BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022F15

Length=459
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010911507.1|  PREDICTED: protein transport protein Sec61 s...    179   1e-54   Elaeis guineensis
gb|ACR37176.1|  unknown                                                 178   2e-54   Zea mays [maize]
ref|NP_001136901.1|  uncharacterized protein LOC100217058               178   8e-54   
gb|ABQ53546.1|  SecY protein                                            179   1e-53   Arachis diogoi
gb|KJB57358.1|  hypothetical protein B456_009G160200                    183   1e-53   Gossypium raimondii
emb|CDO96861.1|  unnamed protein product                                185   2e-53   Coffea canephora [robusta coffee]
emb|CBI25843.3|  unnamed protein product                                179   2e-53   Vitis vinifera
gb|KJB57357.1|  hypothetical protein B456_009G160200                    183   3e-53   Gossypium raimondii
tpg|DAA51542.1|  TPA: hypothetical protein ZEAMMB73_526095              178   4e-53   
gb|KJB68353.1|  hypothetical protein B456_010G241000                    182   6e-53   Gossypium raimondii
ref|XP_011101434.1|  PREDICTED: protein transport protein Sec61 s...    184   2e-52   Sesamum indicum [beniseed]
gb|KJB68354.1|  hypothetical protein B456_010G241000                    182   2e-52   Gossypium raimondii
ref|XP_008807199.1|  PREDICTED: protein transport protein Sec61 s...    182   3e-52   Phoenix dactylifera
ref|XP_004491760.1|  PREDICTED: protein transport protein Sec61 s...    178   4e-52   
ref|XP_010549423.1|  PREDICTED: protein transport protein Sec61 s...    183   4e-52   Tarenaya hassleriana [spider flower]
gb|KJB57355.1|  hypothetical protein B456_009G160200                    183   4e-52   Gossypium raimondii
dbj|BAD28480.1|  putative Sec61                                         179   5e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009624231.1|  PREDICTED: protein transport protein Sec61 s...    183   5e-52   Nicotiana tomentosiformis
gb|EYU26314.1|  hypothetical protein MIMGU_mgv1a005665mg                183   5e-52   Erythranthe guttata [common monkey flower]
ref|XP_011098204.1|  PREDICTED: protein transport protein Sec61 s...    183   5e-52   Sesamum indicum [beniseed]
gb|EPS73277.1|  sec61 transport protein                                 182   6e-52   Genlisea aurea
gb|EPS70408.1|  sec61 transport protein                                 183   6e-52   Genlisea aurea
gb|EYU29535.1|  hypothetical protein MIMGU_mgv1a005663mg                182   6e-52   Erythranthe guttata [common monkey flower]
ref|XP_004233033.1|  PREDICTED: protein transport protein Sec61 s...    182   6e-52   Solanum lycopersicum
ref|NP_001062944.1|  Os09g0347500                                       179   6e-52   
ref|XP_006358101.1|  PREDICTED: protein transport protein Sec61 s...    182   6e-52   Solanum tuberosum [potatoes]
gb|KHG20425.1|  Protein transport Sec61 subunit alpha                   182   8e-52   Gossypium arboreum [tree cotton]
tpg|DAA44056.1|  TPA: hypothetical protein ZEAMMB73_205158              180   8e-52   
gb|EAZ44377.1|  hypothetical protein OsJ_29002                          180   9e-52   Oryza sativa Japonica Group [Japonica rice]
gb|AFW89231.1|  hypothetical protein ZEAMMB73_841109                    180   9e-52   
ref|XP_007025305.1|  SecY protein transport family protein              182   9e-52   Theobroma cacao [chocolate]
ref|NP_177993.1|  SecY protein transport family protein                 182   9e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300978.1|  hypothetical protein CARUB_v10021368mg             182   9e-52   Capsella rubella
gb|KDP21138.1|  hypothetical protein JCGZ_21609                         182   1e-51   Jatropha curcas
ref|NP_001143980.1|  uncharacterized protein LOC100276798               179   1e-51   Zea mays [maize]
emb|CDY37667.1|  BnaA04g20010D                                          179   1e-51   Brassica napus [oilseed rape]
gb|KDO51496.1|  hypothetical protein CISIN_1g011822mg                   179   1e-51   Citrus sinensis [apfelsine]
ref|XP_010930036.1|  PREDICTED: protein transport protein Sec61 s...    181   2e-51   
ref|XP_008811629.1|  PREDICTED: protein transport protein Sec61 s...    181   2e-51   Phoenix dactylifera
gb|KDO51495.1|  hypothetical protein CISIN_1g011822mg                   179   2e-51   Citrus sinensis [apfelsine]
ref|XP_010540524.1|  PREDICTED: protein transport protein Sec61 s...    181   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_008368805.1|  PREDICTED: protein transport protein Sec61 s...    181   2e-51   
emb|CBI20172.3|  unnamed protein product                                179   2e-51   Vitis vinifera
ref|XP_004294073.1|  PREDICTED: protein transport protein Sec61 s...    181   2e-51   Fragaria vesca subsp. vesca
ref|XP_008244574.1|  PREDICTED: protein transport protein Sec61 s...    181   2e-51   Prunus mume [ume]
ref|XP_009342904.1|  PREDICTED: protein transport protein Sec61 s...    181   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_007199826.1|  hypothetical protein PRUPE_ppa005115mg             181   3e-51   Prunus persica
ref|XP_008386268.1|  PREDICTED: protein transport protein Sec61 s...    181   3e-51   
ref|XP_008809619.1|  PREDICTED: protein transport protein Sec61 s...    181   3e-51   Phoenix dactylifera
ref|XP_009379941.1|  PREDICTED: protein transport protein Sec61 s...    181   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002522260.1|  preprotein translocase secy subunit, putative      181   3e-51   Ricinus communis
ref|XP_010906216.1|  PREDICTED: protein transport protein Sec61 s...    181   3e-51   Elaeis guineensis
ref|XP_009408993.1|  PREDICTED: protein transport protein Sec61 s...    181   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403643.1|  PREDICTED: protein transport protein Sec61 s...    181   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007149566.1|  hypothetical protein PHAVU_005G081100g             181   3e-51   Phaseolus vulgaris [French bean]
ref|XP_010248479.1|  PREDICTED: protein transport protein Sec61 s...    180   4e-51   Nelumbo nucifera [Indian lotus]
gb|ABR16326.1|  unknown                                                 181   4e-51   Picea sitchensis
ref|XP_006467607.1|  PREDICTED: protein transport protein Sec61 s...    181   4e-51   Citrus sinensis [apfelsine]
ref|XP_010242143.1|  PREDICTED: protein transport protein Sec61 s...    181   4e-51   Nelumbo nucifera [Indian lotus]
gb|KCW67528.1|  hypothetical protein EUGRSUZ_F01251                     180   4e-51   Eucalyptus grandis [rose gum]
ref|XP_010060713.1|  PREDICTED: protein transport protein Sec61 s...    180   4e-51   Eucalyptus grandis [rose gum]
ref|XP_003628446.1|  Protein transport protein Sec61 subunit alpha      180   5e-51   Medicago truncatula
ref|XP_011002751.1|  PREDICTED: protein transport protein Sec61 s...    180   5e-51   Populus euphratica
ref|XP_006370111.1|  transport protein sec61                            180   5e-51   Populus trichocarpa [western balsam poplar]
ref|XP_007211599.1|  hypothetical protein PRUPE_ppa005456mg             180   5e-51   
gb|KJB12999.1|  hypothetical protein B456_002G050300                    177   5e-51   Gossypium raimondii
ref|XP_008383603.1|  PREDICTED: protein transport protein Sec61 s...    180   6e-51   Malus domestica [apple tree]
gb|EEC84408.1|  hypothetical protein OsI_30995                          179   6e-51   Oryza sativa Indica Group [Indian rice]
emb|CDY43687.1|  BnaA04g20040D                                          179   7e-51   Brassica napus [oilseed rape]
emb|CDP06028.1|  unnamed protein product                                180   7e-51   Coffea canephora [robusta coffee]
ref|XP_009352723.1|  PREDICTED: protein transport protein Sec61 s...    180   7e-51   Pyrus x bretschneideri [bai li]
ref|NP_001146689.1|  uncharacterized protein LOC100280289               180   7e-51   Zea mays [maize]
ref|NP_001062945.1|  Os09g0347700                                       180   7e-51   
ref|XP_006649623.1|  PREDICTED: protein transport protein Sec61 s...    180   7e-51   Oryza brachyantha
ref|XP_004136590.1|  PREDICTED: protein transport protein Sec61 s...    180   8e-51   Cucumis sativus [cucumbers]
ref|XP_004161483.1|  PREDICTED: protein transport protein Sec61 s...    180   8e-51   
ref|XP_004981662.1|  PREDICTED: protein transport protein Sec61 s...    180   8e-51   Setaria italica
tpg|DAA44057.1|  TPA: hypothetical protein ZEAMMB73_205158              180   8e-51   
ref|NP_001049359.1|  Os03g0213100                                       180   8e-51   
ref|NP_174225.2|  SecY protein transport family protein                 179   8e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307403.1|  hypothetical protein CARUB_v10009028mg             179   8e-51   Capsella rubella
ref|XP_004985212.1|  PREDICTED: protein transport protein Sec61 s...    179   8e-51   Setaria italica
ref|XP_008658175.1|  PREDICTED: uncharacterized protein LOC100217...    179   8e-51   
gb|KDP46025.1|  hypothetical protein JCGZ_13471                         179   8e-51   Jatropha curcas
ref|XP_003578013.1|  PREDICTED: protein transport protein Sec61 s...    179   8e-51   Brachypodium distachyon [annual false brome]
ref|XP_002890804.1|  hypothetical protein ARALYDRAFT_473141             179   8e-51   
ref|XP_009115256.1|  PREDICTED: protein transport protein Sec61 s...    179   8e-51   Brassica rapa
ref|XP_010460708.1|  PREDICTED: protein transport protein Sec61 s...    179   8e-51   Camelina sativa [gold-of-pleasure]
dbj|BAJ85974.1|  predicted protein                                      179   9e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_180972.1|  SecY protein transport family protein                 179   9e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415586.1|  hypothetical protein EUTSA_v10007527mg             179   9e-51   Eutrema salsugineum [saltwater cress]
ref|XP_006852951.1|  hypothetical protein AMTR_s00033p00240440          179   9e-51   Amborella trichopoda
ref|XP_008463755.1|  PREDICTED: protein transport protein Sec61 s...    179   9e-51   Cucumis melo [Oriental melon]
ref|XP_009401155.1|  PREDICTED: protein transport protein Sec61 s...    179   9e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002316850.1|  transport protein sec61                            179   9e-51   Populus trichocarpa [western balsam poplar]
ref|XP_011044057.1|  PREDICTED: protein transport protein Sec61 s...    179   9e-51   Populus euphratica
ref|XP_009141364.1|  PREDICTED: protein transport protein Sec61 s...    179   9e-51   Brassica rapa
gb|AAF88109.1|AC021043_2  Putative protein transport protein SEC6...    179   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285514.1|  PREDICTED: protein transport protein Sec61 s...    179   1e-50   Vitis vinifera
ref|NP_001241126.1|  uncharacterized protein LOC100798372               179   1e-50   Glycine max [soybeans]
ref|XP_010647191.1|  PREDICTED: protein transport protein Sec61 s...    179   1e-50   Vitis vinifera
ref|XP_007133277.1|  hypothetical protein PHAVU_011G166200g             179   1e-50   Phaseolus vulgaris [French bean]
ref|XP_006477866.1|  PREDICTED: protein transport protein Sec61 s...    179   1e-50   Citrus sinensis [apfelsine]
ref|XP_006442428.1|  hypothetical protein CICLE_v10019973mg             179   1e-50   Citrus clementina [clementine]
ref|XP_008670755.1|  PREDICTED: uncharacterized protein LOC100276...    179   1e-50   Zea mays [maize]
ref|XP_006449551.1|  hypothetical protein CICLE_v10014773mg             180   2e-50   
gb|KCW74774.1|  hypothetical protein EUGRSUZ_E03508                     171   2e-50   Eucalyptus grandis [rose gum]
gb|AGV54339.1|  protein transport protein Sec61 subunit alpha-lik...    179   2e-50   Phaseolus vulgaris [French bean]
ref|XP_004509316.1|  PREDICTED: protein transport protein Sec61 s...    179   2e-50   
ref|XP_004491759.1|  PREDICTED: protein transport protein Sec61 s...    179   2e-50   Cicer arietinum [garbanzo]
ref|XP_003629384.1|  Protein transport protein Sec61 subunit alpha      179   2e-50   Medicago truncatula
gb|AFK48157.1|  unknown                                                 179   2e-50   Lotus japonicus
ref|XP_003527201.1|  PREDICTED: protein transport protein Sec61 s...    179   2e-50   Glycine max [soybeans]
gb|ACU23375.1|  unknown                                                 179   2e-50   Glycine max [soybeans]
ref|XP_003540494.1|  PREDICTED: protein transport protein Sec61 s...    178   2e-50   Glycine max [soybeans]
ref|XP_003540056.1|  PREDICTED: protein transport protein Sec61 s...    178   2e-50   Glycine max [soybeans]
gb|EEE58576.1|  hypothetical protein OsJ_09896                          179   3e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010472707.1|  PREDICTED: protein transport protein Sec61 s...    178   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004171091.1|  PREDICTED: protein transport protein Sec61 s...    178   3e-50   
ref|XP_004146019.1|  PREDICTED: protein transport protein Sec61 s...    178   3e-50   Cucumis sativus [cucumbers]
ref|XP_010062836.1|  PREDICTED: protein transport protein Sec61 s...    178   4e-50   Eucalyptus grandis [rose gum]
ref|XP_008225231.1|  PREDICTED: protein transport protein Sec61 s...    177   4e-50   Prunus mume [ume]
ref|XP_010691598.1|  PREDICTED: protein transport protein Sec61 s...    177   5e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010686250.1|  PREDICTED: protein transport protein Sec61 s...    177   5e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12997.1|  hypothetical protein B456_002G050300                    177   8e-50   Gossypium raimondii
gb|EMS47738.1|  Protein transport protein Sec61 subunit alpha           178   1e-49   Triticum urartu
ref|XP_001782197.1|  predicted protein                                  176   2e-49   
ref|XP_009626265.1|  PREDICTED: protein transport protein Sec61 s...    176   2e-49   Nicotiana tomentosiformis
ref|XP_009769708.1|  PREDICTED: protein transport protein Sec61 s...    176   2e-49   Nicotiana sylvestris
ref|XP_006360036.1|  PREDICTED: protein transport protein Sec61 s...    176   3e-49   
ref|XP_010059389.1|  PREDICTED: protein transport protein Sec61 s...    171   3e-49   
ref|XP_004248236.1|  PREDICTED: protein transport protein Sec61 s...    176   3e-49   Solanum lycopersicum
gb|KHG05744.1|  Protein transport Sec61 subunit alpha                   175   4e-49   Gossypium arboreum [tree cotton]
gb|AAM65038.1|  putative protein transport protein SEC61 alpha su...    175   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769421.1|  predicted protein                                  175   5e-49   
ref|XP_002983331.1|  hypothetical protein SELMODRAFT_180018             175   5e-49   
ref|XP_002987618.1|  hypothetical protein SELMODRAFT_271933             174   6e-49   
ref|XP_008367174.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    173   7e-49   
ref|XP_010106618.1|  Protein transport protein Sec61 subunit alpha      173   1e-48   
gb|AAF80449.1|AF161718_1  Sec61p                                        173   2e-48   Triticum aestivum [Canadian hard winter wheat]
gb|EMS53662.1|  Protein transport protein Sec61 subunit alpha           173   3e-48   Triticum urartu
ref|XP_007021907.1|  SecY protein transport family protein              172   6e-48   
ref|XP_010537719.1|  PREDICTED: protein transport protein Sec61 s...    171   2e-47   Tarenaya hassleriana [spider flower]
gb|AAK94784.1|  Sec61 alpha subunit                                     170   2e-47   Hordeum vulgare [barley]
ref|XP_008351223.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    163   3e-47   
gb|EMT30970.1|  Protein transport protein Sec61 subunit alpha           170   4e-47   
ref|XP_010228980.1|  PREDICTED: protein transport protein Sec61 s...    169   6e-47   Brachypodium distachyon [annual false brome]
ref|XP_002504986.1|  type II secretory pathway family                   169   1e-46   Micromonas commoda
ref|XP_003060622.1|  type II secretory pathway family protein           167   3e-46   Micromonas pusilla CCMP1545
ref|XP_007515006.1|  protein transport protein SEC61 alpha subunit      167   3e-46   Bathycoccus prasinos
dbj|BAG51324.1|  unnamed protein product                                157   5e-46   Homo sapiens [man]
dbj|BAA91692.1|  unnamed protein product                                160   1e-45   Homo sapiens [man]
ref|XP_002191019.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-45   
gb|KFU99452.1|  Protein transport protein Sec61 subunit alpha iso...    159   2e-45   Tauraco erythrolophus
ref|XP_005081337.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-45   
ref|XP_009975976.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-45   Tauraco erythrolophus
ref|XP_009973150.1|  PREDICTED: protein transport protein Sec61 s...    160   3e-45   Tyto alba [Schleiereule]
gb|KFV60865.1|  Protein transport protein Sec61 subunit alpha iso...    160   3e-45   Tyto alba [Schleiereule]
gb|ETN72576.1|  hypothetical protein NECAME_18785                       155   3e-45   Necator americanus
ref|XP_006497580.1|  PREDICTED: protein transport protein Sec61 s...    160   3e-45   Mus musculus [mouse]
dbj|BAM17983.1|  sec61alpha                                             158   6e-45   Papilio xuthus [Chinese swallowtail]
gb|KIY91973.1|  Protein transport protein Sec61 subunit alpha           156   6e-45   Monoraphidium neglectum
ref|XP_004036299.1|  PREDICTED: protein transport protein Sec61 s...    156   6e-45   
ref|XP_008466992.1|  PREDICTED: protein transport protein Sec61 s...    159   7e-45   Cucumis melo [Oriental melon]
ref|XP_007430199.1|  PREDICTED: protein transport protein Sec61 s...    160   1e-44   
emb|CAD38592.1|  hypothetical protein                                   157   1e-44   Homo sapiens [man]
ref|XP_006497579.1|  PREDICTED: protein transport protein Sec61 s...    160   2e-44   
gb|KFP25983.1|  Protein transport protein Sec61 subunit alpha iso...    160   2e-44   Colius striatus
ref|XP_010201370.1|  PREDICTED: protein transport protein Sec61 s...    160   2e-44   Colius striatus
ref|XP_001421497.1|  IISP family transporter: protein transport p...    163   2e-44   Ostreococcus lucimarinus CCE9901
gb|EDL78657.1|  Sec61, alpha subunit 2 (S. cerevisiae) (predicted)      160   2e-44   Rattus norvegicus [brown rat]
emb|CAH92375.1|  hypothetical protein                                   157   3e-44   Pongo abelii [orang utan]
ref|XP_005778706.1|  hypothetical protein EMIHUDRAFT_457349             162   3e-44   Emiliania huxleyi CCMP1516
gb|EYU28118.1|  hypothetical protein MIMGU_mgv1a022627mg                162   3e-44   Erythranthe guttata [common monkey flower]
ref|XP_008502487.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-44   Calypte anna
ref|XP_004468929.1|  PREDICTED: protein transport protein Sec61 s...    160   3e-44   
emb|CEG01808.1|  Translocon Sec61/SecY, plug domain                     162   4e-44   Ostreococcus tauri
gb|KFO95185.1|  Protein transport protein Sec61 subunit alpha iso...    157   4e-44   Calypte anna
gb|KIH61672.1|  hypothetical protein ANCDUO_08051                       154   4e-44   Ancylostoma duodenale
gb|ACH85336.1|  Sec61 alpha form A-like                                 154   4e-44   Salmo salar
ref|XP_003083352.1|  putative Sec61 alpha form 2 [Oryza sativa (ISS)    162   5e-44   
ref|XP_009814266.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    160   6e-44   Gavia stellata
ref|XP_009694583.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    160   7e-44   Cariama cristata
gb|KFK30162.1|  hypothetical protein AALP_AA7G225200                    160   7e-44   Arabis alpina [alpine rockcress]
ref|XP_006497578.1|  PREDICTED: protein transport protein Sec61 s...    159   7e-44   
gb|EGV95426.1|  Protein transport protein Sec61 subunit alpha iso...    160   7e-44   Cricetulus griseus [Chinese hamsters]
ref|XP_006254319.1|  PREDICTED: protein transport protein Sec61 s...    159   7e-44   Rattus norvegicus [brown rat]
ref|XP_010579287.1|  PREDICTED: protein transport protein Sec61 s...    160   7e-44   Haliaeetus leucocephalus
gb|KFZ65743.1|  Protein transport protein Sec61 subunit alpha iso...    160   7e-44   Podiceps cristatus
gb|KFV56848.1|  Protein transport protein Sec61 subunit alpha iso...    159   7e-44   Gavia stellata
ref|XP_005658390.1|  PREDICTED: protein transport protein Sec61 s...    159   8e-44   
ref|XP_007129360.1|  PREDICTED: protein transport protein Sec61 s...    160   9e-44   
ref|XP_006077807.1|  PREDICTED: protein transport protein Sec61 s...    160   9e-44   Bubalus bubalis [domestic water buffalo]
ref|XP_009514960.1|  hypothetical protein PHYSODRAFT_284123             159   9e-44   Phytophthora sojae
gb|EFA85179.1|  protein transport protein SEC61 alpha subunit           160   1e-43   Heterostelium album PN500
ref|XP_647801.1|  protein transport protein SEC61 alpha subunit         160   1e-43   Dictyostelium discoideum AX4
ref|XP_005668256.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-43   Sus scrofa [pigs]
gb|KGL78327.1|  Protein transport protein Sec61 subunit alpha iso...    160   1e-43   Tinamus guttatus
ref|XP_002946971.1|  hypothetical protein VOLCADRAFT_72975              160   1e-43   Volvox carteri f. nagariensis
ref|XP_006873227.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-43   Chrysochloris asiatica
gb|KFO34545.1|  Protein transport protein Sec61 subunit alpha iso...    159   1e-43   Fukomys damarensis [Damara mole rat]
ref|XP_004320478.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-43   
ref|XP_010339473.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-43   Saimiri boliviensis boliviensis
ref|XP_004351549.1|  transport protein Sec61 alpha subunit, putative    160   1e-43   Acanthamoeba castellanii str. Neff
ref|XP_010579286.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-43   Haliaeetus leucocephalus
gb|EFB21345.1|  hypothetical protein PANDA_014644                       159   1e-43   Ailuropoda melanoleuca
ref|XP_005993900.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-43   
gb|EPQ14139.1|  Protein transport protein Sec61 subunit alpha iso...    159   1e-43   Myotis brandtii
ref|XP_009966212.1|  PREDICTED: protein transport protein Sec61 s...    157   1e-43   Tyto alba [Schleiereule]
ref|XP_011357922.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-43   
gb|EDL07972.1|  Sec61, alpha subunit 2 (S. cerevisiae), isoform C...    159   2e-43   Mus musculus [mouse]
ref|XP_004355758.1|  protein transport protein SEC61 alpha subunit      160   2e-43   Cavenderia fasciculata
ref|XP_004468928.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-43   
ref|XP_001703311.1|  SEC61-alpha subunit of ER-translocon               160   2e-43   Chlamydomonas reinhardtii
ref|XP_005646491.1|  SecY protein                                       160   2e-43   Coccomyxa subellipsoidea C-169
ref|XP_010579284.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-43   Haliaeetus leucocephalus
gb|KFP46467.1|  Protein transport protein Sec61 subunit alpha iso...    159   2e-43   Cathartes aura
ref|XP_008062954.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-43   Carlito syrichta
gb|EMT33101.1|  Protein transport protein Sec61 subunit alpha           160   2e-43   
ref|XP_009647739.1|  PREDICTED: protein transport protein Sec61 s...    160   2e-43   Egretta garzetta
gb|KFW65558.1|  Protein transport protein Sec61 subunit alpha iso...    160   2e-43   Pygoscelis adeliae
dbj|BAG63284.1|  unnamed protein product                                159   2e-43   Homo sapiens [man]
gb|ELR53988.1|  Protein transport protein Sec61 subunit alpha iso...    159   2e-43   Bos mutus
ref|XP_004774968.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-43   
gb|KFV85490.1|  Protein transport protein Sec61 subunit alpha iso...    159   2e-43   Struthio camelus australis
ref|XP_010579282.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-43   Haliaeetus leucocephalus
gb|KFP11647.1|  Protein transport protein Sec61 subunit alpha iso...    159   2e-43   Egretta garzetta
ref|XP_009941891.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   2e-43   Opisthocomus hoazin [hoatzin]
ref|XP_006117154.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-43   
ref|XP_007056612.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-43   
ref|XP_009881313.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   2e-43   Charadrius vociferus
gb|KFO12476.1|  Protein transport protein Sec61 subunit alpha iso...    159   2e-43   Balearica regulorum gibbericeps
ref|XP_005143386.1|  PREDICTED: protein transport protein Sec61 s...    159   2e-43   Melopsittacus undulatus
gb|KFR17832.1|  Protein transport protein Sec61 subunit alpha iso...    160   2e-43   Opisthocomus hoazin [hoatzin]
ref|XP_005398134.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_006022205.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   3e-43   Alligator sinensis
ref|XP_009465560.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Nipponia nippon
ref|XP_005617197.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|NP_001136100.1|  protein transport protein Sec61 subunit alph...    159   3e-43   Homo sapiens [man]
ref|XP_004425423.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_009509420.1|  PREDICTED: protein transport protein Sec61 s...    160   3e-43   Phalacrocorax carbo [common cormorant]
ref|XP_005899188.1|  PREDICTED: protein transport protein Sec61 s...    160   3e-43   
ref|XP_008941687.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   3e-43   Merops nubicus
ref|XP_006270929.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_010172339.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   3e-43   Antrostomus carolinensis
ref|XP_010283319.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Phaethon lepturus
ref|XP_010075911.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   3e-43   Pterocles gutturalis
gb|KFV94819.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Fulmarus glacialis
ref|XP_005426353.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Geospiza fortis
ref|XP_009320047.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Pygoscelis adeliae
gb|EMC82158.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   
ref|XP_005688087.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
gb|KFQ64399.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Pelecanus crispus
gb|KFP89285.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Apaloderma vittatum
ref|XP_009581646.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Fulmarus glacialis
gb|EOB01841.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Anas platyrhynchos [duck]
gb|KFQ35427.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Mesitornis unicolor
gb|EHB07537.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Heterocephalus glaber [naked mole rat]
ref|XP_008924439.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_006098275.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   3e-43   Myotis lucifugus
gb|KFP00330.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Calypte anna
gb|KFP38818.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Chlamydotis macqueenii
ref|XP_011357919.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Pteropus vampyrus
ref|XP_010589033.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|NP_001127084.1|  protein transport protein Sec61 subunit alph...    159   3e-43   Pongo abelii [orang utan]
gb|EHH18885.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Macaca mulatta [rhesus macaque]
ref|XP_003786934.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_010304033.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Balearica regulorum gibbericeps
gb|KFU92356.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Chaetura pelagica
ref|XP_006747370.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Leptonychotes weddellii
gb|KFV67234.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Picoides pubescens
ref|XP_005972190.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Pantholops hodgsonii [Tibetan antelope]
ref|XP_007056611.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Chelonia mydas [green seaturtle]
gb|KFQ99124.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Nipponia nippon
ref|XP_009487226.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Pelecanus crispus
ref|XP_008703678.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Ursus maritimus [white bear]
ref|XP_002763985.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   Callithrix jacchus [common marmoset]
ref|NP_067280.1|  protein transport protein Sec61 subunit alpha i...    159   3e-43   Mus musculus [mouse]
gb|KFO70497.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   Cuculus canorus
ref|XP_006117153.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_008536913.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_008636626.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   3e-43   
ref|XP_007167475.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_005143385.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_004425422.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_003771471.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_004891805.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
gb|KFM11743.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   
ref|XP_009076688.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
gb|KFQ05104.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   
gb|KFP84037.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   
ref|XP_010619656.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_005018904.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_010131986.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
gb|KFO88247.1|  Protein transport protein Sec61 subunit alpha iso...    159   3e-43   
ref|XP_002191724.2|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
ref|XP_009567369.1|  PREDICTED: protein transport protein Sec61 s...    159   3e-43   
gb|KDO15700.1|  protein transporter Sec61 subunit alpha                 157   4e-43   
ref|XP_005607054.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
gb|EHB09092.1|  Protein transport protein Sec61 subunit alpha iso...    157   4e-43   
ref|XP_009999594.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
ref|XP_004647833.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
dbj|BAC11298.1|  unnamed protein product                                157   4e-43   
ref|XP_009959804.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
ref|XP_008837030.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   4e-43   
ref|XP_010182522.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
gb|KFP34012.1|  Protein transport protein Sec61 subunit alpha iso...    157   4e-43   
ref|XP_008491351.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
ref|XP_005039162.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
ref|XP_005992622.1|  PREDICTED: protein transport protein Sec61 s...    158   4e-43   
ref|XP_010718560.1|  PREDICTED: protein transport protein Sec61 s...    160   4e-43   
ref|XP_005617196.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
ref|XP_009465559.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
ref|XP_010406087.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
gb|EAW79324.1|  Sec61 alpha 1 subunit (S. cerevisiae), isoform CRA_a    157   4e-43   
ref|XP_004712691.1|  PREDICTED: protein transport protein Sec61 s...    159   4e-43   
ref|XP_002997717.1|  protein transporter Sec61 subunit alpha, put...    159   4e-43   
ref|XP_008916096.1|  protein transporter Sec61 subunit alpha isof...    159   4e-43   
ref|XP_010205784.1|  PREDICTED: protein transport protein Sec61 s...    157   4e-43   
ref|XP_009868321.1|  PREDICTED: protein transport protein Sec61 s...    159   5e-43   
ref|XP_005439375.1|  PREDICTED: protein transport protein Sec61 s...    159   5e-43   
ref|XP_008000451.1|  PREDICTED: protein transport protein Sec61 s...    159   5e-43   
ref|XP_004891806.1|  PREDICTED: protein transport protein Sec61 s...    159   5e-43   
ref|XP_005240234.1|  PREDICTED: protein transport protein Sec61 s...    159   5e-43   
ref|XP_005510359.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   5e-43   
ref|XP_010579280.1|  PREDICTED: protein transport protein Sec61 s...    159   5e-43   
ref|NP_001119639.1|  Sec61 alpha 1 subunit                              159   5e-43   
ref|XP_004818631.1|  PREDICTED: protein transport protein Sec61 s...    159   5e-43   
ref|XP_006117152.1|  PREDICTED: protein transport protein Sec61 s...    159   5e-43   
ref|XP_006776240.1|  PREDICTED: protein transport protein Sec61 s...    159   5e-43   
pdb|4W27|1  Chain 1, Structure Of The Translating Mammalian Ribos...    157   6e-43   
ref|XP_003468753.1|  PREDICTED: protein transport protein Sec61 s...    159   6e-43   
ref|XP_009898616.1|  PREDICTED: protein transport protein Sec61 s...    159   6e-43   
ref|XP_010214556.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   7e-43   
ref|XP_010127749.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   7e-43   
ref|XP_006412132.1|  hypothetical protein EUTSA_v10027275mg             157   8e-43   
ref|XP_011281901.1|  PREDICTED: protein transport protein Sec61 s...    159   8e-43   
ref|XP_008148669.1|  PREDICTED: protein transport protein Sec61 s...    159   8e-43   
gb|EFN88541.1|  Protein transport protein Sec61 subunit alpha iso...    158   9e-43   
ref|XP_011153709.1|  PREDICTED: protein transport protein Sec61 s...    158   9e-43   
gb|KFW82150.1|  Protein transport protein Sec61 subunit alpha iso...    157   9e-43   
emb|CDJ59754.1|  protein transport protein Sec61 alpha subunit is...    153   9e-43   
ref|XP_007081281.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-42   
ref|XP_011068255.1|  PREDICTED: protein transport protein Sec61 s...    158   1e-42   
ref|XP_011175809.1|  PREDICTED: protein transport protein Sec61 s...    158   1e-42   
ref|XP_011332723.1|  PREDICTED: protein transport protein Sec61 s...    158   1e-42   
ref|XP_009915581.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    159   1e-42   
ref|XP_005876661.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-42   
ref|NP_001037628.1|  transport protein Sec61 alpha subunit              158   1e-42   
emb|CDJ32709.1|  hypothetical protein EMH_0013390                       153   1e-42   
ref|XP_010579274.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-42   
gb|EGI69424.1|  Protein transport protein Sec61 subunit alpha iso...    158   1e-42   
gb|EHJ67611.1|  transport protein Sec61 alpha subunit                   158   1e-42   
ref|XP_011306289.1|  PREDICTED: protein transport protein Sec61 s...    158   1e-42   
gb|ACJ66917.1|  transport protein Sec61 alpha subunit                   157   1e-42   
ref|XP_004662394.1|  PREDICTED: protein transport protein Sec61 s...    159   1e-42   
ref|XP_424024.4|  PREDICTED: LOW QUALITY PROTEIN: protein transpo...    159   1e-42   
ref|XP_008547532.1|  PREDICTED: protein transport protein Sec61 s...    157   1e-42   
ref|XP_004692382.1|  PREDICTED: protein transport protein Sec61 s...    157   1e-42   
gb|AEE61607.1|  unknown                                                 157   1e-42   
ref|XP_970150.1|  PREDICTED: protein transport protein Sec61 subu...    157   1e-42   
gb|KDR12041.1|  Protein transport protein Sec61 subunit alpha iso...    157   2e-42   
ref|XP_007465331.1|  PREDICTED: protein transport protein Sec61 s...    157   2e-42   
ref|XP_006895236.1|  PREDICTED: protein transport protein Sec61 s...    157   2e-42   
ref|XP_004702408.1|  PREDICTED: protein transport protein Sec61 s...    157   2e-42   
ref|XP_004603847.1|  PREDICTED: protein transport protein Sec61 s...    157   2e-42   
ref|XP_004285491.1|  PREDICTED: protein transport protein Sec61 s...    157   2e-42   
ref|XP_008580550.1|  PREDICTED: protein transport protein Sec61 s...    157   2e-42   
gb|EFZ21245.1|  hypothetical protein SINV_02195                         157   2e-42   
ref|XP_007060040.1|  PREDICTED: protein transport protein Sec61 s...    156   2e-42   
ref|XP_007905824.1|  PREDICTED: protein transport protein Sec61 s...    157   2e-42   
gb|EGW09464.1|  Protein transport protein Sec61 subunit alpha iso...    157   2e-42   
ref|XP_007905825.1|  PREDICTED: protein transport protein Sec61 s...    157   2e-42   
ref|XP_004875225.1|  PREDICTED: protein transport protein Sec61 s...    156   2e-42   
ref|XP_008611038.1|  protein transporter Sec61 subunit alpha            157   2e-42   
ref|XP_003360745.1|  PREDICTED: protein transport protein Sec61 s...    157   2e-42   
ref|XP_004014704.1|  PREDICTED: protein transport protein Sec61 s...    158   2e-42   
gb|EOB06967.1|  Protein transport protein Sec61 subunit alpha iso...    157   2e-42   
ref|XP_004944648.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-42   
gb|EFB22588.1|  hypothetical protein PANDA_006024                       156   3e-42   
ref|XP_007642347.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-42   
ref|XP_005979498.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-42   
ref|XP_005142288.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_006816377.1|  PREDICTED: protein transport protein Sec61 s...    155   3e-42   
ref|XP_006078904.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_002428707.1|  protein transport protein Sec61 subunit alph...    157   3e-42   
gb|KFP69419.1|  Protein transport protein Sec61 subunit alpha iso...    157   3e-42   
ref|XP_009872846.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-42   
ref|XP_007465330.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-42   
gb|ETE68905.1|  Protein transport protein Sec61 subunit alpha iso...    157   3e-42   
ref|XP_003982606.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-42   
gb|ELR62748.1|  Protein transport protein Sec61 subunit alpha iso...    156   3e-42   
gb|KFV14972.1|  Protein transport protein Sec61 subunit alpha iso...    156   3e-42   
ref|NP_037468.1|  protein transport protein Sec61 subunit alpha i...    157   3e-42   
ref|XP_004702407.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-42   
ref|XP_009933438.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-42   
gb|KFO58044.1|  Protein transport protein Sec61 subunit alpha iso...    156   3e-42   
ref|XP_004442497.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_004944647.1|  PREDICTED: protein transport protein Sec61 s...    157   3e-42   
ref|XP_004692381.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_004581404.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_010081379.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_003217774.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_002917678.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_009089339.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_007428674.1|  PREDICTED: protein transport protein Sec61 s...    156   3e-42   
ref|XP_010223590.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_007253335.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|NP_001003315.1|  protein transport protein Sec61 subunit alph...    156   4e-42   
ref|XP_006017833.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
emb|CAH91512.1|  hypothetical protein                                   156   4e-42   
gb|KFP39628.1|  Protein transport protein Sec61 subunit alpha iso...    156   4e-42   
ref|XP_009080952.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
gb|KGL84577.1|  Protein transport protein Sec61 subunit alpha iso...    156   4e-42   
gb|KFW93446.1|  Protein transport protein Sec61 subunit alpha iso...    156   4e-42   
gb|EMC85102.1|  Protein transport protein Sec61 subunit alpha iso...    156   4e-42   
dbj|BAE39565.1|  unnamed protein product                                156   4e-42   
ref|XP_009483297.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_008934961.1|  PREDICTED: protein transport protein Sec61 s...    157   4e-42   
ref|XP_006895235.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_414364.3|  PREDICTED: protein transport protein Sec61 subu...    156   4e-42   
ref|XP_009667659.1|  PREDICTED: protein transport protein Sec61 s...    157   4e-42   
ref|XP_007666503.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_005053038.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|NP_001080244.1|  Sec61 alpha 1 subunit                              156   4e-42   
ref|XP_001378065.2|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_005696224.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
gb|KFU92598.1|  Protein transport protein Sec61 subunit alpha iso...    156   4e-42   
ref|XP_001661042.1|  AAEL010716-PA                                      156   4e-42   
ref|XP_003279937.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|NP_001035594.1|  protein transport protein Sec61 subunit alph...    156   4e-42   
ref|XP_010113741.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_005600510.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_005011922.1|  PREDICTED: protein transport protein Sec61 s...    157   4e-42   
ref|XP_009507482.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_009999902.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
gb|ERE66773.1|  protein transport protein Sec61 subunit alpha iso...    157   4e-42   
ref|XP_009569573.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_009681318.1|  PREDICTED: protein transport protein Sec61 s...    161   4e-42   
ref|XP_010019295.1|  PREDICTED: protein transport protein Sec61 s...    157   4e-42   
ref|XP_008923570.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|XP_010292419.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
ref|NP_001004801.1|  Sec61 alpha 1 subunit                              156   4e-42   
ref|XP_003762548.1|  PREDICTED: protein transport protein Sec61 s...    156   4e-42   
gb|AAD27765.1|AF077032_1  sec61 homolog                                 156   4e-42   
ref|XP_009912017.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
gb|EFX71507.1|  hypothetical protein DAPPUDRAFT_308832                  156   5e-42   
ref|XP_005230128.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_009982797.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_007888538.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_008473159.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_006405520.1|  hypothetical protein EUTSA_v10028266mg             149   5e-42   
ref|XP_009319324.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_005887086.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_005507619.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_005420329.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_802085.1|  PREDICTED: protein transport protein Sec61 subu...    156   5e-42   
ref|XP_005432662.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_010388673.1|  PREDICTED: protein transport protein Sec61 s...    157   5e-42   
ref|XP_010184219.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_008696180.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_009282830.1|  PREDICTED: protein transport protein Sec61 s...    156   5e-42   
ref|XP_006633412.1|  PREDICTED: protein transport protein Sec61 s...    156   6e-42   
emb|CCA19502.1|  Sec61 alpha 1 subunit putative                         155   6e-42   
gb|ELK15194.1|  Protein transport protein Sec61 subunit alpha iso...    157   6e-42   
ref|XP_008630570.1|  PREDICTED: protein transport protein Sec61 s...    156   6e-42   
ref|XP_008497329.1|  PREDICTED: protein transport protein Sec61 s...    156   6e-42   
ref|XP_004018759.1|  PREDICTED: protein transport protein Sec61 s...    156   7e-42   
ref|XP_002403755.1|  protein transport protein SEC61 alpha subuni...    155   7e-42   
ref|XP_009637516.1|  PREDICTED: protein transport protein Sec61 s...    156   7e-42   
ref|XP_009955368.1|  PREDICTED: protein transport protein Sec61 s...    156   7e-42   
gb|ETN62479.1|  transport protein Sec61 subunit alpha 2                 155   8e-42   
ref|XP_001850184.1|  transport protein Sec61 subunit alpha 2            155   8e-42   
ref|XP_010571905.1|  PREDICTED: protein transport protein Sec61 s...    156   8e-42   
ref|XP_319948.4|  AGAP009182-PA                                         155   8e-42   
ref|XP_010305079.1|  PREDICTED: protein transport protein Sec61 s...    156   9e-42   
dbj|GAM22992.1|  hypothetical protein SAMD00019534_061670               155   9e-42   
gb|ACO12745.1|  transport protein Sec61 subunit alpha                   155   1e-41   
gb|KHN72448.1|  Protein transport protein Sec61 subunit alpha iso...    155   1e-41   
ref|XP_009841111.1|  protein transporter Sec61 subunit alpha isof...    155   1e-41   
ref|XP_002160468.1|  PREDICTED: protein transport protein Sec61 s...    155   1e-41   
ref|XP_008529956.1|  PREDICTED: protein transport protein Sec61 s...    156   1e-41   
gb|KFM79307.1|  Protein transport protein Sec61 subunit alpha iso...    155   1e-41   
gb|ACO10754.1|  transport protein Sec61 subunit alpha                   155   1e-41   
ref|NP_001255839.1|  Protein Y57G11C.15, isoform b                      155   1e-41   
gb|KFO38366.1|  Protein transport protein Sec61 subunit alpha iso...    156   1e-41   
ref|XP_009062528.1|  hypothetical protein LOTGIDRAFT_194715             155   1e-41   
ref|XP_004894270.1|  PREDICTED: protein transport protein Sec61 s...    156   1e-41   
ref|XP_009888184.1|  PREDICTED: protein transport protein Sec61 s...    156   1e-41   
ref|XP_005105453.1|  PREDICTED: protein transport protein Sec61 s...    155   1e-41   
ref|XP_009474695.1|  PREDICTED: protein transport protein Sec61 s...    156   1e-41   
ref|XP_005571834.1|  PREDICTED: protein transport protein Sec61 s...    156   1e-41   
ref|XP_002128363.1|  PREDICTED: protein transport protein Sec61 s...    155   1e-41   
gb|ELT86973.1|  hypothetical protein CAPTEDRAFT_156174                  155   1e-41   
ref|XP_005746504.1|  PREDICTED: protein transport protein Sec61 s...    154   1e-41   
ref|XP_003739009.1|  PREDICTED: protein transport protein Sec61 s...    155   1e-41   
ref|XP_002141254.1|  protein-transport Sec61 protein subunit alpha      155   2e-41   
gb|EYC11449.1|  hypothetical protein Y032_0050g1920                     155   2e-41   
gb|EGT57180.1|  hypothetical protein CAEBREN_10431                      155   2e-41   
ref|XP_003093119.1|  hypothetical protein CRE_12300                     155   2e-41   



>ref|XP_010911507.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Elaeis guineensis]
Length=121

 Score =   179 bits (455),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  21   LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  80

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  81   LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  113



>gb|ACR37176.1| unknown [Zea mays]
Length=107

 Score =   178 bits (452),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  7    LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  66

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  67   LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  99



>ref|NP_001136901.1| uncharacterized protein LOC100217058 [Zea mays]
 gb|ACF82851.1| unknown [Zea mays]
Length=150

 Score =   178 bits (452),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  50   LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  109

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  110  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  142



>gb|ABQ53546.1| SecY protein [Arachis diogoi]
Length=166

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  66   LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  125

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  126  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  158



>gb|KJB57358.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
Length=307

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  207  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  266

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  267  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  299



>emb|CDO96861.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  309  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  368

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  369  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  401



>emb|CBI25843.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR++N QKELNRYIPTAAAFGGMCIGALTV
Sbjct  85   LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTV  144

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  145  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  177



>gb|KJB57357.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
 gb|KJB57359.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
Length=338

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  238  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  297

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  298  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  330



>tpg|DAA51542.1| TPA: hypothetical protein ZEAMMB73_526095 [Zea mays]
Length=206

 Score =   178 bits (452),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN Q+ELNRYIPTAAAFGG+CIGALTV
Sbjct  106  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQRELNRYIPTAAAFGGVCIGALTV  165

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  166  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  198



>gb|KJB68353.1| hypothetical protein B456_010G241000 [Gossypium raimondii]
 gb|KJB68356.1| hypothetical protein B456_010G241000 [Gossypium raimondii]
Length=338

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  238  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  297

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  298  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  330



>ref|XP_011101434.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Sesamum indicum]
 ref|XP_011101435.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Sesamum indicum]
Length=475

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>gb|KJB68354.1| hypothetical protein B456_010G241000 [Gossypium raimondii]
Length=410

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  310  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  369

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  370  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  402



>ref|XP_008807199.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Phoenix dactylifera]
Length=397

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  297  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  356

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  357  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  389



>ref|XP_004491760.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cicer arietinum]
Length=274

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  174  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  233

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  234  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  266



>ref|XP_010549423.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Tarenaya hassleriana]
 ref|XP_010549425.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Tarenaya hassleriana]
Length=475

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>gb|KJB57355.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
 gb|KJB57356.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
 gb|KJB57360.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
 gb|KJB57361.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
 gb|KJB57362.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
 gb|KJB57363.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
 gb|KJB57364.1| hypothetical protein B456_009G160200 [Gossypium raimondii]
Length=476

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>dbj|BAD28480.1| putative Sec61 [Oryza sativa Japonica Group]
Length=337

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  237  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  296

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  297  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  329



>ref|XP_009624231.1| PREDICTED: protein transport protein Sec61 subunit alpha [Nicotiana 
tomentosiformis]
 ref|XP_009802301.1| PREDICTED: protein transport protein Sec61 subunit alpha [Nicotiana 
sylvestris]
Length=475

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>gb|EYU26314.1| hypothetical protein MIMGU_mgv1a005665mg [Erythranthe guttata]
Length=475

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_011098204.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X1 [Sesamum indicum]
 ref|XP_011098205.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X1 [Sesamum indicum]
 ref|XP_011098206.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X1 [Sesamum indicum]
Length=475

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>gb|EPS73277.1| sec61 transport protein, partial [Genlisea aurea]
Length=476

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  378  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  437

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  438  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  470



>gb|EPS70408.1| sec61 transport protein [Genlisea aurea]
Length=483

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  383  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  442

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  443  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  475



>gb|EYU29535.1| hypothetical protein MIMGU_mgv1a005663mg [Erythranthe guttata]
Length=475

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_004233033.1| PREDICTED: protein transport protein Sec61 subunit alpha [Solanum 
lycopersicum]
Length=475

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|NP_001062944.1| Os09g0347500 [Oryza sativa Japonica Group]
 dbj|BAF24858.1| Os09g0347500, partial [Oryza sativa Japonica Group]
Length=350

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  250  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  309

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  310  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  342



>ref|XP_006358101.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Solanum tuberosum]
Length=475

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>gb|KHG20425.1| Protein transport Sec61 subunit alpha [Gossypium arboreum]
 gb|KJB68352.1| hypothetical protein B456_010G241000 [Gossypium raimondii]
 gb|KJB68355.1| hypothetical protein B456_010G241000 [Gossypium raimondii]
Length=476

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>tpg|DAA44056.1| TPA: hypothetical protein ZEAMMB73_205158 [Zea mays]
Length=377

 Score =   180 bits (456),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  277  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  336

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  337  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  369



>gb|EAZ44377.1| hypothetical protein OsJ_29002 [Oryza sativa Japonica Group]
Length=377

 Score =   180 bits (456),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  277  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  336

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  337  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  369



>gb|AFW89231.1| hypothetical protein ZEAMMB73_841109 [Zea mays]
Length=377

 Score =   180 bits (456),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  277  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  336

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  337  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  369



>ref|XP_007025305.1| SecY protein transport family protein [Theobroma cacao]
 gb|EOY27927.1| SecY protein transport family protein [Theobroma cacao]
Length=476

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|NP_177993.1| SecY protein transport family protein [Arabidopsis thaliana]
 gb|AAC83037.1| Strong similarity to F13P17.9 gi|3337356 transport protein SEC61 
alpha subunit homolog from Arabidopsis thaliana BAC gb|AC004481 
[Arabidopsis thaliana]
 gb|AEE36143.1| SecY protein transport family protein [Arabidopsis thaliana]
Length=475

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVA+QL+EQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVARQLREQQMVMPGHRDSNLQKELNRYIPTAAAFGGLCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_006300978.1| hypothetical protein CARUB_v10021368mg [Capsella rubella]
 gb|EOA33876.1| hypothetical protein CARUB_v10021368mg [Capsella rubella]
Length=475

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVA+QL+EQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVARQLREQQMVMPGHRDSNLQKELNRYIPTAAAFGGLCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>gb|KDP21138.1| hypothetical protein JCGZ_21609 [Jatropha curcas]
Length=476

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|NP_001143980.1| uncharacterized protein LOC100276798 [Zea mays]
 gb|ACG36882.1| hypothetical protein [Zea mays]
Length=337

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN Q+ELNRYIPTAAAFGG+CIGALTV
Sbjct  237  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQRELNRYIPTAAAFGGVCIGALTV  296

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  297  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  329



>emb|CDY37667.1| BnaA04g20010D [Brassica napus]
Length=383

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  283  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  342

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  343  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  375



>gb|KDO51496.1| hypothetical protein CISIN_1g011822mg [Citrus sinensis]
Length=369

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR++N QKELNRYIPTAAAFGGMCIGALTV
Sbjct  269  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTV  328

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  329  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  361



>ref|XP_010930036.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Elaeis guineensis]
 ref|XP_010930037.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Elaeis guineensis]
 ref|XP_010930039.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Elaeis guineensis]
 ref|XP_010930040.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Elaeis guineensis]
 ref|XP_010930041.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Elaeis guineensis]
Length=475

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_008811629.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Phoenix dactylifera]
Length=476

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>gb|KDO51495.1| hypothetical protein CISIN_1g011822mg [Citrus sinensis]
Length=371

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR++N QKELNRYIPTAAAFGGMCIGALTV
Sbjct  271  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTV  330

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  331  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  363



>ref|XP_010540524.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Tarenaya hassleriana]
 ref|XP_010540525.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Tarenaya hassleriana]
Length=475

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_008368805.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Malus domestica]
Length=476

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>emb|CBI20172.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR++N QKELNRYIPTAAAFGGMCIGALTV
Sbjct  310  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTV  369

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  370  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  402



>ref|XP_004294073.1| PREDICTED: protein transport protein Sec61 subunit alpha [Fragaria 
vesca subsp. vesca]
 ref|XP_008226389.1| PREDICTED: protein transport protein Sec61 subunit alpha [Prunus 
mume]
 ref|XP_009334026.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Pyrus x bretschneideri]
Length=476

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_008244574.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Prunus mume]
Length=476

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_009342904.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Pyrus x bretschneideri]
Length=476

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_007199826.1| hypothetical protein PRUPE_ppa005115mg [Prunus persica]
 ref|XP_007212095.1| hypothetical protein PRUPE_ppa005131mg [Prunus persica]
 gb|EMJ01025.1| hypothetical protein PRUPE_ppa005115mg [Prunus persica]
 gb|EMJ13294.1| hypothetical protein PRUPE_ppa005131mg [Prunus persica]
Length=476

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_008386268.1| PREDICTED: protein transport protein Sec61 subunit alpha [Malus 
domestica]
Length=476

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_008809619.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Phoenix dactylifera]
 ref|XP_008809620.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Phoenix dactylifera]
Length=475

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_009379941.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=475

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  IADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_002522260.1| preprotein translocase secy subunit, putative [Ricinus communis]
 gb|EEF40118.1| preprotein translocase secy subunit, putative [Ricinus communis]
Length=476

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_010906216.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Elaeis guineensis]
 ref|XP_010906217.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Elaeis guineensis]
Length=476

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_009408993.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009408994.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=475

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_009403643.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403644.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=475

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_007149566.1| hypothetical protein PHAVU_005G081100g [Phaseolus vulgaris]
 gb|ESW21560.1| hypothetical protein PHAVU_005G081100g [Phaseolus vulgaris]
Length=476

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_010248479.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Nelumbo nucifera]
Length=455

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  355  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  414

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  415  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  447



>gb|ABR16326.1| unknown [Picea sitchensis]
Length=478

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  378  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  437

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  438  MADFMGAIGSGTGILLAVTIIYQYFETFEKERA  470



>ref|XP_006467607.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Citrus sinensis]
 gb|KDO77923.1| hypothetical protein CISIN_1g011896mg [Citrus sinensis]
 gb|KDO77924.1| hypothetical protein CISIN_1g011896mg [Citrus sinensis]
Length=475

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_010242143.1| PREDICTED: protein transport protein Sec61 subunit alpha [Nelumbo 
nucifera]
Length=476

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>gb|KCW67528.1| hypothetical protein EUGRSUZ_F01251 [Eucalyptus grandis]
Length=477

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVA+QL+EQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  377  LFSKTWIEVSGSSAKDVARQLREQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  436

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  437  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  469



>ref|XP_010060713.1| PREDICTED: protein transport protein Sec61 subunit alpha [Eucalyptus 
grandis]
 gb|KCW67527.1| hypothetical protein EUGRSUZ_F01251 [Eucalyptus grandis]
Length=476

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVA+QL+EQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVARQLREQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  468



>ref|XP_003628446.1| Protein transport protein Sec61 subunit alpha [Medicago truncatula]
 gb|AET02922.1| protein transporter Sec61 subunit alpha-like protein [Medicago 
truncatula]
Length=476

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_011002751.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Populus euphratica]
 ref|XP_011002752.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Populus euphratica]
 ref|XP_011002753.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Populus euphratica]
Length=476

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  468



>ref|XP_006370111.1| transport protein sec61 [Populus trichocarpa]
 ref|XP_006370112.1| hypothetical protein POPTR_0001s39590g [Populus trichocarpa]
 gb|ERP66680.1| transport protein sec61 [Populus trichocarpa]
 gb|ERP66681.1| hypothetical protein POPTR_0001s39590g [Populus trichocarpa]
Length=476

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  468



>ref|XP_007211599.1| hypothetical protein PRUPE_ppa005456mg [Prunus persica]
 gb|EMJ12798.1| hypothetical protein PRUPE_ppa005456mg [Prunus persica]
Length=460

 Score =   180 bits (456),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  360  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGLCIGALTV  419

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFET+EKEK 
Sbjct  420  VADLMGAIGSGTGILLAVTIIYQYFETYEKEKV  452



>gb|KJB12999.1| hypothetical protein B456_002G050300 [Gossypium raimondii]
Length=338

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQL+EQQMVMPGHR+ + QKELNRYIPTAAAFGGMCIGALTV
Sbjct  238  LFSKTWIEVSGSSARDVAKQLREQQMVMPGHREGSLQKELNRYIPTAAAFGGMCIGALTV  297

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  298  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  330



>ref|XP_008383603.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Malus domestica]
Length=475

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGLCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKER  466



>gb|EEC84408.1| hypothetical protein OsI_30995 [Oryza sativa Indica Group]
Length=452

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  352  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  411

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  412  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  444



>emb|CDY43687.1| BnaA04g20040D, partial [Brassica napus]
Length=452

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  352  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  411

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  412  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  444



>emb|CDP06028.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_009352723.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Pyrus x bretschneideri]
Length=475

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGLCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKER  466



>ref|NP_001146689.1| uncharacterized protein LOC100280289 [Zea mays]
 gb|ACL54535.1| unknown [Zea mays]
Length=475

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|NP_001062945.1| Os09g0347700 [Oryza sativa Japonica Group]
 ref|XP_006660560.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Oryza brachyantha]
 dbj|BAD28481.1| putative Sec61 alpha form 2 [Oryza sativa Japonica Group]
 dbj|BAD28559.1| putative Sec61 alpha form 2 [Oryza sativa Japonica Group]
 dbj|BAF24859.1| Os09g0347700 [Oryza sativa Japonica Group]
 dbj|BAG94672.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84409.1| hypothetical protein OsI_30997 [Oryza sativa Indica Group]
 gb|EEE69530.1| hypothetical protein OsJ_29000 [Oryza sativa Japonica Group]
 gb|AGT38443.1| sec 61 alpha form 2 [Oryza sativa Japonica Group]
 gb|AGT38444.1| sec 61 alpha [Oryza sativa Japonica Group]
Length=475

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_006649623.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Oryza brachyantha]
Length=475

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_004136590.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cucumis sativus]
 ref|XP_004137223.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cucumis sativus]
 ref|XP_004165723.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cucumis sativus]
 gb|KGN53583.1| hypothetical protein Csa_4G083570 [Cucumis sativus]
 gb|KGN59343.1| hypothetical protein Csa_3G812150 [Cucumis sativus]
Length=476

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEK 
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKV  468



>ref|XP_004161483.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cucumis sativus]
 ref|XP_008443118.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cucumis melo]
Length=476

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEK 
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKV  468



>ref|XP_004981662.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Setaria italica]
Length=475

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>tpg|DAA44057.1| TPA: hypothetical protein ZEAMMB73_205158 [Zea mays]
 tpg|DAA44058.1| TPA: hypothetical protein ZEAMMB73_205158 [Zea mays]
Length=475

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|NP_001049359.1| Os03g0213100 [Oryza sativa Japonica Group]
 gb|ABF94617.1| Protein transport protein Sec61 alpha subunit isoform 2, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11273.1| Os03g0213100 [Oryza sativa Japonica Group]
 gb|EAY89024.1| hypothetical protein OsI_10508 [Oryza sativa Indica Group]
Length=475

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|NP_174225.2| SecY protein transport family protein [Arabidopsis thaliana]
 gb|AAM13046.1| putative protein transport protein SEC61 alpha subunit [Arabidopsis 
thaliana]
 gb|AEE31071.1| SecY protein transport family protein [Arabidopsis thaliana]
Length=475

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_006307403.1| hypothetical protein CARUB_v10009028mg [Capsella rubella]
 ref|XP_010499447.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Camelina sativa]
 ref|XP_010478292.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Camelina sativa]
 gb|EOA40301.1| hypothetical protein CARUB_v10009028mg [Capsella rubella]
Length=475

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_004985212.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Setaria italica]
Length=475

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_008658175.1| PREDICTED: uncharacterized protein LOC100217058 isoform X1 [Zea 
mays]
 gb|ACL54115.1| unknown [Zea mays]
 gb|AFW89229.1| hypothetical protein ZEAMMB73_841109 [Zea mays]
 gb|AFW89230.1| hypothetical protein ZEAMMB73_841109 [Zea mays]
Length=475

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>gb|KDP46025.1| hypothetical protein JCGZ_13471 [Jatropha curcas]
Length=476

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_003578013.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Brachypodium distachyon]
Length=475

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_002890804.1| hypothetical protein ARALYDRAFT_473141 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67063.1| hypothetical protein ARALYDRAFT_473141 [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_009115256.1| PREDICTED: protein transport protein Sec61 subunit alpha [Brassica 
rapa]
 emb|CDY48325.1| BnaA09g26960D [Brassica napus]
Length=475

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_010460708.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Camelina sativa]
Length=475

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>dbj|BAJ85974.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87666.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|NP_180972.1| SecY protein transport family protein [Arabidopsis thaliana]
 ref|NP_001031476.1| SecY protein transport family protein [Arabidopsis thaliana]
 ref|XP_002879488.1| hypothetical protein ARALYDRAFT_482367 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006294128.1| hypothetical protein CARUB_v10023123mg [Capsella rubella]
 ref|XP_006410566.1| hypothetical protein EUTSA_v10016599mg [Eutrema salsugineum]
 ref|XP_009132979.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Brassica rapa]
 ref|XP_009132980.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Brassica rapa]
 ref|XP_009143793.1| PREDICTED: protein transport protein Sec61 subunit alpha [Brassica 
rapa]
 ref|XP_010509778.1| PREDICTED: protein transport protein Sec61 subunit alpha [Camelina 
sativa]
 ref|XP_010509779.1| PREDICTED: protein transport protein Sec61 subunit alpha [Camelina 
sativa]
 ref|XP_010413766.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Camelina sativa]
 gb|AAK32885.1|AF367298_1 At2g34250/F13P17.9 [Arabidopsis thaliana]
 gb|AAC27401.1| putative protein transport protein SEC61 alpha subunit [Arabidopsis 
thaliana]
 gb|AAM65776.1| putative protein transport protein SEC61 alpha subunit [Arabidopsis 
thaliana]
 gb|AAN18076.1| At2g34250/F13P17.9 [Arabidopsis thaliana]
 dbj|BAH19870.1| AT2G34250 [Arabidopsis thaliana]
 gb|EFH55747.1| hypothetical protein ARALYDRAFT_482367 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC08943.1| SecY protein transport family protein [Arabidopsis thaliana]
 gb|AEC08944.1| SecY protein transport family protein [Arabidopsis thaliana]
 gb|EOA27026.1| hypothetical protein CARUB_v10023123mg [Capsella rubella]
 gb|ESQ52019.1| hypothetical protein EUTSA_v10016599mg [Eutrema salsugineum]
 emb|CDY61564.1| BnaCnng37980D [Brassica napus]
 emb|CDY52228.1| BnaC04g54050D [Brassica napus]
 emb|CDY17231.1| BnaA05g09570D [Brassica napus]
 emb|CDX84654.1| BnaA03g15760D [Brassica napus]
Length=475

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_006415586.1| hypothetical protein EUTSA_v10007527mg [Eutrema salsugineum]
 ref|XP_006415587.1| hypothetical protein EUTSA_v10007527mg [Eutrema salsugineum]
 gb|ESQ33939.1| hypothetical protein EUTSA_v10007527mg [Eutrema salsugineum]
 gb|ESQ33940.1| hypothetical protein EUTSA_v10007527mg [Eutrema salsugineum]
Length=475

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_006852951.1| hypothetical protein AMTR_s00033p00240440 [Amborella trichopoda]
 gb|ERN14418.1| hypothetical protein AMTR_s00033p00240440 [Amborella trichopoda]
Length=477

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN Q+ELNRYIPTAAAFGGMCIGALTV
Sbjct  377  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQRELNRYIPTAAAFGGMCIGALTV  436

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  437  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  469



>ref|XP_008463755.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cucumis melo]
 ref|XP_008463756.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cucumis melo]
Length=476

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  468



>ref|XP_009401155.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Musa acuminata subsp. malaccensis]
Length=475

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLK+QQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKDQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  VADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_002316850.1| transport protein sec61 [Populus trichocarpa]
 gb|ABK95348.1| unknown [Populus trichocarpa]
 gb|EEE97462.1| transport protein sec61 [Populus trichocarpa]
Length=476

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  468



>ref|XP_011044057.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Populus euphratica]
 ref|XP_011044058.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Populus euphratica]
Length=476

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  468



>ref|XP_009141364.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Brassica rapa]
Length=475

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>gb|AAF88109.1|AC021043_2 Putative protein transport protein SEC61 alpha subunit [Arabidopsis 
thaliana]
Length=475

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_002285514.1| PREDICTED: protein transport protein Sec61 subunit alpha [Vitis 
vinifera]
Length=476

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR++N QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|NP_001241126.1| uncharacterized protein LOC100798372 [Glycine max]
 ref|XP_006593445.1| PREDICTED: uncharacterized protein LOC100798372 isoform X1 [Glycine 
max]
 gb|ACU19295.1| unknown [Glycine max]
 gb|KHN36899.1| Protein transport protein Sec61 subunit alpha [Glycine soja]
Length=476

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_010647191.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Vitis vinifera]
 ref|XP_010647481.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Vitis vinifera]
Length=476

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR++N QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_007133277.1| hypothetical protein PHAVU_011G166200g [Phaseolus vulgaris]
 gb|AAF18411.1|AF190652_1 putative integral membrane protein [Phaseolus vulgaris]
 gb|ESW05271.1| hypothetical protein PHAVU_011G166200g [Phaseolus vulgaris]
Length=476

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_006477866.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Citrus sinensis]
 gb|KDO51493.1| hypothetical protein CISIN_1g011822mg [Citrus sinensis]
 gb|KDO51494.1| hypothetical protein CISIN_1g011822mg [Citrus sinensis]
Length=476

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR++N QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_006442428.1| hypothetical protein CICLE_v10019973mg [Citrus clementina]
 gb|ESR55668.1| hypothetical protein CICLE_v10019973mg [Citrus clementina]
Length=476

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR++N QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_008670755.1| PREDICTED: uncharacterized protein LOC100276798 isoform X1 [Zea 
mays]
 tpg|DAA51543.1| TPA: hypothetical protein ZEAMMB73_526095 [Zea mays]
Length=475

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN Q+ELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQRELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_006449551.1| hypothetical protein CICLE_v10014773mg [Citrus clementina]
 gb|ESR62791.1| hypothetical protein CICLE_v10014773mg [Citrus clementina]
Length=561

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  461  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRDSNLQKELNRYIPTAAAFGGVCIGALTV  520

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  521  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  553



>gb|KCW74774.1| hypothetical protein EUGRSUZ_E03508 [Eucalyptus grandis]
Length=186

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVA+QL EQQMVMPGHR+SN QKELN YIPTAAAFGGMCIGALTV
Sbjct  87   LFSKTWIEVSGSSAKDVARQLTEQQMVMPGHRESNLQKELNCYIPTAAAFGGMCIGALTV  146

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             A+ MGAIGSGTGILLAVTIIYQYF+TFEKEKA
Sbjct  147  LANFMGAIGSGTGILLAVTIIYQYFDTFEKEKA  179



>gb|AGV54339.1| protein transport protein Sec61 subunit alpha-like protein [Phaseolus 
vulgaris]
Length=476

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_004509316.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X1 [Cicer arietinum]
 ref|XP_004509317.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X2 [Cicer arietinum]
 ref|XP_004509318.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X3 [Cicer arietinum]
Length=476

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_004491759.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cicer arietinum]
Length=476

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_003629384.1| Protein transport protein Sec61 subunit alpha [Medicago truncatula]
 gb|AET03860.1| protein transporter Sec61 subunit alpha-like protein [Medicago 
truncatula]
 gb|AFK34996.1| unknown [Medicago truncatula]
Length=476

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>gb|AFK48157.1| unknown [Lotus japonicus]
Length=476

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_003527201.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Glycine max]
 gb|KHN46678.1| Protein transport protein Sec61 subunit alpha [Glycine soja]
Length=476

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>gb|ACU23375.1| unknown [Glycine max]
Length=476

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_003540494.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X1 [Glycine max]
 ref|XP_006592938.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X2 [Glycine max]
Length=476

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_003540056.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Glycine max]
 gb|KHN02587.1| Protein transport protein Sec61 subunit alpha [Glycine soja]
Length=476

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>gb|EEE58576.1| hypothetical protein OsJ_09896 [Oryza sativa Japonica Group]
Length=549

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  449  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  508

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  509  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  541



>ref|XP_010472707.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Camelina sativa]
Length=476

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KD A+QL+EQQMVMPGHRDSN QK+LNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSAKDAARQLREQQMVMPGHRDSNLQKQLNRYIPTAAAFGGVCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  436  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  468



>ref|XP_004171091.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cucumis sativus]
Length=476

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEK+
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKS  468



>ref|XP_004146019.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Cucumis sativus]
 gb|KGN55053.1| hypothetical protein Csa_4G625570 [Cucumis sativus]
Length=476

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGICIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEK+
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKS  468



>ref|XP_010062836.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Eucalyptus grandis]
 gb|KCW69967.1| hypothetical protein EUGRSUZ_F03282 [Eucalyptus grandis]
Length=476

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKEL+RYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELSRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_008225231.1| PREDICTED: protein transport protein Sec61 subunit alpha [Prunus 
mume]
Length=476

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGLCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFET+EKEK 
Sbjct  436  VADLMGAIGSGTGILLAVTIIYQYFETYEKEKV  468



>ref|XP_010691598.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Beta vulgaris subsp. vulgaris]
Length=475

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQ MVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQGMVMPGHRDSNLQKELNRYIPTAAAFGGICIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_010686250.1| PREDICTED: protein transport protein Sec61 subunit alpha [Beta 
vulgaris subsp. vulgaris]
Length=475

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQ MVMPGHRDSN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQGMVMPGHRDSNLQKELNRYIPTAAAFGGICIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>gb|KJB12997.1| hypothetical protein B456_002G050300 [Gossypium raimondii]
 gb|KJB12998.1| hypothetical protein B456_002G050300 [Gossypium raimondii]
 gb|KJB13000.1| hypothetical protein B456_002G050300 [Gossypium raimondii]
 gb|KJB13001.1| hypothetical protein B456_002G050300 [Gossypium raimondii]
Length=476

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQL+EQQMVMPGHR+ + QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLREQQMVMPGHREGSLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  436  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  468



>gb|EMS47738.1| Protein transport protein Sec61 subunit alpha [Triticum urartu]
Length=594

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  494  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  553

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  554  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  586



>ref|XP_001782197.1| predicted protein [Physcomitrella patens]
 gb|EDQ53020.1| predicted protein [Physcomitrella patens]
Length=477

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQM MPGHR+SN Q+ELNRYIPTAAAFGGMCIGALTV
Sbjct  377  LFSKTWIEVSGSSARDVAKQLKEQQMFMPGHRESNLQRELNRYIPTAAAFGGMCIGALTV  436

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETF+KE+A
Sbjct  437  VADFMGAIGSGTGILLAVTIIYQYFETFDKERA  469



>ref|XP_009626265.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Nicotiana tomentosiformis]
 ref|XP_009626266.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Nicotiana tomentosiformis]
Length=475

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN  KELNRYIPTAAAFGG+CIG LTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLYKELNRYIPTAAAFGGVCIGLLTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_009769708.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Nicotiana sylvestris]
Length=475

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN  KELNRYIPTAAAFGG+CIG LTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLYKELNRYIPTAAAFGGVCIGLLTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_006360036.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006360037.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
isoform X2 [Solanum tuberosum]
Length=475

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN  KELNRYIPTAAAFGG+CIG LTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLYKELNRYIPTAAAFGGVCIGLLTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_010059389.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Eucalyptus grandis]
Length=293

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVA+QL EQQMVMPGHR+SN QKELN YIPTAAAFGGMCIGALTV
Sbjct  194  LFSKTWIEVSGSSAKDVARQLTEQQMVMPGHRESNLQKELNCYIPTAAAFGGMCIGALTV  253

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             A+ MGAIGSGTGILLAVTIIYQYF+TFEKEKA
Sbjct  254  LANFMGAIGSGTGILLAVTIIYQYFDTFEKEKA  286



>ref|XP_004248236.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Solanum lycopersicum]
 ref|XP_010327112.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Solanum lycopersicum]
Length=475

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN  KELNRYIPTAAAFGG+CIG LTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLYKELNRYIPTAAAFGGVCIGLLTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>gb|KHG05744.1| Protein transport Sec61 subunit alpha [Gossypium arboreum]
Length=458

 Score =   175 bits (443),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 83/93 (89%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQL+EQQMVMPGHR+ + QKELNRYIPTAAAFGGMCIGALTV
Sbjct  358  LFSKTWIEVSGSSARDVAKQLREQQMVMPGHREGSLQKELNRYIPTAAAFGGMCIGALTV  417

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD+MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  418  LADLMGAIGSGTGILLAVTIIYQYFETFEKEKA  450



>gb|AAM65038.1| putative protein transport protein SEC61 alpha subunit [Arabidopsis 
thaliana]
Length=475

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DV+KQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVSKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD M AIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMRAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_001769421.1| predicted protein [Physcomitrella patens]
 gb|EDQ65790.1| predicted protein [Physcomitrella patens]
Length=477

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQM MPGHR+SN Q+ELNRYIPTAAAFGG+CIGALTV
Sbjct  377  LFSKTWIEVSGSSARDVAKQLKEQQMFMPGHRESNLQRELNRYIPTAAAFGGICIGALTV  436

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETF+KE+A
Sbjct  437  VADFMGAIGSGTGILLAVTIIYQYFETFDKERA  469



>ref|XP_002983331.1| hypothetical protein SELMODRAFT_180018 [Selaginella moellendorffii]
 gb|EFJ15673.1| hypothetical protein SELMODRAFT_180018 [Selaginella moellendorffii]
Length=477

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQL+EQQMVMPGHR++N Q+ELNRYIPTAAAFGG+CIGALTV
Sbjct  377  LFSKTWIEVSGSSARDVAKQLREQQMVMPGHREANLQRELNRYIPTAAAFGGICIGALTV  436

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETF+KE+A
Sbjct  437  VADFMGAIGSGTGILLAVTIIYQYFETFDKERA  469



>ref|XP_002987618.1| hypothetical protein SELMODRAFT_271933 [Selaginella moellendorffii]
 gb|EFJ11193.1| hypothetical protein SELMODRAFT_271933 [Selaginella moellendorffii]
Length=477

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQL+EQQMVMPGHR++N Q+ELNRYIPTAAAFGG+CIGALTV
Sbjct  377  LFSKTWIEVSGSSARDVAKQLREQQMVMPGHREANLQRELNRYIPTAAAFGGICIGALTV  436

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETF+KE+A
Sbjct  437  VADFMGAIGSGTGILLAVTIIYQYFETFDKERA  469



>ref|XP_008367174.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha-like [Malus domestica]
Length=393

 Score =   173 bits (438),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 86/93 (92%), Gaps = 1/93 (1%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQL EQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  292  LFSKTWIEVSGSSTRDVAKQLNEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  351

Query  277  XADMMGAIGSGTGILLAVTIIYQYFET-FEKEK  182
             AD MGAIGSGTGILLAVT+IYQYFET +EKEK
Sbjct  352  LADFMGAIGSGTGILLAVTVIYQYFETYYEKEK  384



>ref|XP_010106618.1| Protein transport protein Sec61 subunit alpha [Morus notabilis]
 gb|EXC10948.1| Protein transport protein Sec61 subunit alpha [Morus notabilis]
Length=458

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFS+TW EVSGSS +DVAKQLKEQQ+VMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  357  LFSRTWIEVSGSSARDVAKQLKEQQLVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTV  416

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQ FE +EKE+A
Sbjct  417  LADFMGAIGSGTGILLAVTIIYQLFEAYEKERA  449



>gb|AAF80449.1|AF161718_1 Sec61p [Triticum aestivum]
Length=475

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQLKEQQMVMPGHR+SN QKELN+YIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVAKQLKEQQMVMPGHRESNLQKELNKYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLA +IIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLADSIIYQYFETFEKERA  467



>gb|EMS53662.1| Protein transport protein Sec61 subunit alpha [Triticum urartu]
Length=475

 Score =   173 bits (438),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 81/93 (87%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVA+QLKEQQMVMPGHR+SN ++ELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVARQLKEQQMVMPGHRESNLERELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_007021907.1| SecY protein transport family protein [Theobroma cacao]
 gb|EOY13432.1| SecY protein transport family protein [Theobroma cacao]
Length=476

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSK W EVSGSS +DVAKQL+EQQMVMPGHR+++ QKELNRYIPTAAAFGGMCIGALTV
Sbjct  376  LFSKAWIEVSGSSARDVAKQLREQQMVMPGHREASLQKELNRYIPTAAAFGGMCIGALTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFE FEKEKA
Sbjct  436  LADCMGAIGSGTGILLAVTIIYQYFEIFEKEKA  468



>ref|XP_010537719.1| PREDICTED: protein transport protein Sec61 subunit alpha [Tarenaya 
hassleriana]
Length=475

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVA+QL+EQQMVM GHRDSN Q++LN +IPTAAAFGGMCIGALTV
Sbjct  375  LFSKTWIEVSGSSAKDVARQLREQQMVMQGHRDSNHQQQLNPFIPTAAAFGGMCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>gb|AAK94784.1| Sec61 alpha subunit [Hordeum vulgare]
Length=475

 Score =   170 bits (431),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 80/93 (86%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVA+QLKEQQMVMPGHR+SN ++ELNRYIPTAAA GG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVARQLKEQQMVMPGHRESNLERELNRYIPTAAAIGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_008351223.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha-like [Malus domestica]
Length=188

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = -3

Query  448  KTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTVXAD  269
            KTW  VSGSS +DVAKQL EQQMVMPGHRDSN QKELNRYIPTAAAFGGMCIGALTV AD
Sbjct  90   KTWIXVSGSSTRDVAKQLNEQQMVMPGHRDSNLQKELNRYIPTAAAFGGMCIGALTVLAD  149

Query  268  MMGAIGSGTGILLAVTIIYQYFET-FEKEK  182
             MGAIGSGTGILLAVT+IYQYFET +EKEK
Sbjct  150  FMGAIGSGTGILLAVTVIYQYFETIYEKEK  179



>gb|EMT30970.1| Protein transport protein Sec61 subunit alpha [Aegilops tauschii]
Length=498

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 88/106 (83%), Gaps = 13/106 (12%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLK-------------EQQMVMPGHRDSNXQKELNRYIPTA  317
            LFSKTW EVSGSS KDVAKQLK             EQQMVMPGHR+SN QKELNRYIPTA
Sbjct  385  LFSKTWIEVSGSSAKDVAKQLKDVYNIQPDVGAPAEQQMVMPGHRESNLQKELNRYIPTA  444

Query  316  AAFGGMCIGALTVXADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
            AAFGG+CIGALTV AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  445  AAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERA  490



>ref|XP_010228980.1| PREDICTED: protein transport protein Sec61 subunit alpha-like 
[Brachypodium distachyon]
Length=475

 Score =   169 bits (428),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVA+QL+EQQMVMPGHR+++ ++ELNRYIPTAAAFGG+CIGALTV
Sbjct  375  LFSKTWIEVSGSSARDVARQLREQQMVMPGHREASLERELNRYIPTAAAFGGVCIGALTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKEKA
Sbjct  435  LADFMGAIGSGTGILLAVTIIYQYFETFEKEKA  467



>ref|XP_002504986.1| type II secretory pathway family [Micromonas sp. RCC299]
 gb|ACO66244.1| type II secretory pathway family [Micromonas sp. RCC299]
Length=475

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLK+QQM M GHR+S+ QKELNRYIPTAAAFGGMCIG LTV
Sbjct  375  LFSKTWIEVSGSSARDVAKQLKQQQMFMVGHRESSLQKELNRYIPTAAAFGGMCIGMLTV  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  VADFMGAIGSGTGILLAVTIIYQYFETFEKERA  467



>ref|XP_003060622.1| type II secretory pathway family protein [Micromonas pusilla 
CCMP1545]
 gb|EEH55391.1| type II secretory pathway family protein [Micromonas pusilla 
CCMP1545]
Length=476

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLK+QQM M GHR+S+ Q+ELNRYIPTAAAFGGMCIG LTV
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKQQQMFMVGHRESSLQRELNRYIPTAAAFGGMCIGFLTV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  VADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>ref|XP_007515006.1| protein transport protein SEC61 alpha subunit [Bathycoccus prasinos]
 emb|CCO15246.1| protein transport protein SEC61 alpha subunit [Bathycoccus prasinos]
Length=476

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLK+QQM M GHR+S+ Q+ELNRYIPTAAAFGGMCIG LT+
Sbjct  376  LFSKTWIEVSGSSARDVAKQLKQQQMFMTGHRESSLQRELNRYIPTAAAFGGMCIGMLTI  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  436  IADFMGAIGSGTGILLAVTIIYQYFETFEKERA  468



>dbj|BAG51324.1| unnamed protein product [Homo sapiens]
 dbj|BAG51326.1| unnamed protein product [Homo sapiens]
Length=109

 Score =   157 bits (397),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHR+++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  7    FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSV  66

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE++
Sbjct  67   LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQS  99



>dbj|BAA91692.1| unnamed protein product [Homo sapiens]
 dbj|BAB13955.1| unnamed protein product [Homo sapiens]
Length=234

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  132  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  191

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  192  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  224



>ref|XP_002191019.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2-like, partial [Taeniopygia guttata]
 ref|XP_010011221.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Nestor notabilis]
 gb|KFQ48027.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Nestor notabilis]
Length=217

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  115  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  174

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  175  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  207



>gb|KFU99452.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Tauraco erythrolophus]
Length=218

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  116  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  175

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  176  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  208



>ref|XP_005081337.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Mesocricetus auratus]
Length=198

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  96   FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  155

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  156  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  188



>ref|XP_009975976.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Tauraco erythrolophus]
Length=239

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  137  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  196

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  197  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  229



>ref|XP_009973150.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Tyto alba]
Length=270

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  168  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  227

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  228  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  260



>gb|KFV60865.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Tyto alba]
Length=271

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  169  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  228

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  229  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  261



>gb|ETN72576.1| hypothetical protein NECAME_18785 [Necator americanus]
Length=109

 Score =   155 bits (391),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW +VSGSS KDVAKQLKEQQMVM GHR+ +   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  7    FFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSV  66

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD MGAIGSGTGILLAVTIIYQYFE F KE+
Sbjct  67   TADFMGAIGSGTGILLAVTIIYQYFEIFVKEQ  98



>ref|XP_006497580.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X3 [Mus musculus]
Length=277

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  175  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  234

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  235  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  267



>dbj|BAM17983.1| sec61alpha [Papilio xuthus]
Length=234

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW +VSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  132  FFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHRDNSMIHELNRYIPTAAAFGGLCIGALSV  191

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  192  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  224



>gb|KIY91973.1| Protein transport protein Sec61 subunit alpha [Monoraphidium 
neglectum]
 gb|KIY95486.1| Protein transport protein Sec61 subunit alpha [Monoraphidium 
neglectum]
Length=174

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 84/95 (88%), Gaps = 2/95 (2%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRD--SNXQKELNRYIPTAAAFGGMCIGAL  284
            LFSKTW EVSGSS  DVAKQLKEQQM + GHRD  S+ +KELNRYIP AAAFGGMCIGAL
Sbjct  72   LFSKTWIEVSGSSASDVAKQLKEQQMFIQGHRDTQSSLKKELNRYIPVAAAFGGMCIGAL  131

Query  283  TVXADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
            T+ AD+MGAIGSGTGILLAVTIIYQY+E++EKE A
Sbjct  132  TIAADLMGAIGSGTGILLAVTIIYQYYESYEKEVA  166



>ref|XP_004036299.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
1-like [Gorilla gorilla gorilla]
 dbj|BAC11283.1| unnamed protein product [Homo sapiens]
 dbj|BAC11434.1| unnamed protein product [Homo sapiens]
 dbj|BAG50960.1| unnamed protein product [Homo sapiens]
 dbj|BAG51323.1| unnamed protein product [Homo sapiens]
Length=170

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHR+++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  68   FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSV  127

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE++
Sbjct  128  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQS  160



>ref|XP_008466992.1| PREDICTED: protein transport protein Sec61 subunit alpha-like, 
partial [Cucumis melo]
Length=260

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS +DVAKQLKEQQMVMPGHR+SN QKELNRYIPTAAAFGGMCIGALTV
Sbjct  179  LFSKTWIEVSGSSARDVAKQLKEQQMVMPGHRESNLQKELNRYIPTAAAFGGMCIGALTV  238

Query  277  XADMMGAIGSGTGILLAVTIIY  212
             AD MGAIGSGTGILLAVTIIY
Sbjct  239  LADFMGAIGSGTGILLAVTIIY  260



>ref|XP_007430199.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Python bivittatus]
Length=322

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  220  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  279

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  280  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  312



>emb|CAD38592.1| hypothetical protein [Homo sapiens]
Length=215

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHR+++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  113  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSV  172

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE++
Sbjct  173  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQS  205



>ref|XP_006497579.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Mus musculus]
Length=327

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  225  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  284

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  285  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  317



>gb|KFP25983.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Colius striatus]
Length=323

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  221  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  280

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  281  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  313



>ref|XP_010201370.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Colius striatus]
Length=328

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  226  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  285

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  286  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  318



>ref|XP_001421497.1| IISP family transporter: protein transport protein Sec61 alpha 
subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99790.1| IISP family transporter: protein transport protein Sec61 alpha 
subunit [Ostreococcus lucimarinus CCE9901]
Length=476

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EV+GSS +DVAKQLK+QQM++ GHRD   +KELNRYIP AAAFGGMCIGALT+
Sbjct  375  LFSKTWIEVAGSSARDVAKQLKQQQMIIKGHRDVKIEKELNRYIPIAAAFGGMCIGALTI  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD  GAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  VADFFGAIGSGTGILLAVTIIYQYFETFEKERA  467



>gb|EDL78657.1| Sec61, alpha subunit 2 (S. cerevisiae) (predicted) [Rattus norvegicus]
Length=330

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  228  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  287

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  288  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  320



>emb|CAH92375.1| hypothetical protein [Pongo abelii]
Length=253

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHR+++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  151  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSV  210

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE++
Sbjct  211  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQS  243



>ref|XP_005778706.1| hypothetical protein EMIHUDRAFT_457349 [Emiliania huxleyi CCMP1516]
 gb|EOD26277.1| hypothetical protein EMIHUDRAFT_457349 [Emiliania huxleyi CCMP1516]
Length=480

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW EVSGSS KDVAKQL++QQMVM GHRDS+  KELNRYIPTAAAFGGMCIGALTV
Sbjct  379  LFSKTWIEVSGSSAKDVAKQLRDQQMVMKGHRDSSLAKELNRYIPTAAAFGGMCIGALTV  438

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD MGAIGSGTGILLAVT IYQYFE F KE 
Sbjct  439  AADFMGAIGSGTGILLAVTTIYQYFEMFVKEN  470



>gb|EYU28118.1| hypothetical protein MIMGU_mgv1a022627mg [Erythranthe guttata]
Length=466

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            + S  W EVSGSS KD+AKQLKEQQMVMPGHRDS  +KELNRYIPTAAA GG+CIGALTV
Sbjct  373  MLSNLWMEVSGSSAKDIAKQLKEQQMVMPGHRDSTLEKELNRYIPTAAALGGLCIGALTV  432

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD  GAIGSGTGILLAVT I+QYFETFEKEKA
Sbjct  433  LADSTGAIGSGTGILLAVTTIFQYFETFEKEKA  465



>ref|XP_008502487.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
1-like, partial [Calypte anna]
Length=270

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHR+++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  168  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSV  227

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE++
Sbjct  228  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQS  260



>ref|XP_004468929.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 4 [Dasypus novemcinctus]
Length=356

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  254  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  313

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  314  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  346



>emb|CEG01808.1| Translocon Sec61/SecY, plug domain [Ostreococcus tauri]
Length=476

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW E++GSS +DVAKQLK+QQM++ GHRD   +KELNRYIP AAAFGGMCIGALT+
Sbjct  375  LFSKTWIEIAGSSARDVAKQLKQQQMIIRGHRDIKIEKELNRYIPIAAAFGGMCIGALTI  434

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD  GAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  435  VADFFGAIGSGTGILLAVTIIYQYFETFEKERA  467



>gb|KFO95185.1| Protein transport protein Sec61 subunit alpha isoform 1, partial 
[Calypte anna]
Length=272

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHR+++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  170  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSV  229

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE++
Sbjct  230  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQS  262



>gb|KIH61672.1| hypothetical protein ANCDUO_08051 [Ancylostoma duodenale]
Length=168

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW +VSGSS KDVAKQLKEQQMVM GHR+ +   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  66   FFSKTWIDVSGSSAKDVAKQLKEQQMVMRGHREKSMIHELNRYIPTAAAFGGLCIGALSV  125

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD MGAIGSGTGILLAVTIIYQYFE F KE+
Sbjct  126  TADFMGAIGSGTGILLAVTIIYQYFEIFVKEQ  157



>gb|ACH85336.1| Sec61 alpha form A-like [Salmo salar]
Length=170

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHR+++   ELNRYIPTAAAFGG+CIG L+V
Sbjct  68   FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGGLSV  127

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE++
Sbjct  128  MADFLGAIGSGTGILLAVTIIYQYFEIFVKEQS  160



>ref|XP_003083352.1| putative Sec61 alpha form 2 [Oryza sativa (ISS) [Ostreococcus 
tauri]
Length=486

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW E++GSS +DVAKQLK+QQM++ GHRD   +KELNRYIP AAAFGGMCIGALT+
Sbjct  385  LFSKTWIEIAGSSARDVAKQLKQQQMIIRGHRDIKIEKELNRYIPIAAAFGGMCIGALTI  444

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD  GAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  445  VADFFGAIGSGTGILLAVTIIYQYFETFEKERA  477



>ref|XP_009814266.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha isoform 2-like, partial [Gavia stellata]
Length=405

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  303  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  362

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  363  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  395



>ref|XP_009694583.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha isoform 2, partial [Cariama cristata]
Length=409

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  307  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  366

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  367  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  399



>gb|KFK30162.1| hypothetical protein AALP_AA7G225200 [Arabis alpina]
Length=433

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW E+SGSS KDVAKQLKEQQ+VMPGHR+SN +KELNRYI T+AAFGGMCIGALTV
Sbjct  333  FFSKTWIEISGSSAKDVAKQLKEQQLVMPGHRESNLEKELNRYIGTSAAFGGMCIGALTV  392

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD+MGAIGSGTGILLAV+ IYQ FE F+KEK
Sbjct  393  LADLMGAIGSGTGILLAVSTIYQCFEAFDKEK  424



>ref|XP_006497578.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X1 [Mus musculus]
Length=388

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  286  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  345

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  346  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  378



>gb|EGV95426.1| Protein transport protein Sec61 subunit alpha isoform 2 [Cricetulus 
griseus]
Length=400

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  298  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  357

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  358  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  390



>ref|XP_006254319.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X1 [Rattus norvegicus]
Length=388

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  286  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  345

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  346  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  378



>ref|XP_010579287.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X8 [Haliaeetus leucocephalus]
Length=400

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  298  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  357

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  358  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  390



>gb|KFZ65743.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Podiceps cristatus]
Length=401

 Score =   160 bits (404),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  299  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  358

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  359  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  391



>gb|KFV56848.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Gavia stellata]
Length=396

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  294  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  353

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  354  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  386



>ref|XP_005658390.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2-like [Sus scrofa]
Length=380

 Score =   159 bits (402),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  278  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  337

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  338  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  370



>ref|XP_007129360.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X1 [Physeter catodon]
Length=417

 Score =   160 bits (404),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  315  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  374

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  375  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  407



>ref|XP_006077807.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Bubalus bubalis]
 ref|XP_010852397.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Bison bison bison]
 ref|XP_011357921.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X3 [Pteropus vampyrus]
Length=417

 Score =   160 bits (404),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  315  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  374

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  375  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  407



>ref|XP_009514960.1| hypothetical protein PHYSODRAFT_284123 [Phytophthora sojae]
 gb|EGZ27685.1| hypothetical protein PHYSODRAFT_284123 [Phytophthora sojae]
Length=400

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW E+SGSS +DVAKQL++QQMVM GHRDS+    LNRYIPTAAAFGGMCIGAL++
Sbjct  298  LFSKTWIEISGSSARDVAKQLRDQQMVMKGHRDSSIVHVLNRYIPTAAAFGGMCIGALSM  357

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD++GAIGSGTGILLAVTIIYQYFETF +E+A
Sbjct  358  VADLLGAIGSGTGILLAVTIIYQYFETFAREQA  390



>gb|EFA85179.1| protein transport protein SEC61 alpha subunit [Polysphondylium 
pallidum PN500]
Length=473

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSK W EVSGSS +DVAKQL++QQM M GHRDS+  KELNRYIPTAAAFGG+CIGALTV
Sbjct  372  LFSKVWIEVSGSSARDVAKQLRDQQMTMKGHRDSSLVKELNRYIPTAAAFGGLCIGALTV  431

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD MGAIGSGTGILLAVTIIYQYFETF KE+
Sbjct  432  IADFMGAIGSGTGILLAVTIIYQYFETFVKEQ  463



>ref|XP_647801.1| protein transport protein SEC61 alpha subunit [Dictyostelium 
discoideum AX4]
 sp|Q54XK2.1|SC61A_DICDI RecName: Full=Protein transport protein Sec61 subunit alpha; 
AltName: Full=Secretory 61 complex subunit alpha [Dictyostelium 
discoideum]
 gb|EAL68044.1| protein transport protein SEC61 alpha subunit [Dictyostelium 
discoideum AX4]
Length=475

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSK W EVSGSS +DVAKQLK+QQM M GHRD++  KELNRYIPTAAAFGG+CIGALTV
Sbjct  373  LFSKVWIEVSGSSARDVAKQLKDQQMTMKGHRDTSVIKELNRYIPTAAAFGGLCIGALTV  432

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD MGAIGSGTGILLAVTIIYQYFETF KE+
Sbjct  433  VADFMGAIGSGTGILLAVTIIYQYFETFVKEQ  464



>ref|XP_005668256.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Sus scrofa]
Length=417

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  315  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  374

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  375  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  407



>gb|KGL78327.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Tinamus guttatus]
Length=440

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  338  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  397

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  398  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  430



>ref|XP_002946971.1| hypothetical protein VOLCADRAFT_72975 [Volvox carteri f. nagariensis]
 gb|EFJ52197.1| hypothetical protein VOLCADRAFT_72975 [Volvox carteri f. nagariensis]
Length=476

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 2/95 (2%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDS--NXQKELNRYIPTAAAFGGMCIGAL  284
            LFSKTW EVSGSS  DVAKQLKEQQM + GHRD+  + +KELNRYIP AAAFGGMCIGAL
Sbjct  375  LFSKTWIEVSGSSASDVAKQLKEQQMFIQGHRDTTASLKKELNRYIPIAAAFGGMCIGAL  434

Query  283  TVXADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
            T+ AD MGAIGSGTGILLAVTIIYQYFET+EKEKA
Sbjct  435  TIVADFMGAIGSGTGILLAVTIIYQYFETYEKEKA  469



>ref|XP_006873227.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Chrysochloris asiatica]
Length=423

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  321  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  380

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  381  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  413



>gb|KFO34545.1| Protein transport protein Sec61 subunit alpha isoform 2 [Fukomys 
damarensis]
Length=423

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  321  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  380

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  381  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  413



>ref|XP_004320478.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 2 [Tursiops truncatus]
 ref|XP_004605379.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X1 [Sorex araneus]
 ref|XP_004605380.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Sorex araneus]
 ref|XP_005617198.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X3 [Canis lupus familiaris]
 ref|XP_006174251.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X1 [Camelus ferus]
 ref|XP_006174252.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Camelus ferus]
 ref|XP_006208916.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X1 [Vicugna pacos]
 ref|XP_006208917.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Vicugna pacos]
 ref|XP_006891902.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Elephantulus edwardii]
 ref|XP_007129361.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Physeter catodon]
 ref|XP_007167476.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Balaenoptera acutorostrata scammoni]
 ref|XP_007524683.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Erinaceus europaeus]
 ref|XP_007524684.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Erinaceus europaeus]
 ref|XP_007933621.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Orycteropus afer afer]
 ref|XP_007933622.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Orycteropus afer afer]
 ref|XP_008571258.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Galeopterus variegatus]
 ref|XP_008951398.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Pan paniscus]
 ref|XP_011230513.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Ailuropoda melanoleuca]
Length=423

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  321  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  380

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  381  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  413



>ref|XP_010339473.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Saimiri boliviensis boliviensis]
Length=423

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  321  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  380

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  381  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  413



>ref|XP_004351549.1| transport protein Sec61 alpha subunit, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR22772.1| transport protein Sec61 alpha subunit, putative [Acanthamoeba 
castellanii str. Neff]
Length=462

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSKTW +VSGSS KDVAKQL++QQM+M GHRDS+  KELNRYIPTAAAFGG+CIGAL+V
Sbjct  363  LFSKTWIDVSGSSAKDVAKQLRDQQMIMKGHRDSSLVKELNRYIPTAAAFGGLCIGALSV  422

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD MGAIGSGTGILLAVTIIYQYFE F KE+
Sbjct  423  LADFMGAIGSGTGILLAVTIIYQYFEIFVKEQ  454



>ref|XP_010579286.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X7 [Haliaeetus leucocephalus]
Length=423

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  321  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  380

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  381  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  413



>gb|EFB21345.1| hypothetical protein PANDA_014644 [Ailuropoda melanoleuca]
Length=429

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  327  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  386

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  387  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  419



>ref|XP_005993900.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Latimeria chalumnae]
Length=410

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  308  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  367

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  368  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  400



>gb|EPQ14139.1| Protein transport protein Sec61 subunit alpha isoform 2 [Myotis 
brandtii]
Length=431

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  329  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  388

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  389  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  421



>ref|XP_009966212.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
1, partial [Tyto alba]
 gb|KFV52245.1| Protein transport protein Sec61 subunit alpha isoform 1, partial 
[Tyto alba]
Length=322

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHR+++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  220  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLCIGALSV  279

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE++
Sbjct  280  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQS  312



>ref|XP_011357922.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X4 [Pteropus vampyrus]
Length=413

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  311  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  370

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  371  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  403



>gb|EDL07972.1| Sec61, alpha subunit 2 (S. cerevisiae), isoform CRA_a [Mus musculus]
Length=413

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  311  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  370

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  371  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  403



>ref|XP_004355758.1| protein transport protein SEC61 alpha subunit [Dictyostelium 
fasciculatum]
 gb|EGG17274.1| protein transport protein SEC61 alpha subunit [Dictyostelium 
fasciculatum]
Length=474

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
            LFSK W EVSGSS +DVAKQL++QQM M GHRDS+  KELNRYIPTAAAFGG+CIGALTV
Sbjct  373  LFSKVWIEVSGSSARDVAKQLRDQQMTMKGHRDSSLVKELNRYIPTAAAFGGLCIGALTV  432

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEK  182
             AD MGAIGSGTGILLAVTIIYQYFETF KE+
Sbjct  433  IADFMGAIGSGTGILLAVTIIYQYFETFVKEQ  464



>ref|XP_004468928.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 3 [Dasypus novemcinctus]
 ref|XP_005320331.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X3 [Ictidomys tridecemlineatus]
 ref|XP_007647982.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Cricetulus griseus]
 dbj|BAB30840.1| unnamed protein product [Mus musculus]
Length=410

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  308  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  367

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  368  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  400



>ref|XP_001703311.1| SEC61-alpha subunit of ER-translocon [Chlamydomonas reinhardtii]
 gb|EDP05993.1| SEC61-alpha subunit of ER-translocon [Chlamydomonas reinhardtii]
Length=476

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 84/95 (88%), Gaps = 2/95 (2%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDS--NXQKELNRYIPTAAAFGGMCIGAL  284
            LFSKTW EVSGSS  DVAKQLKEQQM + GHRD+  + +KELNRYIP AAAFGGMCIGAL
Sbjct  375  LFSKTWIEVSGSSASDVAKQLKEQQMFIQGHRDTTASLKKELNRYIPIAAAFGGMCIGAL  434

Query  283  TVXADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
            T+ AD MGAIGSGTGILLAVTIIYQYFET+EKEKA
Sbjct  435  TIVADFMGAIGSGTGILLAVTIIYQYFETYEKEKA  469



>ref|XP_005646491.1| SecY protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21947.1| SecY protein [Coccomyxa subellipsoidea C-169]
Length=472

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 84/95 (88%), Gaps = 2/95 (2%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDS--NXQKELNRYIPTAAAFGGMCIGAL  284
            LFSKTW EVSGSS  DVAKQL+EQQM + GHRD+  + +KELNRYIPTAAAFGGMCIGAL
Sbjct  372  LFSKTWIEVSGSSANDVAKQLREQQMFLQGHRDTVQSLKKELNRYIPTAAAFGGMCIGAL  431

Query  283  TVXADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
            T+ AD MGAIGSGTGILLAVTIIYQYFE +EKEKA
Sbjct  432  TIVADFMGAIGSGTGILLAVTIIYQYFEAYEKEKA  466



>ref|XP_010579284.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X6 [Haliaeetus leucocephalus]
 ref|XP_010579285.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X6 [Haliaeetus leucocephalus]
Length=455

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  353  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  412

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  413  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  445



>gb|KFP46467.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Cathartes aura]
Length=451

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  349  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  408

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  409  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  441



>ref|XP_008062954.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Tarsius syrichta]
Length=441

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  339  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  398

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  399  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  431



>gb|EMT33101.1| Protein transport protein Sec61 subunit alpha [Aegilops tauschii]
Length=510

 Score =   160 bits (405),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 81/116 (70%), Positives = 88/116 (76%), Gaps = 23/116 (20%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLK-----------------------EQQMVMPGHRDSNXQ  347
            LFSKTW EVSGSS +DVA+QLK                       EQQMVMPGHR+SN +
Sbjct  387  LFSKTWIEVSGSSARDVARQLKLVLHMNSHYARATRNLLTLATEQEQQMVMPGHRESNLE  446

Query  346  KELNRYIPTAAAFGGMCIGALTVXADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
            +ELNRYIPTAAAFGG+CIGALTV AD MGAIGSGTGILLAVTIIYQYFETFEKE+A
Sbjct  447  RELNRYIPTAAAFGGVCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERA  502



>ref|XP_009647739.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Egretta garzetta]
Length=466

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  364  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  423

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  424  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  456



>gb|KFW65558.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Pygoscelis adeliae]
Length=478

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  376  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  436  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  468



>dbj|BAG63284.1| unnamed protein product [Homo sapiens]
Length=454

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  352  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  411

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  412  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  444



>gb|ELR53988.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Bos mutus]
Length=468

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  366  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  425

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  426  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  458



>ref|XP_004774968.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Mustela putorius furo]
Length=461

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  359  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  418

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  419  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  451



>gb|KFV85490.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Struthio camelus australis]
Length=460

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  358  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  417

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  418  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  450



>ref|XP_010579282.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X5 [Haliaeetus leucocephalus]
 ref|XP_010579283.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X5 [Haliaeetus leucocephalus]
Length=459

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  357  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  416

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  417  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  449



>gb|KFP11647.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Egretta garzetta]
Length=469

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  367  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  426

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  427  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  459



>ref|XP_009941891.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha isoform 2 [Opisthocomus hoazin]
Length=458

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  356  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  415

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  416  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  448



>ref|XP_006117154.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X3 [Pelodiscus sinensis]
Length=456

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  354  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  413

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  414  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  446



>ref|XP_007056612.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Chelonia mydas]
Length=454

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  352  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  411

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  412  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  444



>ref|XP_009881313.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha isoform 2, partial [Charadrius vociferus]
Length=469

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  367  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  426

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  427  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  459



>gb|KFO12476.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Balearica regulorum gibbericeps]
Length=469

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  367  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  426

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  427  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  459



>ref|XP_005143386.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Melopsittacus undulatus]
 ref|XP_005489327.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Zonotrichia albicollis]
 ref|XP_005526112.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Pseudopodoces humilis]
 ref|XP_009085145.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Serinus canaria]
Length=454

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  352  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  411

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  412  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  444



>gb|KFR17832.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Opisthocomus hoazin]
Length=478

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  376  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  435

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  436  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  468



>ref|XP_005398134.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Chinchilla lanigera]
Length=454

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  352  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  411

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  412  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  444



>ref|XP_006022205.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha isoform 2 [Alligator sinensis]
Length=474

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  372  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  431

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  432  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  464



>ref|XP_009465560.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Nipponia nippon]
Length=454

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  352  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  411

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  412  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  444



>ref|XP_005617197.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Canis lupus familiaris]
Length=464

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  362  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  421

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  422  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  454



>ref|NP_001136100.1| protein transport protein Sec61 subunit alpha isoform 2 isoform 
b [Homo sapiens]
 ref|XP_003257715.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 4 [Nomascus leucogenys]
 ref|XP_004049108.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004275909.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 2 [Orcinus orca]
 ref|XP_004379743.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 2 [Trichechus manatus latirostris]
 ref|XP_004409186.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 2 [Odobenus rosmarus divergens]
 ref|XP_004468927.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 2 [Dasypus novemcinctus]
 ref|XP_004578521.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Ochotona princeps]
 ref|XP_004691306.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Condylura cristata]
 ref|XP_005320330.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X2 [Ictidomys tridecemlineatus]
 ref|XP_007452641.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform X3 [Lipotes vexillifer]
Length=454

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  352  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  411

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  412  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  444



>ref|XP_004425423.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 isoform 2 [Ceratotherium simum simum]
Length=454

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  352  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  411

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  412  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  444



>ref|XP_009509420.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Phalacrocorax carbo]
Length=486

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  384  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  443

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  444  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  476



>ref|XP_005899188.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Bos mutus]
Length=512

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  410  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  469

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  470  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  502



>ref|XP_008941687.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha isoform 2, partial [Merops nubicus]
Length=475

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  373  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  432

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  433  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  465



>ref|XP_006270929.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Alligator mississippiensis]
Length=473

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  371  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  430

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  431  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  463



>ref|XP_010172339.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha isoform 2, partial [Caprimulgus carolinensis]
Length=470

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  368  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  427

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  428  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  460



>ref|XP_010283319.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Phaethon lepturus]
Length=473

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  371  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  430

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  431  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  463



>ref|XP_010075911.1| PREDICTED: LOW QUALITY PROTEIN: protein transport protein Sec61 
subunit alpha isoform 2, partial [Pterocles gutturalis]
Length=481

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  379  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  438

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  439  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  471



>gb|KFV94819.1| Protein transport protein Sec61 subunit alpha isoform 2, partial 
[Fulmarus glacialis]
Length=481

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  379  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  438

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  439  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  471



>ref|XP_005426353.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2 [Geospiza fortis]
Length=479

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  377  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  436

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  437  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  469



>ref|XP_009320047.1| PREDICTED: protein transport protein Sec61 subunit alpha isoform 
2, partial [Pygoscelis adeliae]
Length=475

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  457  LFSKTWXEVSGSSXKDVAKQLKEQQMVMPGHRDSNXQKELNRYIPTAAAFGGMCIGALTV  278
             FSKTW EVSGSS KDVAKQLKEQQMVM GHRD++   ELNRYIPTAAAFGG+CIGAL+V
Sbjct  373  FFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSV  432

Query  277  XADMMGAIGSGTGILLAVTIIYQYFETFEKEKA  179
             AD +GAIGSGTGILLAVTIIYQYFE F KE+A
Sbjct  433  LADFLGAIGSGTGILLAVTIIYQYFEIFVKEQA  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563956788320