sbjct  462  EKLLTR  467



>emb|CAD42868.1| solanesyl pyrophosphate synthase [Mucor circinelloides f. lusitanicus]
Length=471

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 128/186 (69%), Gaps = 13/186 (7%)
 Frame = -3

Query  756  GETMQMTTSSD-------QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAF  598
            GE MQ+  + +       +  + ++YM+KTY KT SLI+ SCKA A+L G T EV+ +A+
Sbjct  290  GEFMQLRNTKEGESGKVKKLSTFDHYMEKTYMKTGSLIAQSCKASAVLGGSTKEVANIAY  349

Query  597  EYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQG  418
            ++GKNLGLAFQL+DD+LDFT T+A LGK + +D++ G+ TAP+LFA EEYP+L  ++ + 
Sbjct  350  DFGKNLGLAFQLVDDMLDFTVTAAELGKPAGADLKLGLATAPVLFAWEEYPELEPLIKRK  409

Query  417  FDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELT  238
            F    + + A + + +S G+++T +LA  H  LA+DA+  LP SD      +R ALV++T
Sbjct  410  FSVKGDEEKARDLVYQSDGLKKTLDLAQIHCKLATDALYKLPASD------ARSALVQIT  463

Query  237  QRVITR  220
            ++++TR
Sbjct  464  EKLLTR  469



>dbj|GAN11332.1| hexaprenyl pyrophosphate synthetase [Mucor ambiguus]
Length=469

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 128/186 (69%), Gaps = 13/186 (7%)
 Frame = -3

Query  756  GETMQMTTSSD-------QRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAF  598
            GE MQ+  + +       +  + ++YM+KTY KT SLI+ SCKA A+L G T EV+ +A+
Sbjct  288  GEFMQLRNTKEGESGKVKKLSTFDHYMEKTYMKTGSLIAQSCKASAVLGGSTKEVANIAY  347

Query  597  EYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQG  418
            ++GKNLGLAFQL+DD+LDFT T+A LGK + +D++ G+ TAP+LFA EEYP+L  ++ + 
Sbjct  348  DFGKNLGLAFQLVDDMLDFTVTAAELGKPAGADLKLGLATAPVLFAWEEYPELEPLIKRK  407

Query  417  FDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELT  238
            F    + + A + + +S G+++T +LA  H  LA+DA+  LP SD      +R ALV++T
Sbjct  408  FSVKGDEEKARDLVYQSDGLKKTLDLAQIHCKLATDALYKLPASD------ARSALVQIT  461

Query  237  QRVITR  220
            ++++TR
Sbjct  462  EKLLTR  467



>ref|WP_027841051.1| prenyltransferase [Mastigocoleus testarum]
Length=323

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 118/179 (66%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     +   S+E Y+ KTYYKTASLI+NS KA  LL+G + E +   + YG+NLG
Sbjct  149  GEIQQGLHRFNSSISLETYLNKTYYKTASLIANSSKAAGLLSGVSQETAEHLYAYGRNLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFT +S TLGK   SD++ G +TAP+LFA EE P L  +V++ F    ++
Sbjct  209  LAFQIVDDILDFTSSSDTLGKPVGSDLKSGNLTAPVLFAFEEQPYLEVLVEREFAQSEDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            D A+E +  S+GI+R RELA  HA++A + +  +P S+      SR+AL+ +   V++R
Sbjct  269  DRAIELIKNSQGIKRARELAAYHASVAVEHLQDIPPSE------SRQALINMADYVLSR  321



>ref|WP_015200298.1| solanesyl diphosphate synthase [Calothrix parietina]
 gb|AFZ03685.1| solanesyl diphosphate synthase [Calothrix sp. PCC 6303]
Length=323

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 119/179 (66%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y++K+Y+KTASLI+NS KA  +++  + E+    +EYG +LG
Sbjct  149  GEIQQGLNRFDTNISLETYLKKSYFKTASLIANSSKAAGVISETSPEIIEHLYEYGNHLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG++ TLGK + SD+R G +TAP+LFA+EE P L  ++++ F    ++
Sbjct  209  LAFQIVDDILDFTGSTDTLGKPAGSDLRSGNLTAPVLFALEEKPYLEALIEREFAQDDDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + AL  +  S+GIQR RELA  HA LA D +  LP S+      SR+ALV +   V++R
Sbjct  269  NQALTLIHDSQGIQRARELAAHHAKLAVDNLADLPPSE------SRQALVSMADYVLSR  321



>gb|AFW68984.1| hypothetical protein ZEAMMB73_641528 [Zea mays]
Length=302

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS++Q+ SMEYY+QKTYYKT+SLISNSCKA+A+LAG TAEVSV+A+EYG+NLG
Sbjct  209  GETMQISTSTEQQRSMEYYLQKTYYKTSSLISNSCKAVAILAGHTAEVSVLAYEYGRNLG  268

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVT  478
            LAFQLIDDVL+FTGTSA+LG GSLS IRH  +T
Sbjct  269  LAFQLIDDVLNFTGTSASLGNGSLSHIRHVRIT  301



>ref|XP_005845989.1| hypothetical protein CHLNCDRAFT_58364 [Chlorella variabilis]
 gb|EFN53887.1| hypothetical protein CHLNCDRAFT_58364 [Chlorella variabilis]
Length=634

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE +Q+T   ++  SM++YM+KTY KTASL++NSC+A+A+L G  A     A EYG+++G
Sbjct  271  GEILQLTADVEEAASMDHYMRKTYCKTASLMANSCRAVAVLGGHGAGDCGAAAEYGRHVG  330

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQL+DDV+D+T +++ +GK +L+D+R G+ TAP+L+A EE  +L  ++ + F +  +V
Sbjct  331  LAFQLVDDVMDYTCSASEMGKPALNDLRSGLATAPVLYAAEERLELLPLIQRRFKEEGDV  390

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + A E +  S G+QRTR+LA  HA  A+ A+  +  +  +     R+ L+++TQRV+ R 
Sbjct  391  EAAQELVEGSSGLQRTRQLAAFHAEEAALAVQGMSPAASQHAAEHRQGLLQITQRVLNRK  450

Query  216  K  214
            K
Sbjct  451  K  451



>emb|CDS13928.1| hypothetical protein LRAMOSA06101 [Absidia idahoensis var. thermophila]
Length=488

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 126/184 (68%), Gaps = 11/184 (6%)
 Frame = -3

Query  756  GETMQMTTSSDQ-----RCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEY  592
            GE MQ+  +  +     + + +YY++KTY KT SLI+ SCK+ A+L G T EV+ +AFE+
Sbjct  309  GEFMQLKNTRGENGVRTKSTFDYYIEKTYMKTGSLIAQSCKSSAVLGGCTKEVTDIAFEF  368

Query  591  GKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFD  412
            G+NLG+AFQL+DD+LDFT T+A LGK + +D++ G+ TAP+LFA EE+P+L  ++ + F 
Sbjct  369  GRNLGIAFQLVDDMLDFTVTAADLGKPAGADLKLGLATAPVLFACEEFPELEPLIKRKFA  428

Query  411  DPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQR  232
            +  +VD A   + +S G+++T  LA +H N A   I  LP SD      +R AL++LT++
Sbjct  429  EEGDVDKARLLVYQSDGLKKTLALAEEHCNTAISLISKLPPSD------ARSALIQLTEK  482

Query  231  VITR  220
            ++TR
Sbjct  483  LLTR  486



>ref|WP_017320646.1| prenyltransferase [cyanobacterium PCC 7702]
Length=323

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 119/179 (66%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GET Q         S+E Y++K+YYK+AS+I+NS KA  +L+  + EV+   + YG++LG
Sbjct  149  GETQQALNHFCTSISIEAYLKKSYYKSASIIANSSKATGVLSEVSPEVAEHLYNYGRHLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG+   LGK + SD+R G +TAP+LFA+EE P L  ++++ F+   ++
Sbjct  209  LAFQIVDDILDFTGSPDVLGKPAGSDLRSGNLTAPVLFALEEKPYLEVLIEREFEQEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + AL  +  SRGIQR RELA  HA LA + I  LP S+      SR+AL+ +   V++R
Sbjct  269  EQALALIHDSRGIQRARELAAHHAKLAVEHIGVLPPSE------SRQALINMADYVLSR  321



>ref|WP_006635785.1| prenyltransferase [Microcoleus vaginatus]
 gb|EGK83782.1| solanesyl diphosphate synthase [Microcoleus vaginatus FGP-2]
Length=323

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 122/179 (68%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y++K+YYKTASLI+NS KA   L+  +AE++   + YG+N+G
Sbjct  149  GEIQQGLNGFDTSLSIEAYLEKSYYKTASLIANSSKAAGCLSEVSAEIADDLYNYGRNIG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFT ++ TLGK + SD+R G +TAP LFA+EE P L  ++++ F    ++
Sbjct  209  LAFQIVDDILDFTASTETLGKPAGSDLRSGNLTAPALFALEEKPYLEVLIEREFAQEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + AL  +  SRGI+R+RELAT HA  A + + +LP S+      SR+AL++L + V++R
Sbjct  269  EQALALVEDSRGIERSRELATNHAQKAVEYLVALPHSE------SRQALIDLAEYVLSR  321



>ref|WP_015170979.1| solanesyl diphosphate synthase [Geitlerinema sp. PCC 7407]
 gb|AFY65412.1| solanesyl diphosphate synthase [Geitlerinema sp. PCC 7407]
Length=323

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 122/179 (68%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q  T  D   S+E Y+ K+YYKTASLI+NS KA  LL+  + E++   + YGK++G
Sbjct  149  GEIRQGLTQFDTGLSIEAYLDKSYYKTASLIANSAKAAGLLSEVSPEMADNLYRYGKHMG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG++ +LGK + SD++ G +TAP L+A+EE P L  ++++ F    ++
Sbjct  209  LAFQIVDDILDFTGSAESLGKPAGSDLKSGNLTAPALYALEEQPYLEAIIEREFTQEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + ALE +  S+G+ R+RELA  HA +A +A+  LP SD      SR+AL+ LT  V++R
Sbjct  269  EKALELVQTSQGLDRSRELAASHAKIAVEALADLPASD------SRQALLRLTDYVLSR  321



>ref|WP_035155048.1| prenyltransferase [Calothrix sp. 336/3]
 gb|KFB84649.1| prenyltransferase [Calothrix sp. 336/3]
Length=323

 Score =   157 bits (396),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 117/179 (65%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y+QK+YYKTASLI+NS KA  +++  + E +   + YG+NLG
Sbjct  149  GEIQQGLNRFDTSTSIETYLQKSYYKTASLIANSAKAAGVISDVSRETTENLYTYGRNLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFT ++ TLGK + SD++ G +TAP+LFA+EE P L  ++D+ F    + 
Sbjct  209  LAFQIVDDILDFTSSTDTLGKPAFSDLKSGHLTAPVLFALEEKPYLEILIDREFAQEGDF  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + A+  +  S+GIQR RELA  HA LA + I  LP      +  SR+AL+ +T  V++R
Sbjct  269  EQAMILIQDSQGIQRARELAAHHAKLAVEYIADLP------ISESRQALINMTDYVLSR  321



>ref|WP_015177997.1| solanesyl diphosphate synthase [Oscillatoria nigro-viridis]
 gb|AFZ08757.1| solanesyl diphosphate synthase [Oscillatoria nigro-viridis PCC 
7112]
Length=323

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 121/179 (68%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y++K+YYKTASLI+NS KA   L+  +AE++   + YG+N+G
Sbjct  149  GEIQQGLNGFDTSLSIEAYLEKSYYKTASLIANSSKAAGCLSEVSAEIADDLYNYGRNIG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFT ++ TLGK + SD+R G +TAP LFA+EE P L  ++++ F    ++
Sbjct  209  LAFQIVDDILDFTASTETLGKPAGSDLRSGNLTAPALFALEEKPYLEVLIEREFAQEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + AL  +  SRGI+R+RELAT HA  A + +  LP S+      SR+AL++L + V++R
Sbjct  269  EQALALVEDSRGIERSRELATNHAQKAVEYLAVLPHSE------SRQALIDLAEYVLSR  321



>gb|AFW68985.1| hypothetical protein ZEAMMB73_641528, partial [Zea mays]
Length=304

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQ++TS++Q+ SMEYY+QKTYYKT+SLISNSCKA+A+LAG TAEVSV+A+EYG+NLG
Sbjct  216  GETMQISTSTEQQRSMEYYLQKTYYKTSSLISNSCKAVAILAGHTAEVSVLAYEYGRNLG  275

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRH  490
            LAFQLIDDVL+FTGTSA+LG GSLS IRH
Sbjct  276  LAFQLIDDVLNFTGTSASLGNGSLSHIRH  304



>ref|WP_023066251.1| solanesyl diphosphate synthase [Lyngbya aestuarii]
 gb|ERT07588.1| solanesyl diphosphate synthase [Lyngbya aestuarii BL J]
Length=323

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 120/179 (67%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+  Y++K+YYKTASL++NS KA  LL+G +AE++   + YG+NLG
Sbjct  149  GEIQQGLNRFDTGMSINAYLEKSYYKTASLVANSSKAAGLLSGVSAELAEDLYSYGQNLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG++ TLGK + SD++ G +TAP L+ +EE P L  ++++ F    ++
Sbjct  209  LAFQIVDDILDFTGSTETLGKPAASDLKSGNLTAPTLYTLEETPYLETLIEREFAQEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + A+  + +S  I+R+RELA  HA LA + I   P+ D      SR+AL+EL+  V++R
Sbjct  269  EQAITLIKESSAIERSRELAAYHAKLAVEHISKFPDCD------SRKALIELSDYVLSR  321



>ref|WP_017288916.1| prenyltransferase [Leptolyngbya boryana]
Length=323

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 122/179 (68%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   ++E Y++K+YYKTASLI+NS KA A+L+  +   +   + YG+NLG
Sbjct  149  GEIQQGLFRFDMGITIESYLEKSYYKTASLIANSSKAAAILSDASEVEAQNLYHYGRNLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG++ +LGK + SD+R G +TAP+L+A+EE P L D++D+ F+   ++
Sbjct  209  LAFQIVDDILDFTGSTESLGKPAGSDLRSGNLTAPVLYALEEKPYLEDLIDREFEQEDDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + AL  +  S+GIQR RELA+ HA  A + +  LP S+      SR+AL++L   V++R
Sbjct  269  EQALALVRDSQGIQRARELASHHAKSAIEHLADLPMSE------SRQALIKLADYVLSR  321



>emb|CDH51283.1| hexaprenyl pyrophosphate synthetase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=496

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 126/184 (68%), Gaps = 11/184 (6%)
 Frame = -3

Query  756  GETMQMTTSSDQ-----RCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEY  592
            GE MQ+  +  +     + + +YY++KTY KT SLI+ SCK+ A+L G T EV+ +AFE+
Sbjct  317  GEFMQLKNTRGENGVRTKSTFDYYIEKTYMKTGSLIAQSCKSSAVLGGSTKEVADIAFEF  376

Query  591  GKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFD  412
            G+NLG+AFQL+DD+LDFT T+A LGK + +D++ G+ TAP+LFA EE+P+L  ++ + F 
Sbjct  377  GRNLGIAFQLVDDMLDFTVTAADLGKPAGADLKLGLATAPVLFACEEFPELEPLIKRKFA  436

Query  411  DPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQR  232
            +  +VD A   + +S G+++T  LA +H + A   I  LP SD      +R AL++LT++
Sbjct  437  EEGDVDKARLLVYQSDGLKKTLSLAEEHCSTAISLISQLPPSD------ARSALIQLTEK  490

Query  231  VITR  220
            ++TR
Sbjct  491  LLTR  494



>emb|CCA17241.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=452

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 117/183 (64%), Gaps = 10/183 (5%)
 Frame = -3

Query  756  GETMQMTTSSDQR--CSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKN  583
            GE MQM    ++     +EYY++K YYKTASL++NSCKA   L   T  V  M F YG++
Sbjct  278  GEVMQMRNVQNRSNISLLEYYLRKNYYKTASLMANSCKAALTLGQHTDYVCEMGFAYGRH  337

Query  582  LGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPR  403
            LGLAFQLIDDVLD+ G  +  GK  L+D+R G++TAP+L A EE+PQL+ + D+ F    
Sbjct  338  LGLAFQLIDDVLDYEGLES--GKPLLADLRCGVITAPLLLAQEEFPQLKALSDRKFSRDG  395

Query  402  NVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVIT  223
            ++D A E + +S GIQ+T++LA   ANLA DAI     S       +R ALV L Q ++ 
Sbjct  396  DIDQAYELVCQSSGIQKTKDLAIDQANLACDAILQFAASP------ARDALVRLAQCIVI  449

Query  222  RTK  214
            R+K
Sbjct  450  RSK  452



>gb|KFH72490.1| hypothetical protein MVEG_02780 [Mortierella verticillata NRRL 
6337]
Length=488

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 123/187 (66%), Gaps = 12/187 (6%)
 Frame = -3

Query  756  GETMQMTTS------SDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFE  595
            GE MQ+         S    + EYYM+K+Y KTASLIS SC++ A+L G T EV  +A+ 
Sbjct  308  GEFMQLRNGQIENGRSRNMTTFEYYMEKSYMKTASLISKSCRSSAVLGGATNEVCDIAYT  367

Query  594  YGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGF  415
            YGKN+GLAFQL+DD+LDFT +S   GK + +D++ G+ TAP+LFA EE+P+L  ++ + F
Sbjct  368  YGKNIGLAFQLVDDMLDFTVSSEEFGKPAGADLKLGLATAPVLFAWEEFPELGKLIKRNF  427

Query  414  DDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQ  235
            +   +V+ A   + KS+G+++TR LA  H   A  A+  LP+S      +++ AL++LT+
Sbjct  428  NQEGDVETAWNLVLKSQGLEQTRRLAQIHCQRAIAAVSQLPDS------QAKTALIQLTE  481

Query  234  RVITRTK  214
            +V+ R K
Sbjct  482  KVLDRKK  488



>ref|WP_023173513.1| solanesyl diphosphate synthase [Gloeobacter kilaueensis]
 gb|AGY58373.1| solanesyl diphosphate synthase [Gloeobacter kilaueensis JS1]
Length=325

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 122/179 (68%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE +Q T   D   + E Y+ K++YKTASL++ + +A A+L+G  A V    +EYG++LG
Sbjct  151  GELLQSTIQFDPELTFEQYLDKSFYKTASLMAGTSRAAAVLSGSPAVVCDALYEYGRHLG  210

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQ+IDD+LDFTG++A LGK + SD++ G +TAP+L+A+EE P L  ++++ FD+P ++
Sbjct  211  IAFQVIDDLLDFTGSTAQLGKPAGSDLQDGNLTAPVLYALEEAPHLGVLIERQFDEPGDL  270

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + A+  +  SRGI+RTRELA +HA  A   +D+LP S       +R AL +L   ++ R
Sbjct  271  EKAMSMVFASRGIERTRELAQQHAREALTNLDALPASP------AREALADLVDYILGR  323



>ref|XP_002594697.1| hypothetical protein BRAFLDRAFT_240454 [Branchiostoma floridae]
 gb|EEN50708.1| hypothetical protein BRAFLDRAFT_240454 [Branchiostoma floridae]
Length=328

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 122/181 (67%), Gaps = 6/181 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+ T  D+     +Y++KT+ KTASL+++SC+A+A+L+G + +V  +A++YGKNLG
Sbjct  154  GEFMQLGTKEDEDERFAHYLKKTFKKTASLLAHSCRAVAVLSGSSKDVQEVAYQYGKNLG  213

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQL+DD+LDF  T   +GK + +D++ G+ TAP+LFA E+YP+L  ++ + F +P +V
Sbjct  214  IAFQLVDDMLDFMSTEELMGKPTAADLKLGLATAPVLFAAEKYPELNAMIMRRFSEPGDV  273

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LA E + K+  +Q+ R LA ++   A   I  L  S +      R ALV LTQ+V+ R 
Sbjct  274  ELAREAVTKTDSLQQARILAEQYCREAVRQIQQLAPSPE------REALVTLTQKVLNRK  327

Query  216  K  214
            K
Sbjct  328  K  328



>ref|XP_002594699.1| hypothetical protein BRAFLDRAFT_240460 [Branchiostoma floridae]
 gb|EEN50710.1| hypothetical protein BRAFLDRAFT_240460 [Branchiostoma floridae]
Length=328

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 122/181 (67%), Gaps = 6/181 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+ T  D+     +Y++KT+ KTASL+++SC+A+A+L+G + +V  +A++YGKNLG
Sbjct  154  GEFMQLGTKEDEDERFAHYLKKTFKKTASLLAHSCRAVAVLSGSSKDVQEVAYQYGKNLG  213

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQL+DD+LDF  T   +GK + +D++ G+ TAP+LFA E+YP+L  ++ + F +P +V
Sbjct  214  IAFQLVDDMLDFMSTEELMGKPTAADLKLGLATAPVLFAAEKYPELNAMIMRRFSEPGDV  273

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            +LA E + K+  +Q+ R LA ++   A   I  L  S +      R ALV LTQ+V+ R 
Sbjct  274  ELAREAVTKTDSLQQARILAEQYCREAVRQIQQLAPSPE------REALVTLTQKVLNRK  327

Query  216  K  214
            K
Sbjct  328  K  328



>ref|XP_003292910.1| hypothetical protein DICPUDRAFT_157686 [Dictyostelium purpureum]
 gb|EGC30569.1| hypothetical protein DICPUDRAFT_157686 [Dictyostelium purpureum]
Length=465

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 122/181 (67%), Gaps = 8/181 (4%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ  +S     S ++Y++KTY KT SLI+NSC++ A+L+G    +  ++ E+GKNLG
Sbjct  293  GEFMQAKSSG--VSSFDHYLKKTYLKTGSLITNSCRSAAILSGADQNIVNISTEFGKNLG  350

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ+IDD+LD+TG++   GK    D+  G+ TAP+LFA +E+PQL D++ + F    +V
Sbjct  351  LAFQIIDDLLDYTGSAEQCGKAVSVDLNLGLATAPVLFATQEFPQLEDLIKRKFSKEGDV  410

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + A   + +S+GI++TR LA ++ NLA +++  LP+SD      SR  L+ L+  V+TRT
Sbjct  411  EEAKRLVAQSQGIEKTRNLAIEYVNLAIESLLKLPQSD------SRDLLIALSHTVVTRT  464

Query  216  K  214
            K
Sbjct  465  K  465



>emb|CCI43550.1| unnamed protein product [Albugo candida]
Length=393

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 115/183 (63%), Gaps = 10/183 (5%)
 Frame = -3

Query  756  GETMQMTTSSDQR--CSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKN  583
            GE MQM     +     +EYY++K YYKTASL++NSCKA   L   T  V  M F YG++
Sbjct  219  GEVMQMRNVEGRSNISLLEYYLRKNYYKTASLMANSCKAALTLGKHTEYVCEMGFAYGRH  278

Query  582  LGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPR  403
            LGLAFQLIDDVLD+ G  +  GK  L+D++ G++TAP+L A E++P+L+ + D+ F    
Sbjct  279  LGLAFQLIDDVLDYEGLES--GKPLLADLKCGVITAPLLLAQEQFPELKVLSDRKFSRDG  336

Query  402  NVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVIT  223
            ++D A   + KS GIQ+T+ELA   ANLA DAI     S       +R ALV L Q ++ 
Sbjct  337  DIDQAFHLVSKSSGIQKTKELAIDQANLACDAILQFSASP------ARDALVRLAQCIVN  390

Query  222  RTK  214
            R+K
Sbjct  391  RSK  393



>ref|WP_017717726.1| prenyltransferase [Oscillatoria sp. PCC 10802]
Length=323

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 121/179 (68%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y++K+YYKTASL++NS KA  +L+  + ++++  + YG+N+G
Sbjct  149  GEIQQGLNRFDSTLSIEAYLEKSYYKTASLLANSAKAAGILSEVSDDLALDLYGYGRNIG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG++ TLGK + SD++ G +TAP+LFA+EE P L  ++++ F +  + 
Sbjct  209  LAFQVVDDILDFTGSTETLGKPAGSDLKSGNLTAPVLFALEEKPYLEALIEREFSEEGDF  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            D A+  + +S+GI+R+RELA  HA LA   I  LP  +      SR+AL+ L   V++R
Sbjct  269  DQAIAAVKESKGIERSRELAAHHAGLAVQHISKLPACE------SRQALINLADYVLSR  321



>ref|WP_006278494.1| prenyltransferase [Cylindrospermopsis raciborskii]
 gb|EFA68655.1| Polyprenyl synthetase [Cylindrospermopsis raciborskii CS-505]
Length=323

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 119/179 (66%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y++K+YYKTASLI+NS KA  +L+  ++E +   + YGK+LG
Sbjct  149  GEIQQGLNRFDTNLSIETYLKKSYYKTASLIANSAKAAGILSNVSSESANNLYNYGKDLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG+  TLGK + SD++ G +TAP+LFA+EE P L  ++++ F    ++
Sbjct  209  LAFQIVDDILDFTGSMDTLGKPAASDLKSGNLTAPVLFALEEQPSLEVLIEREFAQEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + A++ +  S+GI R RELA  HANLA   I  L  S+      S++AL+ +T  V++R
Sbjct  269  EQAVKLISDSQGIPRARELANHHANLAKQHIADLGPSE------SKQALINMTDYVLSR  321



>ref|WP_036002195.1| prenyltransferase [Leptolyngbya sp. JSC-1]
Length=323

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 118/179 (66%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y++K+YYKTASLI+NS KA  LL+G +AE +   + YG+++G
Sbjct  149  GEIQQGLNRFDASLSIEAYLEKSYYKTASLIANSSKAAGLLSGVSAEQAQHLYSYGRHIG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG+S  LGK + SD++ G +TAP L+A+EE P L  ++++ F    ++
Sbjct  209  LAFQIVDDILDFTGSSEALGKPAGSDLKSGNLTAPALYALEEKPYLEKLIEREFAHEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + AL  +  SRGI+R+RELA  HA  A   +  L  S+      SR+AL+EL   V++R
Sbjct  269  EQALALIEDSRGIERSRELAAHHAQQAVQHLSDLSPSE------SRQALIELADYVLSR  321



>gb|ACJ76979.1| geranyl diphosphate synthase [Linum usitatissimum]
Length=209

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GETMQMTT+S+QRCSMEYYMQKTYYKTASLISNSCKA+ALLAGQT EV+ +AFEYG+NLG
Sbjct  133  GETMQMTTTSEQRCSMEYYMQKTYYKTASLISNSCKAVALLAGQTTEVATLAFEYGRNLG  192

Query  576  LAFQLIDDVLDFTGTSA  526
            LAFQLIDDVLDFTGTSA
Sbjct  193  LAFQLIDDVLDFTGTSA  209



>ref|WP_015117724.1| solanesyl diphosphate synthase [Rivularia sp. PCC 7116]
 gb|AFY54148.1| solanesyl diphosphate synthase [Rivularia sp. PCC 7116]
Length=323

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 118/179 (66%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE +Q   S D   SM+ Y+QKTYYKTA+L +NS KA  +L+  + + +   +EYG+NLG
Sbjct  149  GEILQAVNSFDVDISMDTYLQKTYYKTATLFANSSKAAGILSEVSQQTAENLYEYGRNLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+ DFT ++ TLGK + SD+  G +TAP+++A+EE P+L+ ++   F  P ++
Sbjct  209  LAFQIVDDIFDFTSSTDTLGKPAGSDLEDGHITAPVIYALEERPELKTLIKHKFTQPGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + AL  +  S+GIQR+R+LA   A LA + I  LP S       +R+ L+++   V++R
Sbjct  269  EKALTLVEDSKGIQRSRDLAASKAKLAVEHIGQLPSSP------TRQTLIDMADYVLSR  321



>ref|XP_002738102.1| PREDICTED: decaprenyl-diphosphate synthase subunit 1-like [Saccoglossus 
kowalevskii]
Length=403

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 121/181 (67%), Gaps = 6/181 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+ +  D+     +Y+QKTY KTASLI+NSCKA+++L+G    +  + ++YG+N+G
Sbjct  229  GEFMQLGSKEDENERFAHYLQKTYKKTASLIANSCKAVSILSGCNPAIVEITYQYGRNMG  288

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQL+DD+LD+  +   +GK + +D++ G+ T+P+LFA ++YP+L  ++ + F +P +V
Sbjct  289  IAFQLVDDMLDYISSDTVMGKPTSTDLKLGLATSPVLFACQQYPELNALIMRRFSEPGDV  348

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + A   + ++ GIQ+TR LA ++ N A   I  L ES       +R+ALV LT +++ R 
Sbjct  349  EKARRLVAETDGIQQTRYLAQQYCNEAIKQISGLAESP------ARKALVTLTHKILNRI  402

Query  216  K  214
            K
Sbjct  403  K  403



>ref|WP_037218231.1| prenyltransferase [Richelia intracellularis]
 emb|CDN11800.1| Solanesyl diphosphate synthase [Richelia intracellularis]
Length=323

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 119/179 (66%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S++ Y QK+YYKTASLI+NS KA  +L+  + EV+   + YG++LG
Sbjct  149  GEIQQGLNRFDTNTSLDIYSQKSYYKTASLIANSSKAAGVLSDVSVEVAENLYNYGRHLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFT +S TLGK + SD++ G +TAP+LFA+EE P L  ++++ F    ++
Sbjct  209  LAFQIVDDILDFTSSSDTLGKPAGSDLKSGNLTAPVLFALEEQPYLEVLIEREFAQEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            D A+  +  S+GIQR+RELAT HA +A + I+++  S       SR+ L+ L   V++R
Sbjct  269  DQAMSLIKNSQGIQRSRELATDHAKIAVENIEAIAPSP------SRQTLINLANYVLSR  321



>ref|WP_006511604.1| solanesyl diphosphate synthase [Xenococcus sp. PCC 7305]
 gb|ELS01223.1| solanesyl diphosphate synthase [Xenococcus sp. PCC 7305]
Length=323

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 121/179 (68%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE +Q     D   S++ Y++K+YYKTASLI+NS KA A+L+    + +V  +EYG+NLG
Sbjct  149  GEILQGLNRFDTSISLDAYLEKSYYKTASLIANSAKAAAILSEVNEDKAVALYEYGRNLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG++  LGK + SD+  G +TAP+++AMEE P L  ++++ F +  ++
Sbjct  209  LAFQIVDDILDFTGSTQVLGKPAGSDLVSGNLTAPVIYAMEEKPYLEVIIEREFSEENDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + AL  +  S+GI +T++LA KHA+ A + +D L  SD      S  AL ELT  V++R
Sbjct  269  EQALAMIQDSQGISKTKKLAKKHAHQAKEYLDCLAPSD------SALALGELTDYVLSR  321



>emb|CCI43551.1| unnamed protein product [Albugo candida]
Length=448

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 115/183 (63%), Gaps = 10/183 (5%)
 Frame = -3

Query  756  GETMQMTTSSDQR--CSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKN  583
            GE MQM     +     +EYY++K YYKTASL++NSCKA   L   T  V  M F YG++
Sbjct  274  GEVMQMRNVEGRSNISLLEYYLRKNYYKTASLMANSCKAALTLGKHTEYVCEMGFAYGRH  333

Query  582  LGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPR  403
            LGLAFQLIDDVLD+ G  +  GK  L+D++ G++TAP+L A E++P+L+ + D+ F    
Sbjct  334  LGLAFQLIDDVLDYEGLES--GKPLLADLKCGVITAPLLLAQEQFPELKVLSDRKFSRDG  391

Query  402  NVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVIT  223
            ++D A   + KS GIQ+T+ELA   ANLA DAI     S       +R ALV L Q ++ 
Sbjct  392  DIDQAFHLVSKSSGIQKTKELAIDQANLACDAILQFSASP------ARDALVRLAQCIVN  445

Query  222  RTK  214
            R+K
Sbjct  446  RSK  448



>emb|CCX16500.1| Similar to Probable hexaprenyl pyrophosphate synthase, mitochondrial; 
acc. no. Q7S565 [Pyronema omphalodes CBS 100304]
Length=452

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 123/188 (65%), Gaps = 13/188 (7%)
 Frame = -3

Query  756  GETMQMT-TSSDQ------RCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAF  598
            GE  Q+T T +D       + S++YY++KTY KTASLIS SC+A A+L G T  V+  A+
Sbjct  271  GELYQLTNTRTDYGSEGYLKKSLDYYLEKTYLKTASLISKSCRAAAVLGGATEPVANAAY  330

Query  597  EYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQG  418
             YGK++GLAFQLIDDVLD+TG+S  LGK + +D+  G+ TAP+ +A EE+P+L  ++ + 
Sbjct  331  VYGKHMGLAFQLIDDVLDYTGSSEELGKPATADLELGLATAPVFYAWEEFPELGPMIARK  390

Query  417  FDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELT  238
            F+ P +   A E + KS+GI+RTRELA    + A +AI   P+++      +R  L E+ 
Sbjct  391  FEQPGDAARARELVYKSKGIERTRELAQSFCDTAKEAIQIFPDTE------ARAGLEEVL  444

Query  237  QRVITRTK  214
              V++R K
Sbjct  445  NMVLSRKK  452



>gb|KFX49430.1| putative hexaprenyl pyrophosphate synthase, mitochondrial, partial 
[Talaromyces marneffei PM1]
Length=293

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 124/188 (66%), Gaps = 13/188 (7%)
 Frame = -3

Query  756  GETMQM-TTSSDQRC------SMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAF  598
            GE MQ+  T+SD+R       ++ YY+QKTY KTASLIS SC+A ALL   T E+   A+
Sbjct  112  GEFMQLKNTASDERSPVFTDDTIAYYLQKTYLKTASLISKSCRATALLGNSTPEIVEAAY  171

Query  597  EYGKNLGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQG  418
             YG+NLGLAFQL+DD+LD+T  S   GK + +D+  G+ TAP+LFA +  P+L  +V + 
Sbjct  172  SYGRNLGLAFQLVDDMLDYTVNSVEFGKPAGADLELGLATAPLLFAWKSNPELGALVGRK  231

Query  417  FDDPRNVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELT  238
            F+   +V+ A E + +S GI++TR LA ++A+ A+ A+D LP+SD      ++  L+++ 
Sbjct  232  FEQEGDVERARELVARSDGIEQTRALAQEYADKAAAALDILPDSD------AKNGLLDMC  285

Query  237  QRVITRTK  214
            ++ + R K
Sbjct  286  EKTMKRRK  293



>emb|CCI43552.1| unnamed protein product [Albugo candida]
Length=451

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 115/183 (63%), Gaps = 10/183 (5%)
 Frame = -3

Query  756  GETMQMTTSSDQR--CSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKN  583
            GE MQM     +     +EYY++K YYKTASL++NSCKA   L   T  V  M F YG++
Sbjct  277  GEVMQMRNVEGRSNISLLEYYLRKNYYKTASLMANSCKAALTLGKHTEYVCEMGFAYGRH  336

Query  582  LGLAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPR  403
            LGLAFQLIDDVLD+ G  +  GK  L+D++ G++TAP+L A E++P+L+ + D+ F    
Sbjct  337  LGLAFQLIDDVLDYEGLES--GKPLLADLKCGVITAPLLLAQEQFPELKVLSDRKFSRDG  394

Query  402  NVDLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVIT  223
            ++D A   + KS GIQ+T+ELA   ANLA DAI     S       +R ALV L Q ++ 
Sbjct  395  DIDQAFHLVSKSSGIQKTKELAIDQANLACDAILQFSASP------ARDALVRLAQCIVN  448

Query  222  RTK  214
            R+K
Sbjct  449  RSK  451



>dbj|GAM22902.1| hypothetical protein SAMD00019534_060770, partial [Acytostelium 
subglobosum LB1]
Length=415

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 123/181 (68%), Gaps = 9/181 (5%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+ ++ +   S + YM+KTY KTASLI+NSC++ A+LAG    +  +A ++GK+LG
Sbjct  244  GEFMQIKSAGN---SFDAYMKKTYLKTASLITNSCRSTAVLAGADRAMIDLATDFGKHLG  300

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFT +S  LGK +  D+  G+ TAP+LFA +E+P+L  ++++ F +  +V
Sbjct  301  LAFQIVDDLLDFTSSSEELGKPASVDLSLGLATAPVLFAAQEFPELETLIERKFSESGDV  360

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + A + + KS+GI+RTR LA +H N A   +  LP+S+  D+      L+ LT  V+TR 
Sbjct  361  ERARDMVFKSKGIERTRNLAIEHCNKAIQCLMQLPQSEPRDL------LINLTHTVVTRN  414

Query  216  K  214
            +
Sbjct  415  R  415



>gb|EFA78653.1| hypothetical protein PPL_08108 [Polysphondylium pallidum PN500]
Length=417

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 123/179 (69%), Gaps = 9/179 (5%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+ ++S    S E Y++KTY KTASL +N C++IA+L+G  A ++ MA E+GKNLG
Sbjct  218  GELMQIKSNS---TSFESYIRKTYLKTASLFANGCRSIAVLSGADANMTNMATEFGKNLG  274

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ+IDD+LD TG+S +LGK +  D+  G+ TAP+LFA+EEYP L  ++++ F +  +V
Sbjct  275  LAFQIIDDLLDVTGSSESLGKPASVDMSLGLATAPVLFALEEYPDLEVLINRKFSESGDV  334

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            D+A + + KS  I++T+ LA ++ N + + +  LP+S      +SR  L+ LTQ  + R
Sbjct  335  DIANQLVLKSNAIEKTKSLAIEYCNKSIEFLMKLPQS------QSRDLLITLTQSKVIR  387



>ref|WP_022604134.1| solanesyl diphosphate synthase [Rubidibacter lacunae]
 gb|ERN43041.1| solanesyl diphosphate synthase [Rubidibacter lacunae KORDI 51-2]
Length=323

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 120/179 (67%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q  +  D   ++E Y++K+YYKTASLI+NS KA  +L+  +A+V+   + YG+N G
Sbjct  149  GEIRQGLSQFDTTLTVERYLEKSYYKTASLIANSVKAAGVLSSVSAKVAEELYCYGRNFG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFT T+  LGK   SD+  G +TAP+LFA+EE PQL  V+++ F +  ++
Sbjct  209  LAFQIVDDILDFTATAEVLGKPVGSDLASGHLTAPVLFALEENPQLNAVIERRFSESGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + AL ++ +S+G++R R LA++ A  A   +D+LP S       SR+ALVEL   V+ R
Sbjct  269  ERALAWVERSKGVERARALASQFARTAVLHLDALPPS------ASRQALVELADYVLER  321



>ref|WP_015223417.1| solanesyl diphosphate synthase [Cyanobacterium stanieri]
 gb|AFZ48102.1| solanesyl diphosphate synthase [Cyanobacterium stanieri PCC 7202]
Length=323

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 121/181 (67%), Gaps = 6/181 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q  +  D   S+E Y+QK+Y+KTASLI+NS KA A+L+  +AE +   + YGKNLG
Sbjct  149  GEIQQGLSCFDTDVSLEKYLQKSYFKTASLIANSAKAAAVLSDSSAETAEKIYSYGKNLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFT  +  LGK + SD+  G +TAP++FAMEE P L+  +++ F +  ++
Sbjct  209  LAFQIVDDILDFTSPTEVLGKPAGSDLASGNLTAPVIFAMEENPSLKMFIEREFSEEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + AL+ +  S+GI+++R +A+ H+ LA   +D L  S       S +AL+ELT  +++R 
Sbjct  269  EQALKLVYDSQGIEKSRAMASHHSKLALQELDCLSPSP------STQALIELTDYLLSRI  322

Query  216  K  214
            K
Sbjct  323  K  323



>ref|WP_009631776.1| solanesyl diphosphate synthase [Synechocystis sp. PCC 7509]
Length=323

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 121/179 (68%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q  +  D   ++E Y++K+YYKTASLI+NS KA  LL+  + E +   + YG++ G
Sbjct  149  GEIQQGMSQFDCGVTIEAYLEKSYYKTASLIANSSKAAGLLSDVSRETAEHLYGYGRHWG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFTG+++TLGK +L+DI  G +TAP L+A+EE P L +++++ F  P ++
Sbjct  209  LAFQIVDDILDFTGSTSTLGKPALADISSGNLTAPTLYALEEKPYLEELIERQFSKPGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + A+  +  S GI+R R LA  HA+LA + +  LP S      +S++AL+++   V++R
Sbjct  269  ENAIALISDSNGIERARTLAAHHAHLAVEHLTDLPAS------QSKQALIDMADYVLSR  321



>ref|WP_006194857.1| prenyltransferase [Nodularia spumigena]
 gb|EAW46645.1| Polyprenyl synthetase [Nodularia spumigena CCY9414]
 gb|AHJ30296.1| Solanesyl diphosphate synthase [Nodularia spumigena CCY9414]
Length=323

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 119/179 (66%), Gaps = 6/179 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE  Q     D   S+E Y++K+YYKTASLI+NS KA ALL+  + E +   ++YG++LG
Sbjct  149  GEIQQGINCFDNGISIETYLKKSYYKTASLIANSSKAAALLSDASPETAENLYDYGRHLG  208

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQ++DD+LDFT T+ TLGK + SD++ G +TAP+LFA+ E P L  ++++ F+   ++
Sbjct  209  LAFQIVDDILDFTSTTDTLGKPAGSDLKSGNLTAPVLFALGEKPDLEALIERKFEQEGDL  268

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITR  220
            + ALE +  S+GIQ+ RELA  HA LA D +  +  S+      SR AL+ +   V++R
Sbjct  269  EQALELIQDSQGIQQARELAAYHAKLAVDHLQVIAPSE------SREALINIADYVLSR  321



>ref|XP_002426574.1| Decaprenyl-diphosphate synthase subunit, putative [Pediculus 
humanus corporis]
 gb|EEB13836.1| Decaprenyl-diphosphate synthase subunit, putative [Pediculus 
humanus corporis]
Length=262

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+ +   +     +Y+ KTY KTASLI+NS KA+A+LAG    +S +AF+YG+N+G
Sbjct  88   GEFMQLGSKETENERFAHYLTKTYRKTASLIANSAKAVAMLAGADESLSEVAFQYGRNIG  147

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQL+DD+LDF  ++  +GK + +D++ G+ TAP+LFA E+YP+L  ++ + F +P +V
Sbjct  148  LAFQLVDDLLDFVSSADAMGKPTAADLKLGLATAPVLFACEKYPELNAMIMRRFQEPGDV  207

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            D A E + KS+G+++TR LA KH   A    +++ ES        ++ L+ ++  V+ R 
Sbjct  208  DKAFELVHKSQGLEQTRFLAKKHCMEAVRLANTIVESP------YQKGLIVVSDFVLNRM  261

Query  216  K  214
            K
Sbjct  262  K  262



>ref|NP_001072229.1| prenyl (decaprenyl) diphosphate synthase, subunit 1 [Xenopus 
(Silurana) tropicalis]
 gb|AAI18814.1| trans-prenyltransferase [Xenopus (Silurana) tropicalis]
Length=292

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 121/181 (67%), Gaps = 6/181 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE +Q+ +  ++     +Y++KT+ KTASLI+NSCKA+++LA     V  +A++YGKN+G
Sbjct  118  GEFLQLGSKENENERFSHYIEKTFKKTASLIANSCKAVSVLACPDPAVHEIAYQYGKNIG  177

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            +AFQLIDDVLDFT  +  LGK + +D++ G+ T P+LFA +++P+L D++ + F  P +V
Sbjct  178  IAFQLIDDVLDFTSCADQLGKPAAADLKLGLATGPVLFACQQFPELNDLIMRRFSLPGDV  237

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + A +Y+ +S G+++T  LA  + N A   I  L  S +      R AL++LT+ V+TR 
Sbjct  238  ERAWQYVLQSDGVRQTTYLAQSYCNQAVQEIRKLQPSPE------REALIQLTEIVLTRD  291

Query  216  K  214
            K
Sbjct  292  K  292



>ref|XP_008558928.1| PREDICTED: decaprenyl-diphosphate synthase subunit 1 [Microplitis 
demolitor]
Length=412

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 119/181 (66%), Gaps = 6/181 (3%)
 Frame = -3

Query  756  GETMQMTTSSDQRCSMEYYMQKTYYKTASLISNSCKAIALLAGQTAEVSVMAFEYGKNLG  577
            GE MQ+ +   +     +Y+ KTY KTASLI+NS KA+A+L G   ++S +AF+YG+N+G
Sbjct  238  GEFMQLGSKETENERFAHYLTKTYRKTASLIANSAKAVAMLGGADEKLSDVAFQYGRNIG  297

Query  576  LAFQLIDDVLDFTGTSATLGKGSLSDIRHGIVTAPILFAMEEYPQLRDVVDQGFDDPRNV  397
            LAFQL+DD+LDF  ++AT+GK + +D++ G+ TAP+LFA E YP+L  ++ + F +P +V
Sbjct  298  LAFQLVDDLLDFVSSTATMGKPTAADLKLGLATAPVLFACERYPELNPMIMRRFQEPGDV  357

Query  396  DLALEYLGKSRGIQRTRELATKHANLASDAIDSLPESDDEDVQRSRRALVELTQRVITRT  217
            + A E + KS+G+ +TR LA KH   A    +SL ES  ++       LV +   VI R 
Sbjct  358  EKAFELVHKSQGLDQTRFLAKKHCEEAKRLAESLAESPYQN------CLVRVGDFVIDRM  411

Query  216  K  214
            K
Sbjct  412  K  412



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260