BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF022D11

Length=773
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625539.1|  PREDICTED: uncharacterized protein LOC104116...    331   2e-106   
ref|XP_009625540.1|  PREDICTED: uncharacterized protein LOC104116...    331   2e-106   
ref|XP_009763752.1|  PREDICTED: uncharacterized protein LOC104215...    330   5e-106   Nicotiana sylvestris
ref|XP_009617895.1|  PREDICTED: uncharacterized protein LOC104110...    324   1e-103   Nicotiana tomentosiformis
ref|XP_009625535.1|  PREDICTED: uncharacterized protein LOC104116...    330   2e-103   
ref|XP_009625534.1|  PREDICTED: uncharacterized protein LOC104116...    330   2e-103   
ref|XP_009625531.1|  PREDICTED: uncharacterized protein LOC104116...    330   3e-103   Nicotiana tomentosiformis
ref|XP_009625533.1|  PREDICTED: uncharacterized protein LOC104116...    330   4e-103   Nicotiana tomentosiformis
ref|XP_009763750.1|  PREDICTED: uncharacterized protein LOC104215...    329   1e-102   Nicotiana sylvestris
ref|XP_006354448.1|  PREDICTED: uncharacterized protein LOC102604983    328   3e-102   Solanum tuberosum [potatoes]
ref|XP_004247758.1|  PREDICTED: uncharacterized protein LOC101260476    326   1e-101   Solanum lycopersicum
ref|XP_009617893.1|  PREDICTED: uncharacterized protein LOC104110...    323   1e-100   Nicotiana tomentosiformis
ref|XP_009617891.1|  PREDICTED: uncharacterized protein LOC104110...    322   1e-100   Nicotiana tomentosiformis
ref|XP_009617889.1|  PREDICTED: uncharacterized protein LOC104110...    323   2e-100   Nicotiana tomentosiformis
ref|XP_004173387.1|  PREDICTED: probable fatty acid methyltransfe...    306   3e-100   
ref|XP_009780643.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    313   7e-100   Nicotiana sylvestris
gb|EYU32577.1|  hypothetical protein MIMGU_mgv1a001185mg                322   1e-99    Erythranthe guttata [common monkey flower]
ref|XP_006606356.1|  PREDICTED: uncharacterized protein LOC100815...    312   3e-99    Glycine max [soybeans]
ref|XP_010650131.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    312   4e-99    Vitis vinifera
ref|XP_011073567.1|  PREDICTED: uncharacterized protein LOC105158...    318   6e-99    
ref|XP_008460676.1|  PREDICTED: pavine N-methyltransferase-like i...    311   6e-99    Cucumis melo [Oriental melon]
ref|XP_006589308.1|  PREDICTED: uncharacterized protein LOC100801...    311   1e-98    
ref|XP_004296397.1|  PREDICTED: uncharacterized protein LOC101309817    318   2e-98    Fragaria vesca subsp. vesca
ref|XP_011073566.1|  PREDICTED: uncharacterized protein LOC105158...    318   2e-98    Sesamum indicum [beniseed]
ref|XP_007227011.1|  hypothetical protein PRUPE_ppa001275mg             318   2e-98    Prunus persica
ref|XP_011029775.1|  PREDICTED: uncharacterized protein LOC105129...    308   1e-97    Populus euphratica
ref|XP_007144121.1|  hypothetical protein PHAVU_007G1305000g            311   2e-97    Phaseolus vulgaris [French bean]
ref|XP_010650129.1|  PREDICTED: uncharacterized protein LOC100249...    311   2e-97    
ref|XP_009357997.1|  PREDICTED: uncharacterized protein LOC103948...    314   5e-97    Pyrus x bretschneideri [bai li]
gb|KHN01041.1|  Putative fatty acid methyltransferase                   313   5e-97    Glycine soja [wild soybean]
emb|CBI23694.3|  unnamed protein product                                314   6e-97    Vitis vinifera
ref|XP_010650134.1|  PREDICTED: uncharacterized protein LOC100242...    314   7e-97    
ref|XP_009358001.1|  PREDICTED: uncharacterized protein LOC103948...    314   7e-97    Pyrus x bretschneideri [bai li]
ref|XP_010650133.1|  PREDICTED: uncharacterized protein LOC100242...    314   7e-97    
ref|XP_010650132.1|  PREDICTED: uncharacterized protein LOC100242...    314   7e-97    
ref|XP_010670963.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    303   9e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008340641.1|  PREDICTED: uncharacterized protein LOC103403...    306   9e-97    
ref|XP_010527410.1|  PREDICTED: uncharacterized protein LOC104804765    313   1e-96    Tarenaya hassleriana [spider flower]
ref|XP_002311690.2|  cyclopropane-fatty-acyl-phospholipid synthas...    313   2e-96    
ref|XP_006606354.1|  PREDICTED: uncharacterized protein LOC100815...    312   2e-96    Glycine max [soybeans]
ref|XP_008224158.1|  PREDICTED: uncharacterized protein LOC103323...    313   2e-96    Prunus mume [ume]
ref|XP_008224157.1|  PREDICTED: uncharacterized protein LOC103323...    313   2e-96    Prunus mume [ume]
ref|XP_010264927.1|  PREDICTED: uncharacterized protein LOC104602...    310   3e-96    Nelumbo nucifera [Indian lotus]
gb|KHN30725.1|  Putative fatty acid methyltransferase                   311   3e-96    Glycine soja [wild soybean]
ref|XP_008460674.1|  PREDICTED: uncharacterized protein LOC103499...    312   4e-96    Cucumis melo [Oriental melon]
ref|XP_006296683.1|  hypothetical protein CARUB_v10012958mg             311   6e-96    Capsella rubella
emb|CDO99279.1|  unnamed protein product                                311   7e-96    Coffea canephora [robusta coffee]
ref|XP_002281958.1|  PREDICTED: uncharacterized protein LOC100249...    311   8e-96    Vitis vinifera
ref|XP_006421140.1|  hypothetical protein CICLE_v10004346mg             310   9e-96    
emb|CDY67345.1|  BnaCnng54600D                                          300   9e-96    Brassica napus [oilseed rape]
ref|XP_011013987.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    300   9e-96    Populus euphratica
ref|XP_010264925.1|  PREDICTED: uncharacterized protein LOC104602...    311   1e-95    Nelumbo nucifera [Indian lotus]
ref|XP_011029773.1|  PREDICTED: uncharacterized protein LOC105129...    308   1e-95    Populus euphratica
emb|CBI23697.3|  unnamed protein product                                311   1e-95    Vitis vinifera
ref|XP_006589307.1|  PREDICTED: uncharacterized protein LOC100801...    310   1e-95    Glycine max [soybeans]
ref|XP_002883433.1|  hypothetical protein ARALYDRAFT_898865             310   2e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_009586640.1|  PREDICTED: uncharacterized protein LOC104084...    310   2e-95    Nicotiana tomentosiformis
ref|XP_011470583.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-tetrahyd...    299   2e-95    Fragaria vesca subsp. vesca
ref|XP_011041421.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    298   2e-95    Populus euphratica
gb|KGN61577.1|  hypothetical protein Csa_2G172470                       290   5e-95    Cucumis sativus [cucumbers]
emb|CDY09021.1|  BnaC01g30700D                                          308   6e-95    Brassica napus [oilseed rape]
ref|XP_010466687.1|  PREDICTED: uncharacterized protein LOC104746847    309   6e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010490069.1|  PREDICTED: uncharacterized protein LOC104767788    308   8e-95    
ref|XP_006493505.1|  PREDICTED: uncharacterized protein LOC102615...    308   1e-94    Citrus sinensis [apfelsine]
ref|XP_011029770.1|  PREDICTED: uncharacterized protein LOC105129...    308   1e-94    Populus euphratica
ref|XP_011029772.1|  PREDICTED: uncharacterized protein LOC105129...    308   1e-94    Populus euphratica
ref|XP_010109738.1|  Cyclopropane-fatty-acyl-phospholipid synthase      287   1e-94    
emb|CDX85109.1|  BnaC07g07970D                                          308   1e-94    
gb|KGN61573.1|  hypothetical protein Csa_2G171940                       308   2e-94    Cucumis sativus [cucumbers]
emb|CDX77504.1|  BnaA07g06420D                                          308   2e-94    
ref|XP_010512500.1|  PREDICTED: uncharacterized protein LOC104788...    306   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010512493.1|  PREDICTED: uncharacterized protein LOC104788...    307   4e-94    Camelina sativa [gold-of-pleasure]
gb|EPS65744.1|  cyclopropane fatty acid synthase                        300   4e-94    Genlisea aurea
dbj|BAB02771.1|  mycolic acid methyl transferase-like protein           306   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414043.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    292   4e-94    
ref|NP_188995.2|  Cyclopropane-fatty-acyl-phospholipid synthase         306   4e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CAN68017.1|  hypothetical protein VITISV_025151                     306   4e-94    Vitis vinifera
gb|AAL57657.1|  AT3g23510/MEE5_5                                        306   4e-94    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44154.1|  unnamed protein product                                306   5e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102618.1|  PREDICTED: uncharacterized protein LOC103828...    300   6e-94    Brassica rapa
ref|XP_008340636.1|  PREDICTED: uncharacterized protein LOC103403...    306   7e-94    
ref|XP_009102608.1|  PREDICTED: uncharacterized protein LOC103828731    306   9e-94    Brassica rapa
gb|KEH42686.1|  cyclopropane-fatty-acyl-phospholipid synthase           305   1e-93    Medicago truncatula
ref|XP_010670960.1|  PREDICTED: uncharacterized protein LOC104887...    302   2e-93    
gb|KDP40373.1|  hypothetical protein JCGZ_02371                         305   2e-93    Jatropha curcas
ref|XP_010317817.1|  PREDICTED: uncharacterized protein LOC101256...    303   2e-93    Solanum lycopersicum
dbj|BAB01742.1|  unnamed protein product                                303   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406021.1|  hypothetical protein EUTSA_v10020039mg             304   4e-93    Eutrema salsugineum [saltwater cress]
ref|XP_010488415.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    293   5e-93    Camelina sativa [gold-of-pleasure]
ref|XP_004234691.1|  PREDICTED: uncharacterized protein LOC101256...    304   5e-93    Solanum lycopersicum
ref|XP_002314493.2|  cyclopropane-fatty-acyl-phospholipid synthas...    303   7e-93    
ref|XP_007035209.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    303   9e-93    Theobroma cacao [chocolate]
emb|CDX92987.1|  BnaA03g37090D                                          303   1e-92    
ref|XP_009135859.1|  PREDICTED: uncharacterized protein LOC103860003    303   1e-92    Brassica rapa
ref|XP_011470580.1|  PREDICTED: sterol 24-C-methyltransferase-like      286   1e-92    Fragaria vesca subsp. vesca
ref|XP_010670961.1|  PREDICTED: uncharacterized protein LOC104887...    302   2e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_188993.2|  cyclopropane-fatty-acyl-phospholipid synthase         302   2e-92    Arabidopsis thaliana [mouse-ear cress]
emb|CDX77513.1|  BnaA07g06510D                                          300   2e-92    
ref|XP_002528810.1|  methyltransferase, putative                        302   2e-92    Ricinus communis
ref|XP_006354535.1|  PREDICTED: pavine N-methyltransferase-like         291   2e-92    Solanum tuberosum [potatoes]
ref|XP_006406026.1|  hypothetical protein EUTSA_v10020049mg             302   2e-92    
ref|XP_002314494.2|  hypothetical protein POPTR_0010s07840g             291   2e-92    
ref|XP_011030435.1|  PREDICTED: uncharacterized protein LOC105129...    301   3e-92    Populus euphratica
ref|XP_011030438.1|  PREDICTED: uncharacterized protein LOC105129...    301   4e-92    Populus euphratica
emb|CDX94854.1|  BnaC03g43340D                                          301   4e-92    
gb|KGN61575.1|  hypothetical protein Csa_2G171960                       284   9e-92    Cucumis sativus [cucumbers]
ref|XP_004169418.1|  PREDICTED: cyclopropane-fatty-acyl-phospholi...    293   1e-91    
ref|XP_009102616.1|  PREDICTED: uncharacterized protein LOC103828...    300   1e-91    Brassica rapa
ref|XP_002528379.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    287   1e-91    
ref|XP_009388106.1|  PREDICTED: uncharacterized protein LOC103974927    285   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004495453.1|  PREDICTED: uncharacterized protein LOC101501999    299   2e-91    
ref|XP_010023868.1|  PREDICTED: uncharacterized protein LOC104414445    298   5e-91    Eucalyptus grandis [rose gum]
ref|XP_004173332.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    283   8e-91    
gb|KDO40332.1|  hypothetical protein CISIN_1g0240962mg                  281   1e-90    Citrus sinensis [apfelsine]
emb|CDX77514.1|  BnaA07g06520D                                          296   1e-90    
gb|AAT74602.1|  cyclopropane fatty acid synthase                        297   1e-90    Gossypium hirsutum [American cotton]
gb|KJB28514.1|  hypothetical protein B456_005G052900                    297   2e-90    Gossypium raimondii
gb|KCW60259.1|  hypothetical protein EUGRSUZ_H029682                    286   2e-90    Eucalyptus grandis [rose gum]
ref|XP_008796359.1|  PREDICTED: uncharacterized protein LOC103711...    290   2e-90    
gb|KJB38366.1|  hypothetical protein B456_006G251800                    295   2e-90    Gossypium raimondii
gb|KHG28468.1|  putative fatty acid methyltransferase                   295   3e-90    Gossypium arboreum [tree cotton]
gb|KJB38367.1|  hypothetical protein B456_006G251800                    296   4e-90    Gossypium raimondii
gb|KHG28467.1|  putative fatty acid methyltransferase                   295   5e-90    Gossypium arboreum [tree cotton]
ref|XP_010023867.1|  PREDICTED: uncharacterized protein LOC104414444    296   5e-90    Eucalyptus grandis [rose gum]
ref|XP_009102765.1|  PREDICTED: uncharacterized protein LOC103828879    296   5e-90    
ref|XP_002314497.2|  hypothetical protein POPTR_0010s07830g             286   6e-90    
gb|KDO54091.1|  hypothetical protein CISIN_1g0146251mg                  283   1e-89    Citrus sinensis [apfelsine]
ref|XP_010529627.1|  PREDICTED: uncharacterized protein LOC104806...    295   1e-89    Tarenaya hassleriana [spider flower]
gb|KFK39641.1|  hypothetical protein AALP_AA3G270000                    284   1e-89    Arabis alpina [alpine rockcress]
ref|XP_008796357.1|  PREDICTED: uncharacterized protein LOC103711...    289   5e-89    
ref|XP_009586644.1|  PREDICTED: uncharacterized protein LOC104084...    290   6e-89    Nicotiana tomentosiformis
ref|XP_006857466.1|  hypothetical protein AMTR_s00067p00185740          293   6e-89    
ref|XP_008796358.1|  PREDICTED: uncharacterized protein LOC103711...    289   6e-89    Phoenix dactylifera
ref|NP_188989.2|  cyclopropane-fatty-acyl-phospholipid synthase         283   8e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004247760.1|  PREDICTED: uncharacterized protein LOC101261068    281   2e-88    Solanum lycopersicum
ref|XP_006299255.1|  hypothetical protein CARUB_v10015414mg             280   2e-88    
ref|XP_009586642.1|  PREDICTED: uncharacterized protein LOC104084...    291   3e-88    Nicotiana tomentosiformis
ref|XP_009586641.1|  PREDICTED: uncharacterized protein LOC104084...    291   3e-88    Nicotiana tomentosiformis
ref|XP_006489667.1|  PREDICTED: uncharacterized protein LOC102613...    285   3e-88    
ref|XP_002314496.2|  hypothetical protein POPTR_0010s07820g             281   4e-88    
ref|XP_008796356.1|  PREDICTED: uncharacterized protein LOC103711...    289   8e-88    
ref|XP_006378321.1|  hypothetical protein POPTR_0010s07800g             280   1e-87    
ref|XP_008796355.1|  PREDICTED: uncharacterized protein LOC103711...    289   1e-87    Phoenix dactylifera
ref|XP_008796354.1|  PREDICTED: uncharacterized protein LOC103711...    289   1e-87    
ref|XP_004169247.1|  PREDICTED: uncharacterized protein LOC101225338    288   2e-87    
ref|XP_006489666.1|  PREDICTED: uncharacterized protein LOC102613...    284   3e-87    Citrus sinensis [apfelsine]
ref|XP_007035221.1|  Cyclopropane-fatty-acyl-phospholipid synthase      288   3e-87    
ref|XP_010532684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    276   5e-87    Tarenaya hassleriana [spider flower]
ref|XP_011041574.1|  PREDICTED: uncharacterized protein LOC105137508    283   7e-87    Populus euphratica
ref|XP_006350407.1|  PREDICTED: uncharacterized protein LOC102579...    287   8e-87    Solanum tuberosum [potatoes]
ref|XP_010532680.1|  PREDICTED: uncharacterized protein LOC104808649    287   8e-87    Tarenaya hassleriana [spider flower]
ref|XP_010532681.1|  PREDICTED: uncharacterized protein LOC104808651    287   9e-87    Tarenaya hassleriana [spider flower]
ref|XP_006489664.1|  PREDICTED: uncharacterized protein LOC102612...    283   1e-86    Citrus sinensis [apfelsine]
gb|KCW60262.1|  hypothetical protein EUGRSUZ_H02971                     285   1e-86    Eucalyptus grandis [rose gum]
ref|XP_010532682.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    276   2e-86    Tarenaya hassleriana [spider flower]
ref|XP_010023866.1|  PREDICTED: uncharacterized protein LOC104414443    286   3e-86    Eucalyptus grandis [rose gum]
ref|XP_010532685.1|  PREDICTED: uncharacterized protein LOC104808...    285   7e-86    Tarenaya hassleriana [spider flower]
ref|XP_010936015.1|  PREDICTED: uncharacterized protein LOC105055...    281   8e-86    Elaeis guineensis
gb|KGN61574.1|  hypothetical protein Csa_2G171950                       284   1e-85    Cucumis sativus [cucumbers]
ref|XP_006489663.1|  PREDICTED: uncharacterized protein LOC102612...    283   1e-85    
ref|XP_006489662.1|  PREDICTED: uncharacterized protein LOC102612...    283   3e-85    Citrus sinensis [apfelsine]
ref|NP_001189954.1|  Cyclopropane-fatty-acyl-phospholipid synthase      272   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936014.1|  PREDICTED: uncharacterized protein LOC105055...    281   2e-84    Elaeis guineensis
ref|XP_002531842.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    281   2e-84    
ref|XP_006406025.1|  hypothetical protein EUTSA_v10020040mg             280   6e-84    
ref|XP_004307322.2|  PREDICTED: uncharacterized protein LOC101300392    260   6e-84    Fragaria vesca subsp. vesca
gb|AES60365.2|  cyclopropane-fatty-acyl-phospholipid synthase           278   9e-84    Medicago truncatula
emb|CDY18120.1|  BnaA01g23810D                                          269   1e-83    Brassica napus [oilseed rape]
ref|XP_007035220.1|  Cyclopropane fatty acid synthase                   266   1e-83    
ref|XP_009107970.1|  PREDICTED: uncharacterized protein LOC103833648    269   2e-83    Brassica rapa
ref|XP_010026810.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    277   3e-83    
ref|XP_002460494.1|  hypothetical protein SORBIDRAFT_02g029350          267   1e-82    
ref|XP_009758040.1|  PREDICTED: uncharacterized protein LOC104210742    258   5e-82    Nicotiana sylvestris
ref|XP_010532683.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    264   6e-82    Tarenaya hassleriana [spider flower]
dbj|BAJ91247.1|  predicted protein                                      260   7e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006420311.1|  hypothetical protein CICLE_v10005727mg             257   1e-81    
ref|XP_007035218.1|  Cyclopropane fatty acid synthase isoform 2         262   2e-81    
ref|XP_007035217.1|  Cyclopropane fatty acid synthase isoform 1         262   3e-81    
ref|XP_010670959.1|  PREDICTED: uncharacterized protein LOC104887...    271   6e-81    Beta vulgaris subsp. vulgaris [field beet]
gb|KDO50392.1|  hypothetical protein CISIN_1g0358701mg                  270   1e-80    Citrus sinensis [apfelsine]
ref|XP_010466684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    260   2e-80    
ref|XP_006420313.1|  hypothetical protein CICLE_v10005536mg             256   2e-80    
ref|NP_001059618.1|  Os07g0474600                                       258   2e-80    
gb|ABG37642.1|  cyclopropane fatty acid synthase                        275   3e-80    Populus trichocarpa [western balsam poplar]
ref|XP_006420314.1|  hypothetical protein CICLE_v10007034mg             268   6e-80    
ref|XP_010466683.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    259   8e-80    
ref|XP_010466685.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    258   9e-80    Camelina sativa [gold-of-pleasure]
ref|XP_011030437.1|  PREDICTED: uncharacterized protein LOC105129...    268   1e-79    Populus euphratica
ref|XP_003590114.1|  Cyclopropane fatty acid synthase                   267   1e-79    
ref|XP_002883432.1|  predicted protein                                  254   2e-79    
ref|XP_004147184.1|  PREDICTED: uncharacterized protein LOC101213850    270   9e-79    
gb|EMS55075.1|  Cyclopropane-fatty-acyl-phospholipid synthase           265   1e-78    Triticum urartu
ref|XP_006489661.1|  PREDICTED: uncharacterized protein LOC102611924    265   1e-78    Citrus sinensis [apfelsine]
ref|XP_006658552.1|  PREDICTED: uncharacterized protein LOC102715408    263   2e-78    
ref|XP_008667917.1|  PREDICTED: cyclopropane fatty acid synthase ...    263   3e-78    
ref|XP_010670925.1|  PREDICTED: uncharacterized protein LOC104887...    263   3e-78    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001147782.1|  cyclopropane fatty acid synthase                   264   5e-78    Zea mays [maize]
ref|XP_002467653.1|  hypothetical protein SORBIDRAFT_01g031685          260   5e-78    
ref|XP_010670924.1|  PREDICTED: uncharacterized protein LOC104887...    263   8e-78    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ95828.1|  predicted protein                                      261   9e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001066537.1|  Os12g0267200                                       262   9e-78    
ref|XP_004296401.1|  PREDICTED: uncharacterized protein LOC101310979    253   2e-77    Fragaria vesca subsp. vesca
ref|XP_007035215.1|  Cyclopropane fatty acid synthase                   263   2e-77    
gb|EEE67149.1|  hypothetical protein OsJ_24210                          259   4e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957293.1|  PREDICTED: uncharacterized protein LOC101772901    261   4e-77    Setaria italica
dbj|BAJ93367.1|  predicted protein                                      261   4e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB01740.1|  cyclopocyclopropane fatty acid synthase-like pro...    250   1e-76    Arabidopsis thaliana [mouse-ear cress]
ref|NP_188990.4|  Cyclopropane-fatty-acyl-phospholipid synthase         250   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011091266.1|  PREDICTED: uncharacterized protein LOC105171...    258   3e-76    Sesamum indicum [beniseed]
ref|XP_011091265.1|  PREDICTED: uncharacterized protein LOC105171...    258   4e-76    Sesamum indicum [beniseed]
ref|XP_010239672.1|  PREDICTED: uncharacterized protein LOC100842...    258   4e-76    
ref|XP_006350427.1|  PREDICTED: uncharacterized protein LOC102587606    251   4e-76    
gb|EEC82010.1|  hypothetical protein OsI_25960                          258   5e-76    Oryza sativa Indica Group [Indian rice]
ref|XP_003581006.1|  PREDICTED: uncharacterized protein LOC100842...    258   7e-76    Brachypodium distachyon [annual false brome]
gb|EEC78767.1|  hypothetical protein OsI_18995                          261   8e-76    Oryza sativa Indica Group [Indian rice]
gb|EEE62857.1|  hypothetical protein OsJ_17660                          255   2e-75    Oryza sativa Japonica Group [Japonica rice]
gb|KDO54095.1|  hypothetical protein CISIN_1g038410mg                   255   6e-75    Citrus sinensis [apfelsine]
ref|XP_006489756.1|  PREDICTED: uncharacterized protein LOC102615557    255   6e-75    
gb|EMT03310.1|  Cyclopropane-fatty-acyl-phospholipid synthase           253   3e-74    
ref|XP_007035240.1|  Cyclopropane fatty acid synthase                   245   3e-74    
ref|XP_011091264.1|  PREDICTED: uncharacterized protein LOC105171751    253   5e-74    Sesamum indicum [beniseed]
ref|XP_006664478.1|  PREDICTED: uncharacterized protein LOC102701601    248   3e-72    Oryza brachyantha
gb|AAM33848.1|AF470622_1  cyclopropane synthase                         247   5e-72    Sterculia foetida
gb|EMS56688.1|  Cyclopropane-fatty-acyl-phospholipid synthase           241   5e-71    Triticum urartu
ref|XP_010670965.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    236   6e-71    Beta vulgaris subsp. vulgaris [field beet]
gb|EPS70161.1|  hypothetical protein M569_04599                         243   1e-70    Genlisea aurea
dbj|BAJ86532.1|  predicted protein                                      227   8e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG13738.1|  Cyclopropane-fatty-acyl-phospholipid synthase           238   4e-69    Gossypium arboreum [tree cotton]
ref|XP_002964119.1|  hypothetical protein SELMODRAFT_166747             238   1e-68    Selaginella moellendorffii
gb|KJB12590.1|  hypothetical protein B456_002G025800                    237   3e-68    Gossypium raimondii
gb|AAT74601.1|  cyclopropane fatty acid synthase                        237   3e-68    Gossypium hirsutum [American cotton]
gb|KJB12595.1|  hypothetical protein B456_002G026100                    237   3e-68    Gossypium raimondii
gb|AAT74600.1|  cyclopropane fatty acid synthase                        236   8e-68    Gossypium hirsutum [American cotton]
dbj|BAK04927.1|  predicted protein                                      218   8e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006406023.1|  hypothetical protein EUTSA_v10022172mg             226   9e-68    
ref|XP_001769171.1|  predicted protein                                  233   5e-67    
gb|KJB70811.1|  hypothetical protein B456_011G092100                    233   9e-67    Gossypium raimondii
ref|XP_002862681.1|  hypothetical protein ARALYDRAFT_359447             213   5e-65    
gb|EMS47377.1|  Cyclopropane-fatty-acyl-phospholipid synthase           224   7e-65    Triticum urartu
gb|EMT01203.1|  Cyclopropane-fatty-acyl-phospholipid synthase           210   5e-64    
emb|CDY09025.1|  BnaC01g30660D                                          207   7e-64    Brassica napus [oilseed rape]
ref|XP_004956057.1|  PREDICTED: uncharacterized protein LOC101762...    224   1e-63    Setaria italica
ref|XP_004956056.1|  PREDICTED: uncharacterized protein LOC101762...    224   2e-63    
ref|XP_004972625.1|  PREDICTED: uncharacterized protein LOC101764920    223   2e-63    Setaria italica
gb|KDO54094.1|  hypothetical protein CISIN_1g048309mg                   211   6e-63    Citrus sinensis [apfelsine]
dbj|BAK05892.1|  predicted protein                                      222   6e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05129.1|  predicted protein                                      222   6e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007035214.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    222   8e-63    
gb|AFW60130.1|  hypothetical protein ZEAMMB73_361545                    214   9e-63    
gb|EMS47376.1|  Cyclopropane-fatty-acyl-phospholipid synthase           219   1e-62    Triticum urartu
ref|XP_008664677.1|  PREDICTED: uncharacterized protein LOC103643...    217   3e-61    Zea mays [maize]
ref|XP_008664676.1|  PREDICTED: uncharacterized protein LOC103643...    217   4e-61    Zea mays [maize]
ref|XP_002451281.1|  hypothetical protein SORBIDRAFT_05g026900          217   5e-61    Sorghum bicolor [broomcorn]
ref|XP_002528378.1|  cyclopropane-fatty-acyl-phospholipid synthas...    216   6e-61    
gb|EMS64510.1|  Cyclopropane-fatty-acyl-phospholipid synthase           214   2e-60    Triticum urartu
ref|XP_008677860.1|  PREDICTED: uncharacterized protein LOC103652...    214   3e-60    Zea mays [maize]
gb|EMT06798.1|  Cyclopropane-fatty-acyl-phospholipid synthase           214   4e-60    
emb|CDX85102.1|  BnaC07g08040D                                          199   1e-59    
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase           211   2e-58    Triticum urartu
gb|KJB28509.1|  hypothetical protein B456_005G052800                    202   2e-58    Gossypium raimondii
gb|KJB28512.1|  hypothetical protein B456_005G052900                    206   2e-57    Gossypium raimondii
ref|XP_002451282.1|  hypothetical protein SORBIDRAFT_05g026910          202   3e-56    
gb|KJB70810.1|  hypothetical protein B456_011G092100                    202   5e-56    Gossypium raimondii
ref|XP_004147183.1|  PREDICTED: uncharacterized protein LOC101213610    193   1e-52    
gb|EYU18296.1|  hypothetical protein MIMGU_mgv1a024671mg                192   2e-52    Erythranthe guttata [common monkey flower]
ref|XP_010532686.1|  PREDICTED: uncharacterized protein LOC104808...    190   2e-51    Tarenaya hassleriana [spider flower]
ref|XP_005717868.1|  unnamed protein product                            185   2e-51    Chondrus crispus [carageen]
emb|CDY54629.1|  BnaCnng27480D                                          176   2e-50    Brassica napus [oilseed rape]
gb|KDO54097.1|  hypothetical protein CISIN_1g0029283mg                  184   1e-49    Citrus sinensis [apfelsine]
dbj|GAM27526.1|  hypothetical protein SAMD00019534_107020               175   2e-47    Acytostelium subglobosum LB1
ref|XP_005537745.1|  probable mycolic acid methyl transferase           174   1e-45    Cyanidioschyzon merolae strain 10D
ref|XP_009586643.1|  PREDICTED: uncharacterized protein LOC104084...    159   2e-45    Nicotiana tomentosiformis
gb|EMS68326.1|  Cyclopropane-fatty-acyl-phospholipid synthase           167   4e-45    Triticum urartu
ref|WP_017221214.1|  hypothetical protein                               167   5e-45    Moritella dasanensis
gb|EFA79547.1|  cyclopropane fatty acid synthase                        167   5e-45    Heterostelium album PN500
ref|WP_028577058.1|  cyclopropane-fatty-acyl-phospholipid synthase      170   7e-45    Desulfomicrobium escambiense
ref|WP_019440999.1|  hypothetical protein                               167   8e-45    Moritella marina
ref|WP_012012891.1|  cyclopropane-fatty-acyl-phospholipid synthase      166   1e-44    Arcobacter butzleri
ref|WP_003182274.1|  cyclopropane-fatty-acyl-phospholipid synthase      166   2e-44    Pseudomonas fluorescens
ref|WP_028630133.1|  cyclopropane-fatty-acyl-phospholipid synthase      166   2e-44    
ref|WP_011758933.1|  cyclopropane-fatty-acyl-phospholipid synthase      166   2e-44    
dbj|BAC83502.1|  putative cyclopropane synthase                         169   2e-44    
ref|WP_038097960.1|  cyclopropane-fatty-acyl-phospholipid synthase      164   4e-44    
ref|WP_010151137.1|  cyclopropane-fatty-acyl-phospholipid synthase      165   5e-44    
ref|WP_008223526.1|  cyclopropane-fatty-acyl-phospholipid synthase      164   8e-44    
ref|WP_030138826.1|  cyclopropane-fatty-acyl-phospholipid synthase      164   8e-44    
ref|WP_042145087.1|  cyclopropane-fatty-acyl-phospholipid synthase      164   9e-44    
ref|WP_036537494.1|  cyclopropane-fatty-acyl-phospholipid synthase      163   1e-43    
ref|WP_010384712.1|  cyclopropane-fatty-acyl-phospholipid synthase      164   1e-43    
ref|WP_043771147.1|  hypothetical protein                               163   1e-43    
ref|XP_004356254.1|  cyclopropane fatty acid synthase                   164   2e-43    
ref|WP_016545452.1|  cyclopropane-fatty-acyl-phospholipid synthase      163   2e-43    
ref|WP_039591068.1|  cyclopropane-fatty-acyl-phospholipid synthase      163   2e-43    
ref|WP_025258609.1|  cyclopropane-fatty-acyl-phospholipid synthase      163   2e-43    
ref|WP_027697442.1|  cyclopropane-fatty-acyl-phospholipid synthase      163   2e-43    
ref|WP_008107386.1|  cyclopropane-fatty-acyl-phospholipid synthase      162   2e-43    
ref|WP_032829569.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    163   3e-43    
ref|WP_024775005.1|  cyclopropane-fatty-acyl-phospholipid synthase      162   3e-43    
ref|WP_032830102.1|  cyclopropane-fatty-acyl-phospholipid synthase      162   3e-43    
gb|EKO15287.1|  cyclopropane-fatty-acyl-phospholipid synthase           163   3e-43    
ref|WP_008293215.1|  cyclopropane-fatty-acyl-phospholipid synthase      162   3e-43    
gb|EMJ93734.1|  cyclopropane-fatty-acyl-phospholipid synthase           163   3e-43    
ref|WP_009836691.1|  cyclopropane-fatty-acyl-phospholipid synthase      162   3e-43    
ref|XP_008677861.1|  PREDICTED: uncharacterized protein LOC103652...    166   4e-43    
ref|WP_015774604.1|  cyclopropane-fatty-acyl-phospholipid synthase      165   4e-43    
ref|WP_040415201.1|  cyclopropane-fatty-acyl-phospholipid synthase      162   5e-43    
ref|WP_008588835.1|  cyclopropane-fatty-acyl-phospholipid synthase      162   5e-43    
dbj|GAK56531.1|  cyclopropane-fatty-acyl-phospholipid synthase          162   6e-43    
ref|WP_009024070.1|  cyclopropane-fatty-acyl-phospholipid synthase      161   7e-43    
gb|EPR40260.1|  Cyclopropane-fatty-acyl-phospholipid synthase           162   7e-43    
ref|WP_007641361.1|  cyclopropane-fatty-acyl-phospholipid synthase      161   7e-43    
ref|WP_009575288.1|  cyclopropane-fatty-acyl-phospholipid synthase      161   8e-43    
ref|WP_027331136.1|  cyclopropane-fatty-acyl-phospholipid synthase      161   8e-43    
ref|WP_020414996.1|  hypothetical protein                               161   9e-43    
ref|WP_026107288.1|  cyclopropane-fatty-acyl-phospholipid synthase      161   1e-42    
gb|ERB64848.1|  hypothetical protein N779_13070                         156   1e-42    
gb|ADW18290.1|  Cyclopropane-fatty-acyl-phospholipid synthase           163   1e-42    
ref|WP_008610474.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   2e-42    
ref|WP_007236107.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   2e-42    
ref|WP_015487921.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   2e-42    
ref|WP_002997644.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   2e-42    
ref|WP_005993583.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   2e-42    
ref|WP_039423507.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   2e-42    
ref|WP_008983445.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   2e-42    
ref|WP_041585800.1|  hypothetical protein                               157   3e-42    
ref|XP_006676884.1|  hypothetical protein BATDEDRAFT_86144              160   3e-42    
ref|WP_008952004.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   3e-42    
ref|WP_028761302.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   3e-42    
ref|WP_008898188.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   3e-42    
ref|WP_041479999.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   3e-42    
ref|WP_006082541.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   3e-42    
gb|KDO40251.1|  hypothetical protein CISIN_1g042963mg                   153   4e-42    
ref|WP_029221686.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   4e-42    
ref|WP_013135425.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   5e-42    
emb|CEL43918.1|  Putative cyclopropane-fatty-acyl-phospholipid sy...    155   5e-42    
ref|WP_035517956.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   5e-42    
ref|WP_040372386.1|  hypothetical protein                               162   5e-42    
ref|WP_022973428.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   5e-42    
ref|WP_017011088.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   5e-42    
ref|WP_016903512.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   6e-42    
ref|WP_024940524.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   6e-42    
ref|WP_039514269.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   7e-42    
gb|EWH09403.1|  cyclopropane-fatty-acyl-phospholipid synthase           159   7e-42    
ref|WP_006451778.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   7e-42    
ref|WP_035015231.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   7e-42    
ref|WP_041149642.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   8e-42    
ref|WP_043298452.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   8e-42    
ref|WP_040352724.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   9e-42    
ref|WP_040151432.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   9e-42    
ref|WP_037046900.1|  cyclopropane-fatty-acyl-phospholipid synthase      159   9e-42    
gb|ABC78887.1|  cyclopropane-fatty-acyl-phospholipid synthase           157   1e-41    
ref|WP_011919691.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_012089763.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_028773824.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
gb|EAQ78945.1|  cyclopropane-fatty-acyl-phospholipid synthase           158   1e-41    
ref|WP_016773216.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_012587152.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_017171442.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   1e-41    
gb|EPJ77588.1|  cyclopropane-fatty-acyl-phospholipid synthase           157   1e-41    
ref|WP_027671132.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_007951699.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_020770137.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_028573790.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   1e-41    
ref|WP_042609708.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_007646211.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_024014288.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   1e-41    
ref|WP_011847383.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   2e-41    
ref|WP_003456705.1|  SAM dependent methyltransferase, cyclopropan...    158   2e-41    
ref|WP_038858777.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_017163033.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   2e-41    
ref|WP_008025867.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    157   2e-41    
ref|WP_003479409.1|  cyclopropane-fatty-acyl-phospholipid synthase      158   2e-41    
ref|WP_013693276.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    157   2e-41    
ref|WP_039011882.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_043008625.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_038510630.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_028237012.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_003201531.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    157   2e-41    
ref|WP_043042257.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_014339200.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_039574900.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_011788652.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_019408878.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_006962791.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_038155939.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_014611029.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_019275710.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_013659680.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_033062920.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   2e-41    
ref|WP_003208420.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    157   3e-41    
ref|WP_002814454.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_016551412.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_017168650.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|XP_003289116.1|  hypothetical protein DICPUDRAFT_48369              157   3e-41    
gb|KGK59141.1|  cyclopropane-fatty-acyl-phospholipid synthase           157   3e-41    
ref|WP_017160022.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_017155651.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_016493425.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
dbj|BAP41523.1|  cyclopropane-fatty-acyl-phospholipid synthase          157   3e-41    
ref|WP_010409431.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_039433432.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_010366079.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_011073246.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_039442644.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_039766323.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_011408294.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_011258655.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   3e-41    
ref|WP_014503964.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_021701492.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
gb|EPE84491.1|  cyclopropane-fatty-acyl-phospholipid synthase           152   4e-41    
ref|WP_023903310.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_017475993.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_004406950.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|XP_002294769.1|  predicted protein                                  161   4e-41    
gb|KDO39428.1|  hypothetical protein CISIN_1g047022mg                   156   4e-41    
ref|WP_013031406.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_003485448.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_037337739.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   4e-41    
ref|WP_003415046.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_024744102.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_024665589.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_004419129.1|  Cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_024652616.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_003408647.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_017277944.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_003421694.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_024691823.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_011266739.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_037420850.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    157   4e-41    
ref|WP_044311961.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_016567259.1|  Cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
ref|WP_032658908.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   4e-41    
gb|EGH32293.1|  cyclopropane-fatty-acyl-phospholipid synthase           157   4e-41    
ref|WP_024682685.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
ref|WP_010342347.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
ref|WP_016987210.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
gb|EGH44451.1|  cyclopropane-fatty-acyl-phospholipid synthase           157   5e-41    
ref|WP_019676732.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   5e-41    
ref|WP_003365609.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
ref|WP_007967668.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
ref|WP_005924870.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
ref|WP_003433715.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
ref|WP_016781761.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
gb|EGH75650.1|  cyclopropane-fatty-acyl-phospholipid synthase           156   5e-41    
ref|WP_038639059.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
ref|WP_010428686.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   5e-41    
ref|WP_010568252.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
ref|WP_009835536.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   5e-41    
ref|WP_017529903.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   5e-41    
gb|EPM75350.1|  cyclopropane-fatty-acyl-phospholipid synthase           155   5e-41    
ref|WP_028380038.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   5e-41    
ref|WP_029148983.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   5e-41    
ref|WP_010572522.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   6e-41    
ref|WP_032615929.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   6e-41    
ref|WP_024647595.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   6e-41    
ref|WP_012916972.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   6e-41    
ref|WP_009583767.1|  Cyclopropane-fatty-acyl-phospholipid synthase      157   6e-41    
ref|WP_010177020.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   6e-41    
ref|WP_003467054.1|  cyclopropane-fatty-acyl-phospholipid synthase      157   6e-41    
ref|WP_039761286.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_024661275.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_039034308.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_044343954.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_019742551.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_010458259.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_005746219.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_044319716.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_002552156.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
gb|EKM95559.1|  cyclopropane-fatty-acyl-phospholipid synthase           156   7e-41    
ref|WP_005733596.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_011167849.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_042827312.1|  cyclopropane-fatty-acyl-phospholipid synthase      153   7e-41    
ref|WP_037020191.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   7e-41    
ref|WP_010380444.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   8e-41    
ref|XP_007512428.1|  cyclopropane-fatty-acyl-phospholipid synthase      160   8e-41    
ref|WP_008373278.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   8e-41    
ref|WP_011050875.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    156   8e-41    
ref|WP_027925959.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   8e-41    
ref|WP_016965510.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   8e-41    
ref|WP_011346862.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   8e-41    
ref|WP_016850267.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   9e-41    
ref|WP_005911656.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    156   9e-41    
ref|WP_040280933.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   9e-41    
ref|WP_039580557.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   9e-41    
ref|WP_017340747.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   9e-41    
dbj|GAF52913.1|  cyclopropane-fatty-acyl-phospholipid synthase, p...    157   9e-41    
ref|WP_009852233.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   9e-41    
ref|WP_017072351.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   1e-40    
ref|WP_019825100.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   1e-40    
ref|WP_017912728.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   1e-40    
ref|WP_005768844.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    155   1e-40    
ref|WP_011103434.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   1e-40    
ref|WP_017915334.1|  cyclopropane-fatty-acyl-phospholipid synthase      156   1e-40    
ref|WP_011335916.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   1e-40    
ref|WP_019304527.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   1e-40    
ref|WP_017067826.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   1e-40    
ref|WP_019301959.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   1e-40    
ref|WP_024656809.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   1e-40    
ref|WP_005891172.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   1e-40    
ref|WP_017070213.1|  cyclopropane-fatty-acyl-phospholipid synthase      155   1e-40    



>ref|XP_009625539.1| PREDICTED: uncharacterized protein LOC104116392 isoform X5 [Nicotiana 
tomentosiformis]
Length=556

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LVLQFISIPDERYDEYR
Sbjct  379  YRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYR  438

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  439  QSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQS  498

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  499  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  556



>ref|XP_009625540.1| PREDICTED: uncharacterized protein LOC104116392 isoform X6 [Nicotiana 
tomentosiformis]
Length=556

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LVLQFISIPDERYDEYR
Sbjct  379  YRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYR  438

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  439  QSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQS  498

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  499  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  556



>ref|XP_009763752.1| PREDICTED: uncharacterized protein LOC104215602 isoform X2 [Nicotiana 
sylvestris]
Length=566

 Score =   330 bits (846),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM EFF   ES LAE+G+LVLQFISIPDERYDEYR
Sbjct  389  YRQLPNMSRYDRIISCEMLEAVGHEFMEEFFTCSESALAEDGLLVLQFISIPDERYDEYR  448

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  449  QSSDFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQS  508

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  509  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYHGVPSTY  566



>ref|XP_009617895.1| PREDICTED: uncharacterized protein LOC104110155 isoform X5 [Nicotiana 
tomentosiformis]
Length=566

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM EFF  CES LA +G+LVLQFISIPDERYDEYR
Sbjct  389  YRQLPNMSRYDRIISCEMLEAVGHEFMEEFFTCCESALAGDGLLVLQFISIPDERYDEYR  448

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  449  QSSDFIKEYIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQS  508

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  509  QIHALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  566



>ref|XP_009625535.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625536.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625538.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   330 bits (846),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LVLQFISIPDERYDEYR
Sbjct  625  YRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYR  684

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  685  QSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQS  744

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  745  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  802



>ref|XP_009625534.1| PREDICTED: uncharacterized protein LOC104116392 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   330 bits (846),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LVLQFISIPDERYDEYR
Sbjct  631  YRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYR  690

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  691  QSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQS  750

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  751  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  808



>ref|XP_009625531.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009625532.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   330 bits (847),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  748  QSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  808  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865



>ref|XP_009625533.1| PREDICTED: uncharacterized protein LOC104116392 isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   330 bits (847),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  748  QSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  808  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865



>ref|XP_009763750.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009763751.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
Length=865

 Score =   329 bits (844),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM EFF   ES LAE+G+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPNMSRYDRIISCEMLEAVGHEFMEEFFTCSESALAEDGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  748  QSSDFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  808  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYHGVPSTY  865



>ref|XP_006354448.1| PREDICTED: uncharacterized protein LOC102604983 [Solanum tuberosum]
Length=862

 Score =   328 bits (840),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM EFF  CES LAE+G+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPNMSRYDRIISCEMLEAVGHEFMEEFFTCCESALAEDGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLP+LSRVTSAM+A+SRLCVEHLEDIGIHYYQTLRCWR NFLE+QS
Sbjct  748  QSSDFIKEYIFPGGCLPALSRVTSAMSAASRLCVEHLEDIGIHYYQTLRCWRKNFLEKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGL  250
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+
Sbjct  808  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGV  861



>ref|XP_004247758.1| PREDICTED: uncharacterized protein LOC101260476 [Solanum lycopersicum]
Length=862

 Score =   326 bits (836),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   RYDRIISCEMLEAVGHEFM EFF  CES LAE+G+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPKMSRYDRIISCEMLEAVGHEFMEEFFTCCESALAEDGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLP+LSRVTSAM+A+SRLCVEHLEDIGIHYYQTLRCWR NFLE+QS
Sbjct  748  QSSDFIKEYIFPGGCLPALSRVTSAMSAASRLCVEHLEDIGIHYYQTLRCWRKNFLEKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  253
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G
Sbjct  808  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNG  860



>ref|XP_009617893.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009617894.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   323 bits (827),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM EFF  CES LA +G+LVLQFISIPDERYDEYR
Sbjct  625  YRQLPNMSRYDRIISCEMLEAVGHEFMEEFFTCCESALAGDGLLVLQFISIPDERYDEYR  684

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  685  QSSDFIKEYIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQS  744

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  745  QIHALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  802



>ref|XP_009617891.1| PREDICTED: uncharacterized protein LOC104110155 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009617892.1| PREDICTED: uncharacterized protein LOC104110155 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM EFF  CES LA +G+LVLQFISIPDERYDEYR
Sbjct  631  YRQLPNMSRYDRIISCEMLEAVGHEFMEEFFTCCESALAGDGLLVLQFISIPDERYDEYR  690

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  691  QSSDFIKEYIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQS  750

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  751  QIHALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  808



>ref|XP_009617889.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617890.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  RYDRIISCEMLEAVGHEFM EFF  CES LA +G+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPNMSRYDRIISCEMLEAVGHEFMEEFFTCCESALAGDGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QS
Sbjct  748  QSSDFIKEYIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  808  QIHALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  865



>ref|XP_004173387.1| PREDICTED: probable fatty acid methyltransferase-like, partial 
[Cucumis sativus]
Length=291

 Score =   306 bits (784),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   +YDRIISCEM+EAVGHEFM +FFG CESVLAENG+ VLQFISIPDERY+EYR
Sbjct  114  YRKLPSTEKYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYNEYR  173

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE +S
Sbjct  174  LSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENKS  233

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  234  KILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  291



>ref|XP_009780643.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Nicotiana sylvestris]
Length=543

 Score =   313 bits (803),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +YDRIISC MLE VGH+FM EFF  CES LAE+G+LV+QFISIPDERYDEYR
Sbjct  366  YRQMPNKDKYDRIISCGMLEHVGHDFMGEFFSCCESALAEDGLLVVQFISIPDERYDEYR  425

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLP+L+RVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR  FL+ QS
Sbjct  426  QSSDFIKEYIFPGGCLPALNRVTSAMAAASRLCVVHLEEIGIHYYQTLRCWREKFLKNQS  485

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV  FGDPY G+ SAY
Sbjct  486  QIRALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAVFGDPYNGVPSAY  543



>gb|EYU32577.1| hypothetical protein MIMGU_mgv1a001185mg [Erythranthe guttata]
Length=870

 Score =   322 bits (824),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +Y+RIISCEMLEAVGHE+M EFFG CES LAE+G+ VLQFISIPDERY EYR
Sbjct  692  YRQLPKTEKYNRIISCEMLEAVGHEYMEEFFGCCESALAEDGLFVLQFISIPDERYTEYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEH+EDIGIHYYQTLRCWR NFL R S
Sbjct  752  RSSDFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEHVEDIGIHYYQTLRCWRENFLNRTS  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I +LGFD+KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPYK +  AY
Sbjct  812  EIKNLGFDEKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYKSVPCAY  869



>ref|XP_006606356.1| PREDICTED: uncharacterized protein LOC100815937 isoform X3 [Glycine 
max]
Length=566

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR
Sbjct  394  YRQLPKTYKYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYR  453

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ+
Sbjct  454  RSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCVEHVENIGIHYYQTLRCWRKNFLKRQN  513

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  514  EILALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVPALGDPYK  565



>ref|XP_010650131.1| PREDICTED: (S)-coclaurine N-methyltransferase isoform X4 [Vitis 
vinifera]
Length=556

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIISCEMLEAVGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR
Sbjct  379  YRQLSDSYKYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYR  438

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS
Sbjct  439  RSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQS  498

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  499  KIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  556



>ref|XP_011073567.1| PREDICTED: uncharacterized protein LOC105158481 isoform X2 [Sesamum 
indicum]
Length=802

 Score =   318 bits (815),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISCEMLEAVGHE+M EFF  CESVL E+GILVLQFISIPDERY+EYR
Sbjct  625  YRQLPNTDKYDRIISCEMLEAVGHEYMEEFFRCCESVLQEDGILVLQFISIPDERYNEYR  684

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QS+DFIKEYIFPGGCLPSLSRVT+AM+A+SRLCVEHLEDIGIHYYQTLR WR +FLE+QS
Sbjct  685  QSADFIKEYIFPGGCLPSLSRVTTAMSAASRLCVEHLEDIGIHYYQTLRRWRESFLEKQS  744

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I  LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  745  KIQALGFDEKFIRTWEYYFDYCAAGFKTCTLGNYQIVFSRPGNVEAFGDPYKTIPSAY  802



>ref|XP_008460676.1| PREDICTED: pavine N-methyltransferase-like isoform X3 [Cucumis 
melo]
Length=557

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   RYDRIISCEM+EAVGHEFM +FFG CESVLAENG+ VLQFISIPDERYDEYR
Sbjct  380  YRKLPSTERYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYDEYR  439

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE QS
Sbjct  440  LSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENQS  499

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  500  KILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  557



>ref|XP_006589308.1| PREDICTED: uncharacterized protein LOC100801659 isoform X2 [Glycine 
max]
Length=566

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR
Sbjct  394  YRQLPKAYKYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYR  453

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+E+IGIHYYQTLRCWR NFLERQ+
Sbjct  454  RSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHVENIGIHYYQTLRCWRKNFLERQN  513

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +I+ LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  514  EIMALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAALGDPYK  565



>ref|XP_004296397.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462298.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
Length=865

 Score =   318 bits (815),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P N + DRIISCEMLE+VGHEFMN+FF  CESVLAENG+LVLQFISIPDERYDEYR
Sbjct  688  YRQMPANYKCDRIISCEMLESVGHEFMNDFFASCESVLAENGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAM  SSRLCVEH+E+IGIHYYQTLR WR NFLERQS
Sbjct  748  RSSDFIKEYIFPGGCLPSLSRVTSAMVNSSRLCVEHIENIGIHYYQTLRYWRKNFLERQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  808  EILALGFNEKFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNVPAFSNPYKGFPSAY  865



>ref|XP_011073566.1| PREDICTED: uncharacterized protein LOC105158481 isoform X1 [Sesamum 
indicum]
Length=869

 Score =   318 bits (815),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISCEMLEAVGHE+M EFF  CESVL E+GILVLQFISIPDERY+EYR
Sbjct  692  YRQLPNTDKYDRIISCEMLEAVGHEYMEEFFRCCESVLQEDGILVLQFISIPDERYNEYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QS+DFIKEYIFPGGCLPSLSRVT+AM+A+SRLCVEHLEDIGIHYYQTLR WR +FLE+QS
Sbjct  752  QSADFIKEYIFPGGCLPSLSRVTTAMSAASRLCVEHLEDIGIHYYQTLRRWRESFLEKQS  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I  LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  812  KIQALGFDEKFIRTWEYYFDYCAAGFKTCTLGNYQIVFSRPGNVEAFGDPYKTIPSAY  869



>ref|XP_007227011.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
 gb|EMJ28210.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
Length=866

 Score =   318 bits (814),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP N +YDRIISCEMLE+VGHEFM+EFF  CESVLA+NG+LVLQFISIPDERYDEYR
Sbjct  688  YRQLP-NYKYDRIISCEMLESVGHEFMDEFFACCESVLADNGLLVLQFISIPDERYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S
Sbjct  747  RSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHS  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGF++ FIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  807  EILALGFNENFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNTPAFADPYKGFPSA  863



>ref|XP_011029775.1| PREDICTED: uncharacterized protein LOC105129420 isoform X4 [Populus 
euphratica]
Length=566

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYR
Sbjct  389  YRQLPKTHKYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYR  448

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q 
Sbjct  449  QSSDFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQR  508

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  509  KILALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  566



>ref|XP_007144121.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
 gb|ESW16115.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
Length=694

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   ++DRIISCEM+EAVGHE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR
Sbjct  522  YRQLPKTYKFDRIISCEMIEAVGHEYMEEFFGCCESVLAQNGLLVLQFISIPDERYDEYR  581

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAMA +SRLCVEH+E++GIHYYQTLRCWR NF+ERQ+
Sbjct  582  RSSDFIKEYIFPGGCLPSLSRITSAMATTSRLCVEHVENLGIHYYQTLRCWRKNFMERQN  641

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV AFGDPYK
Sbjct  642  EILALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAAFGDPYK  693



>ref|XP_010650129.1| PREDICTED: uncharacterized protein LOC100249441 isoform X2 [Vitis 
vinifera]
Length=684

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIISCEMLEAVGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR
Sbjct  507  YRQLSDSYKYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYR  566

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS
Sbjct  567  RSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQS  626

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  627  KIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  684



>ref|XP_009357997.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357998.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357999.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358000.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
Length=863

 Score =   314 bits (805),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 163/173 (94%), Gaps = 1/173 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL +N +YDRIISCEMLE+VGHEFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR
Sbjct  688  YRQLANN-KYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFLERQS
Sbjct  747  RSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLERQS  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  253
            +IL LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  807  EILALGFDEKFIRTWEYYFDYCAAGFRTCTLGNYQMVFSRPGNVPAFSNPYEG  859



>gb|KHN01041.1| Putative fatty acid methyltransferase [Glycine soja]
Length=794

 Score =   313 bits (801),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR
Sbjct  622  YRQLPKTYKYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYR  681

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ+
Sbjct  682  RSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCVEHVENIGIHYYQTLRCWRKNFLKRQN  741

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  742  EILALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVPALGDPYK  793



>emb|CBI23694.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   314 bits (805),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP++ +YDRIISC MLE+VGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR
Sbjct  704  YRQLPNSYKYDRIISCGMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYR  763

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS
Sbjct  764  RSSDFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQS  823

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I++LGF++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  824  KIIELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  881



>ref|XP_010650134.1| PREDICTED: uncharacterized protein LOC100242555 isoform X3 [Vitis 
vinifera]
Length=865

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP++ +YDRIISC MLE+VGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPNSYKYDRIISCGMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS
Sbjct  748  RSSDFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I++LGF++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  808  KIIELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  865



>ref|XP_009358001.1| PREDICTED: uncharacterized protein LOC103948676 isoform X2 [Pyrus 
x bretschneideri]
Length=862

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 163/173 (94%), Gaps = 1/173 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL +N +YDRIISCEMLE+VGHEFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR
Sbjct  688  YRQLANN-KYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFLERQS
Sbjct  747  RSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLERQS  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  253
            +IL LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  807  EILALGFDEKFIRTWEYYFDYCAAGFRTCTLGNYQMVFSRPGNVPAFSNPYEG  859



>ref|XP_010650133.1| PREDICTED: uncharacterized protein LOC100242555 isoform X2 [Vitis 
vinifera]
Length=866

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP++ +YDRIISC MLE+VGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR
Sbjct  689  YRQLPNSYKYDRIISCGMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYR  748

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS
Sbjct  749  RSSDFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQS  808

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I++LGF++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  809  KIIELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  866



>ref|XP_010650132.1| PREDICTED: uncharacterized protein LOC100242555 isoform X1 [Vitis 
vinifera]
Length=868

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP++ +YDRIISC MLE+VGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR
Sbjct  691  YRQLPNSYKYDRIISCGMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYR  750

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS
Sbjct  751  RSSDFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQS  810

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I++LGF++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  811  KIIELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  868



>ref|XP_010670963.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   303 bits (775),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLPD  +Y+RIISCEMLEAVGHE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR
Sbjct  280  YRQLPDVHKYNRIISCEMLEAVGHEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYR  339

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS
Sbjct  340  RSSDFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQS  399

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  253
            +I  LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  400  KIHSLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  452



>ref|XP_008340641.1| PREDICTED: uncharacterized protein LOC103403572 isoform X2 [Malus 
domestica]
Length=554

 Score =   306 bits (783),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 160/173 (92%), Gaps = 1/173 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL  + +YDRIISCEMLE+VGHEFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR
Sbjct  379  YRQLA-SYKYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYR  437

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFL+RQ 
Sbjct  438  RSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLDRQG  497

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  253
            +IL LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV AF +PYKG
Sbjct  498  EILALGFDEKFIRTWEYYFDYCAAGFRTYTLGNYQIVFSRPGNVPAFSNPYKG  550



>ref|XP_010527410.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
 ref|XP_010527411.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
Length=870

 Score =   313 bits (803),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIISCEMLEAVGHEFM  FF RCES LAE+G++VLQFISIP+ERYDEYR
Sbjct  691  YRQLSDSRKYDRIISCEMLEAVGHEFMETFFSRCESALAEDGVIVLQFISIPEERYDEYR  750

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLRCWR NFLERQ 
Sbjct  751  LSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRCWRKNFLERQK  810

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGF+++FIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGN  AFGDPY+   SA+
Sbjct  811  QIMALGFNEEFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNTAAFGDPYRSFPSAH  868



>ref|XP_002311690.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEE89057.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=858

 Score =   313 bits (801),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYR
Sbjct  681  YRQLPKTHKYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYR  740

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSL+R+TSAMAASSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q 
Sbjct  741  QSSDFIKEYIFPGGCLPSLTRITSAMAASSRLCVEHVENIGIHYYQTLKYWRKNFLEKQR  800

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  801  KILALGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  858



>ref|XP_006606354.1| PREDICTED: uncharacterized protein LOC100815937 isoform X1 [Glycine 
max]
Length=861

 Score =   312 bits (800),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR
Sbjct  689  YRQLPKTYKYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYR  748

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ+
Sbjct  749  RSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCVEHVENIGIHYYQTLRCWRKNFLKRQN  808

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  809  EILALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVPALGDPYK  860



>ref|XP_008224158.1| PREDICTED: uncharacterized protein LOC103323914 isoform X2 [Prunus 
mume]
Length=866

 Score =   313 bits (801),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL  N +YDRIISCEMLE+VGHEFM+EFF  CESVL +NG+LVLQFISIPDERYDEYR
Sbjct  688  YRQL-SNYKYDRIISCEMLESVGHEFMDEFFACCESVLTDNGLLVLQFISIPDERYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S
Sbjct  747  RSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHS  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGF++ FIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  807  EILALGFNENFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNTPAFTDPYKGFPSA  863



>ref|XP_008224157.1| PREDICTED: uncharacterized protein LOC103323914 isoform X1 [Prunus 
mume]
Length=871

 Score =   313 bits (801),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL  N +YDRIISCEMLE+VGHEFM+EFF  CESVL +NG+LVLQFISIPDERYDEYR
Sbjct  693  YRQL-SNYKYDRIISCEMLESVGHEFMDEFFACCESVLTDNGLLVLQFISIPDERYDEYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S
Sbjct  752  RSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHS  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGF++ FIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  812  EILALGFNENFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNTPAFTDPYKGFPSA  868



>ref|XP_010264927.1| PREDICTED: uncharacterized protein LOC104602804 isoform X2 [Nelumbo 
nucifera]
Length=776

 Score =   310 bits (795),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP + +YDRIISCEMLEAVGHE+M EF G CESVLAENG+LVLQFISIPDERYDEYR
Sbjct  599  YRQLPYSHKYDRIISCEMLEAVGHEYMEEFLGCCESVLAENGLLVLQFISIPDERYDEYR  658

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGC+PSLSRVTSAMA++SRLCVEHLE+IGIHYYQTL  WR +F+E+QS
Sbjct  659  RSSDFIKEYIFPGGCIPSLSRVTSAMASASRLCVEHLENIGIHYYQTLIYWRNSFMEKQS  718

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQIVFSRPGN+TAF DPYKGL SA+
Sbjct  719  EILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQIVFSRPGNLTAFSDPYKGLPSAF  776



>gb|KHN30725.1| Putative fatty acid methyltransferase [Glycine soja]
Length=787

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR
Sbjct  615  YRQLPKAYKYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYR  674

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+E+IGIHYYQTLRCWR NFLERQ+
Sbjct  675  RSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHVENIGIHYYQTLRCWRKNFLERQN  734

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +I+ LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  735  EIMALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAALGDPYK  786



>ref|XP_008460674.1| PREDICTED: uncharacterized protein LOC103499444 isoform X1 [Cucumis 
melo]
Length=865

 Score =   312 bits (799),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   RYDRIISCEM+EAVGHEFM +FFG CESVLAENG+ VLQFISIPDERYDEYR
Sbjct  688  YRKLPSTERYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE QS
Sbjct  748  LSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  808  KILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865



>ref|XP_006296683.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
 gb|EOA29581.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
Length=867

 Score =   311 bits (798),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERYDEYR
Sbjct  687  YRQLSDVHKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ 
Sbjct  747  LSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQK  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD+KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  807  QIMALGFDEKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>emb|CDO99279.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   311 bits (796),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISCEMLEAVGHEFM ++F  C SVLAE+GILVLQFISIPDERY+EYR
Sbjct  674  YRQLPETYKYDRIISCEMLEAVGHEFMEKYFSSCNSVLAEDGILVLQFISIPDERYEEYR  733

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFI+EYIFPGGCLPSLSRVTSAMAA+S LCVEHLE+ GIHYY TLR WR NFL +QS
Sbjct  734  QSSDFIREYIFPGGCLPSLSRVTSAMAAASGLCVEHLENFGIHYYHTLRRWRTNFLSKQS  793

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL+LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQ+VFSRPGNV +FG+  KG+ SAY
Sbjct  794  EILELGFDEKFIRTWEYYFDYCAAGFKTCTLGNYQVVFSRPGNVVSFGNLQKGVPSAY  851



>ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 isoform X1 [Vitis 
vinifera]
Length=865

 Score =   311 bits (797),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIISCEMLEAVGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR
Sbjct  688  YRQLSDSYKYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS
Sbjct  748  RSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  808  KIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  865



>ref|XP_006421140.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34380.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=802

 Score =   310 bits (793),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL    +YDRIISCEM+EAVGHEFM EFFG CES+LAE+G+LVLQFISIPDERY+EYR
Sbjct  625  YRQLAKANKYDRIISCEMIEAVGHEFMEEFFGCCESMLAEDGLLVLQFISIPDERYNEYR  684

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSLSR+TSAM+A+SRLCVE +E+IGIHYYQTLRCWR NF+E+QS
Sbjct  685  LSSDFIKEYIFPGGCLPSLSRITSAMSAASRLCVEQVENIGIHYYQTLRCWRKNFMEKQS  744

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF+ KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  745  KILALGFNDKFIRTWEYYFDYCAAGFKSYTLGNYQIVFSRPGNVAAFSNPYKGFPSAY  802



>emb|CDY67345.1| BnaCnng54600D [Brassica napus]
Length=454

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR
Sbjct  276  YRQLSDAKKYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYR  335

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IG+HYYQTLRCWR NFLE Q 
Sbjct  336  LNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGLHYYQTLRCWRKNFLENQK  395

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  396  QIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  453



>ref|XP_011013987.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013989.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013990.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
Length=460

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 158/184 (86%), Gaps = 2/184 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   +YDRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR
Sbjct  279  YRELPKGYKYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYR  338

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S
Sbjct  339  RSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKS  398

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY*A  232
            +IL +GFD+KFIRTWEYYFDYCAAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY  
Sbjct  399  KILAMGFDEKFIRTWEYYFDYCAAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY--  456

Query  231  HSLL  220
            H LL
Sbjct  457  HHLL  460



>ref|XP_010264925.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264926.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
Length=865

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP + +YDRIISCEMLEAVGHE+M EF G CESVLAENG+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPYSHKYDRIISCEMLEAVGHEYMEEFLGCCESVLAENGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGC+PSLSRVTSAMA++SRLCVEHLE+IGIHYYQTL  WR +F+E+QS
Sbjct  748  RSSDFIKEYIFPGGCIPSLSRVTSAMASASRLCVEHLENIGIHYYQTLIYWRNSFMEKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQIVFSRPGN+TAF DPYKGL SA+
Sbjct  808  EILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQIVFSRPGNLTAFSDPYKGLPSAF  865



>ref|XP_011029773.1| PREDICTED: uncharacterized protein LOC105129420 isoform X3 [Populus 
euphratica]
Length=732

 Score =   308 bits (788),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYR
Sbjct  555  YRQLPKTHKYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYR  614

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q 
Sbjct  615  QSSDFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQR  674

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  675  KILALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  732



>emb|CBI23697.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/178 (81%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIISCEMLEAVGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR
Sbjct  721  YRQLSDSYKYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYR  780

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS
Sbjct  781  RSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQS  840

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  841  KIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  898



>ref|XP_006589307.1| PREDICTED: uncharacterized protein LOC100801659 isoform X1 [Glycine 
max]
Length=860

 Score =   310 bits (795),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPKAYKYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+E+IGIHYYQTLRCWR NFLERQ+
Sbjct  748  RSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHVENIGIHYYQTLRCWRKNFLERQN  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +I+ LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  808  EIMALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAALGDPYK  859



>ref|XP_002883433.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59692.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
Length=867

 Score =   310 bits (795),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  687  YRQLSDAHKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ 
Sbjct  747  LSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRVWRKNFLERQK  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  807  QIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_009586640.1| PREDICTED: uncharacterized protein LOC104084479 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+N +YDRIISC MLE VGH+F+ EFF  CE+ LAE+G+LV+QFISIPDERY+EYR
Sbjct  688  YRQMPNNYKYDRIISCGMLEHVGHDFIGEFFSCCETALAEDGLLVVQFISIPDERYEEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLP+L+RVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR  FL+ QS
Sbjct  748  RSSDFIKEYIFPGGCLPALNRVTSAMAAASRLCVVHLEEIGIHYYQTLRCWREKFLKNQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV  FGDPY G+ SAY
Sbjct  808  QIRALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAVFGDPYNGVPSAY  865



>ref|XP_011470583.1| PREDICTED: LOW QUALITY PROTEIN: (S)-tetrahydroprotoberberine 
N-methyltransferase-like [Fragaria vesca subsp. vesca]
Length=445

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP N  YDR+ISCEMLE VGH+FM EFFG CES+LAE G+LVLQF S+PDERYD+YR
Sbjct  268  YRKLPPNSTYDRVISCEMLEHVGHKFMEEFFGCCESLLAEKGLLVLQFTSLPDERYDKYR  327

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFI EYIFPG C+PSLSRVTSAMA SS+L VEHLE+IGIHYY TL+CW+  FLE Q+
Sbjct  328  QSSDFINEYIFPGACIPSLSRVTSAMATSSKLSVEHLENIGIHYYPTLKCWKKIFLENQN  387

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD++FIRTWEYYFDYCAAGF++CTLG+YQIVFSRPGNV   G+P+KG  SAY
Sbjct  388  EILALGFDEEFIRTWEYYFDYCAAGFNSCTLGNYQIVFSRPGNVPVLGNPFKGFPSAY  445



>ref|XP_011041421.1| PREDICTED: (S)-coclaurine N-methyltransferase-like, partial [Populus 
euphratica]
Length=419

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   +YDRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR
Sbjct  238  YRELPKGYKYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYR  297

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S
Sbjct  298  RSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKS  357

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL +GFD+KFIRTWEYYFDYCAAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  358  KILAMGFDEKFIRTWEYYFDYCAAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY  415



>gb|KGN61577.1| hypothetical protein Csa_2G172470 [Cucumis sativus]
Length=213

 Score =   290 bits (742),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISC +LE+VGHEFM +FFG CESVL ENG+LV+QFIS+PD+RYDE+R
Sbjct  33   YRQLPNTHKYDRIISCGLLESVGHEFMEDFFGLCESVLVENGLLVVQFISMPDDRYDEHR  92

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDF++EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + 
Sbjct  93   LSSDFMREYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKR  152

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I++LGFD+ FIRTWEYYFDYCAAGF + T+GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  153  KIIELGFDESFIRTWEYYFDYCAAGFKSRTIGDYQIVFSRAGNVTTFNNPYQGIPSA  209



>emb|CDY09021.1| BnaC01g30700D [Brassica napus]
Length=804

 Score =   308 bits (788),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR
Sbjct  626  YRQLSDAHKYDRIISCEMLEAVGHEFMETFFTHCEAALAEDGIFVLQFISIPEERYDEYR  685

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL RVTSAMA+SSRLCVE++E+IGIHYYQTLRCWR NFLERQ 
Sbjct  686  LSSDFIKEYIFPGGCLPSLGRVTSAMASSSRLCVENVENIGIHYYQTLRCWRKNFLERQK  745

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI+DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP+    SA
Sbjct  746  QIIDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFHCFPSA  802



>ref|XP_010466687.1| PREDICTED: uncharacterized protein LOC104746847 [Camelina sativa]
Length=867

 Score =   309 bits (791),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  687  YRQLSDVQKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ 
Sbjct  747  LSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQK  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  807  QIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  864



>ref|XP_010490069.1| PREDICTED: uncharacterized protein LOC104767788, partial [Camelina 
sativa]
Length=862

 Score =   308 bits (790),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  682  YRQLSDVQKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYR  741

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ 
Sbjct  742  LSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQK  801

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  802  QIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  859



>ref|XP_006493505.1| PREDICTED: uncharacterized protein LOC102615883 isoform X1 [Citrus 
sinensis]
 ref|XP_006493506.1| PREDICTED: uncharacterized protein LOC102615883 isoform X2 [Citrus 
sinensis]
Length=869

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL    +YDRIISCEM+EAVGHEFM EFFG CES+L E+G+LVLQFISIPDERY+EYR
Sbjct  692  YRQLAKANKYDRIISCEMIEAVGHEFMEEFFGCCESLLVEDGLLVLQFISIPDERYNEYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSLSR+TSAM+A+SRLCVE +E+IGIHYYQTLRCWR NF+E+QS
Sbjct  752  LSSDFIKEYIFPGGCLPSLSRITSAMSAASRLCVEQVENIGIHYYQTLRCWRKNFMEKQS  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF+ KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  812  KILALGFNDKFIRTWEYYFDYCAAGFKSYTLGNYQIVFSRPGNVAAFSNPYKGFPSAY  869



>ref|XP_011029770.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
 ref|XP_011029771.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
Length=866

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYR
Sbjct  689  YRQLPKTHKYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYR  748

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q 
Sbjct  749  QSSDFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQR  808

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  809  KILALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  866



>ref|XP_011029772.1| PREDICTED: uncharacterized protein LOC105129420 isoform X2 [Populus 
euphratica]
Length=865

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYR
Sbjct  688  YRQLPKTHKYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q 
Sbjct  748  QSSDFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQR  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  808  KILALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  865



>ref|XP_010109738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Morus notabilis]
 gb|EXC24409.1| Cyclopropane-fatty-acyl-phospholipid synthase [Morus notabilis]
Length=161

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  MLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP  541
            MLEAVGHEFM +FFG CES LAENG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLP
Sbjct  1    MLEAVGHEFMEDFFGSCESALAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLP  60

Query  540  SLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEY  361
            SLSRVTSAMAA+SRLCVEH+E+IGIHY+QTLRCWR NFLE+QS+IL LGF++KFIRTWEY
Sbjct  61   SLSRVTSAMAAASRLCVEHIENIGIHYHQTLRCWRKNFLEKQSEILALGFNEKFIRTWEY  120

Query  360  YFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            YFDYCAAGF + TLG+YQIVFSRPGNV AF +PYK   SA
Sbjct  121  YFDYCAAGFKSHTLGNYQIVFSRPGNVAAFRNPYKSFPSA  160



>emb|CDX85109.1| BnaC07g07970D [Brassica napus]
Length=868

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  688  YRQLSDAHKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLMVLQFISIPEERYNEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ 
Sbjct  748  LSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQK  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
             I+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  808  PIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAAFADSYKGFPSAY  865



>gb|KGN61573.1| hypothetical protein Csa_2G171940 [Cucumis sativus]
Length=865

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 160/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   +YDRIISCEM+EAVGHEFM +FFG CESVLAENG+ VLQFISIPDERY+EYR
Sbjct  688  YRKLPSTEKYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYNEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE +S
Sbjct  748  LSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENKS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  808  KILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865



>emb|CDX77504.1| BnaA07g06420D [Brassica napus]
Length=861

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  681  YRQLSDAHKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLMVLQFISIPEERYNEYR  740

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ 
Sbjct  741  LSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQK  800

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
             I+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  801  PIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAAFADSYKGFPSAY  858



>ref|XP_010512500.1| PREDICTED: uncharacterized protein LOC104788434 isoform X2 [Camelina 
sativa]
Length=803

 Score =   306 bits (784),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  623  YRQLSDVQKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYR  682

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ 
Sbjct  683  LSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQK  742

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LG D KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  743  QIMALGIDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  800



>ref|XP_010512493.1| PREDICTED: uncharacterized protein LOC104788434 isoform X1 [Camelina 
sativa]
Length=867

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  687  YRQLSDVQKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ 
Sbjct  747  LSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQK  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LG D KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  807  QIMALGIDDKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  864



>gb|EPS65744.1| cyclopropane fatty acid synthase, partial [Genlisea aurea]
Length=567

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   RYDRIISCEMLEAVGHEFM EFF  CES+L ++G+LVLQFISIPD RYD YR
Sbjct  391  YRQLPKTDRYDRIISCEMLEAVGHEFMEEFFSCCESLLVKDGLLVLQFISIPDVRYDTYR  450

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMA +SR CVEHLEDIGIHYY TLRCWR  FL  + 
Sbjct  451  RSSDFIKEYIFPGGCLPSLSRVTAAMATASRFCVEHLEDIGIHYYPTLRCWREKFLGSRK  510

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I DLGFD+KFIRTW YYFDYCAAGF +CTLG+YQIV SRPGNVTAFG+PY  L SA
Sbjct  511  EIEDLGFDEKFIRTWVYYFDYCAAGFKSCTLGNYQIVMSRPGNVTAFGNPYSSLPSA  567



>dbj|BAB02771.1| mycolic acid methyl transferase-like protein [Arabidopsis thaliana]
Length=842

 Score =   306 bits (784),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  662  YRQLSDAQKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYR  721

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ 
Sbjct  722  LSSDFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQK  781

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  782  QIMALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  839



>ref|XP_009414043.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Musa acuminata subsp. malaccensis]
Length=333

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISCEM+E VGHE+M +FFG CES+LAE+GI VLQFISIPDERYDEYR
Sbjct  155  YRQLPNYHKYDRIISCEMIEEVGHEYMEQFFGCCESLLAEDGIFVLQFISIPDERYDEYR  214

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+T+AMA SSR C+EHLE+IGIHYYQTLRCWR NF   + 
Sbjct  215  RSSDFIKEYIFPGGCLPSLSRITTAMATSSRFCIEHLENIGIHYYQTLRCWRNNFFANKE  274

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGFD+KF RTWEYYF Y AAGF +CTLGDYQIVFSRPGN+ AFG+P+  + + 
Sbjct  275  KILALGFDEKFFRTWEYYFMYRAAGFKSCTLGDYQIVFSRPGNLRAFGEPFNSIPAT  331



>ref|NP_188995.2| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAL38380.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAP21152.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AEE76773.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   306 bits (785),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  687  YRQLSDAQKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ 
Sbjct  747  LSSDFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQK  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  807  QIMALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera]
Length=874

 Score =   306 bits (785),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIISCEMLEAVGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR
Sbjct  675  YRQLSDSYKYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYR  734

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVT+AMAA+SRLC+EHLE+IGIHYYQTLR WR NFLE QS
Sbjct  735  RSSDFIKEYIFPGGCLPSLSRVTTAMAAASRLCMEHLENIGIHYYQTLRHWRKNFLENQS  794

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PYK
Sbjct  795  KIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYK  846



>gb|AAL57657.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAN64525.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
Length=867

 Score =   306 bits (785),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  687  YRQLSDAQKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ 
Sbjct  747  LSSDFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQK  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  807  QIMALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>dbj|BAD44154.1| unnamed protein product [Arabidopsis thaliana]
Length=867

 Score =   306 bits (784),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  687  YRQLSDAQKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ 
Sbjct  747  LSSDFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRENFLARQK  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  807  QIMALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_009102618.1| PREDICTED: uncharacterized protein LOC103828740 isoform X2 [Brassica 
rapa]
Length=619

 Score =   300 bits (769),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR
Sbjct  441  YRQLSDARKYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYR  500

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q 
Sbjct  501  LNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQK  560

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  561  QIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  618



>ref|XP_008340636.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340637.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340639.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340640.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
Length=863

 Score =   306 bits (783),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 160/173 (92%), Gaps = 1/173 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL  + +YDRIISCEMLE+VGHEFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR
Sbjct  688  YRQLA-SYKYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFL+RQ 
Sbjct  747  RSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLDRQG  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  253
            +IL LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV AF +PYKG
Sbjct  807  EILALGFDEKFIRTWEYYFDYCAAGFRTYTLGNYQIVFSRPGNVPAFSNPYKG  859



>ref|XP_009102608.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
 ref|XP_009102609.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
Length=870

 Score =   306 bits (783),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR
Sbjct  690  YRQLSDAHKYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLMVLQFISIPEERYNEYR  749

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ 
Sbjct  750  LSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQK  809

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
             I+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF + YKG  SAY
Sbjct  810  PIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAAFANSYKGFPSAY  867



>gb|KEH42686.1| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=860

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESV+A +G+LVLQFISIPDERYDEYR
Sbjct  686  YRQLPKTYKYDRIISCEMIEAVGHEYMEEFFGCCESVMANDGLLVLQFISIPDERYDEYR  745

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TS+MA++SRLCVEH+E+ GIHYYQTLR WR NFLERQS
Sbjct  746  RSSDFIKEYIFPGGCLPSLSRITSSMASTSRLCVEHVENFGIHYYQTLRLWRKNFLERQS  805

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNVTAF DPYK
Sbjct  806  EILALGFNEKFIRTWEYYFDYCGAGFKSRTLGNYQVVFSRPGNVTAFTDPYK  857



>ref|XP_010670960.1| PREDICTED: uncharacterized protein LOC104887889 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=725

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLPD  +Y+RIISCEMLEAVGHE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR
Sbjct  548  YRQLPDVHKYNRIISCEMLEAVGHEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYR  607

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS
Sbjct  608  RSSDFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQS  667

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  253
            +I  LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  668  KIHSLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  720



>gb|KDP40373.1| hypothetical protein JCGZ_02371 [Jatropha curcas]
Length=869

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP N RYDRIISCEM+EAVGHE+M EFFG CESVLAE+G++VLQFISIP+ERY+EYR
Sbjct  692  YRQLPKNYRYDRIISCEMIEAVGHEYMEEFFGCCESVLAEDGLIVLQFISIPEERYEEYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSL+R+ SAM+A+SRLC+EH+E+IGIHYYQTLR WR NFL+ Q 
Sbjct  752  QSSDFIKEYIFPGGCLPSLTRIASAMSAASRLCMEHVENIGIHYYQTLRYWRKNFLDNQG  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGN+ A G+P++G  SAY
Sbjct  812  KILALGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVLSRPGNIAALGNPFQGFPSAY  869



>ref|XP_010317817.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317818.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317819.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
Length=805

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +YDRIISC MLE VGH+F+ EFF  CES LAE G+LVLQFISIPDERY+EYR
Sbjct  625  YRQIPNKDKYDRIISCGMLEHVGHDFIGEFFTCCESALAEYGLLVLQFISIPDERYEEYR  684

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDF+KEYIFPGGC+P+LSRVTSAMAA+SRLCVEHLE+IGIHYYQTLRCWR NFL+ +S
Sbjct  685  QSSDFMKEYIFPGGCVPALSRVTSAMAAASRLCVEHLEEIGIHYYQTLRCWRENFLKNKS  744

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  FGDPY    S Y
Sbjct  745  QIRSLGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVAVFGDPYNYSPSTY  802



>dbj|BAB01742.1| unnamed protein product [Arabidopsis thaliana]
Length=793

 Score =   303 bits (775),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAE+G++VLQFIS P+ERY+EYR
Sbjct  613  YRQLSDAHKYDRIISCEMLEAVGHEFMEMFFSRCEAALAEDGLMVLQFISTPEERYNEYR  672

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPG C+PSL++VTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ 
Sbjct  673  LSSDFIKEYIFPGACVPSLAKVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQK  732

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  733  QIMALGFDDKFVRTWEYYFDYCAAGFKTRTLGDYQLVFSRPGNVAAFADSYRGFPSAY  790



>ref|XP_006406021.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
 gb|ESQ47474.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
Length=870

 Score =   304 bits (778),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LA++G++VLQFISIP+ERY+EYR
Sbjct  690  YRQLSDTQKYDRIISCEMLEAVGHEFMEMFFSRCEAALAQDGLIVLQFISIPEERYNEYR  749

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYY+TLR WR NFLERQ 
Sbjct  750  LSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYKTLRLWRKNFLERQK  809

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
             I+ LGFD +FIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGN+ AF D YKG  SAY
Sbjct  810  PIIALGFDDQFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNLAAFADSYKGFPSAY  867



>ref|XP_010488415.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Camelina sativa]
Length=455

 Score =   293 bits (750),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 152/174 (87%), Gaps = 2/174 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLE  GHEFM  FF  CE+ L E+GI ++QFISIP+ERY+EYR
Sbjct  272  YRQLSDAQKYDRIISCEMLEHAGHEFMETFFSHCEAALTEDGITIIQFISIPEERYNEYR  331

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+R +
Sbjct  332  LNSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRHN  391

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYK  256
            QI+DLGFD KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGNV AFG  DP++
Sbjct  392  QIMDLGFDDKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNVAAFGDDDPFR  445



>ref|XP_004234691.1| PREDICTED: uncharacterized protein LOC101256851 isoform X1 [Solanum 
lycopersicum]
Length=868

 Score =   304 bits (778),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +YDRIISC MLE VGH+F+ EFF  CES LAE G+LVLQFISIPDERY+EYR
Sbjct  688  YRQIPNKDKYDRIISCGMLEHVGHDFIGEFFTCCESALAEYGLLVLQFISIPDERYEEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDF+KEYIFPGGC+P+LSRVTSAMAA+SRLCVEHLE+IGIHYYQTLRCWR NFL+ +S
Sbjct  748  QSSDFMKEYIFPGGCVPALSRVTSAMAAASRLCVEHLEEIGIHYYQTLRCWRENFLKNKS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  FGDPY    S Y
Sbjct  808  QIRSLGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVAVFGDPYNYSPSTY  865



>ref|XP_002314493.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEF00664.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=869

 Score =   303 bits (777),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YD IISCEM+EAVGHE+M EFFG CESVLAENG+ VLQFISIP+ERYDEYR
Sbjct  692  YRQLPKTHKYDTIISCEMIEAVGHEYMEEFFGCCESVLAENGLFVLQFISIPEERYDEYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q 
Sbjct  752  KSSDFIKEYIFPGGCLPSLTRITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQR  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            + L LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  812  ETLSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVVALSNPYRGFPSAY  869



>ref|XP_007035209.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035210.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035211.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06135.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06136.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06137.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
Length=865

 Score =   303 bits (776),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M +FF  CESVLAE+G+LVLQFISIP+ERYDEYR
Sbjct  688  YRQLPSTNKYDRIISCEMVEAVGHEYMEDFFSCCESVLAEDGLLVLQFISIPEERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE+QS
Sbjct  748  RSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCVEHVENIGLHYYQTLRHWRKNFLEKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK   +A
Sbjct  808  KILALGFNEKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYKRFPTA  864



>emb|CDX92987.1| BnaA03g37090D [Brassica napus]
Length=876

 Score =   303 bits (776),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR
Sbjct  698  YRQLSDAHKYDRIISCEMLEAVGHEFMETFFRHCEAALAEDGIFVLQFISIPEERYDEYR  757

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ 
Sbjct  758  LSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQK  817

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP++   SA
Sbjct  818  QINDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFRSFPSA  874



>ref|XP_009135859.1| PREDICTED: uncharacterized protein LOC103860003 [Brassica rapa]
Length=870

 Score =   303 bits (776),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR
Sbjct  692  YRQLSDAHKYDRIISCEMLEAVGHEFMETFFRHCEAALAEDGIFVLQFISIPEERYDEYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ 
Sbjct  752  LSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQK  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP++   SA
Sbjct  812  QINDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFRSFPSA  868



>ref|XP_011470580.1| PREDICTED: sterol 24-C-methyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=270

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR LP N +YDRI+SCEM+E VGHE+M EFF  C+S LAENG+LVLQF S+PDE YDEYR
Sbjct  93   YRTLPKNYKYDRIVSCEMVEHVGHEYMEEFFACCDSALAENGLLVLQFTSLPDELYDEYR  152

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +   FI+EYI PGGCLPSLSR+T+AMAASSRL VEHLE+IG HYY+TL+ WR NFLE+QS
Sbjct  153  RCPSFIREYILPGGCLPSLSRLTAAMAASSRLSVEHLENIGSHYYRTLKYWRKNFLEKQS  212

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I  LGFD KFIRTWEYYFDYCAAGF+ CTLG+YQIVFSRPGNV    DPYKG  SAY
Sbjct  213  EIQALGFDDKFIRTWEYYFDYCAAGFNACTLGNYQIVFSRPGNVVLLNDPYKGFPSAY  270



>ref|XP_010670961.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010670962.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=866

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLPD  +Y+RIISCEMLEAVGHE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR
Sbjct  689  YRQLPDVHKYNRIISCEMLEAVGHEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYR  748

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS
Sbjct  749  RSSDFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQS  808

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  253
            +I  LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  809  KIHSLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  861



>ref|NP_188993.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 dbj|BAC41919.1| putative cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis 
thaliana]
 gb|AEE76772.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF RCE+ LAE+G++VLQFIS P+ERY+EYR
Sbjct  687  YRQLSDAHKYDRIISCEMLEAVGHEFMEMFFSRCEAALAEDGLMVLQFISTPEERYNEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPG C+PSL++VTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ 
Sbjct  747  LSSDFIKEYIFPGACVPSLAKVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQK  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+ LGFD KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  807  QIMALGFDDKFVRTWEYYFDYCAAGFKTRTLGDYQLVFSRPGNVAAFADSYRGFPSAY  864



>emb|CDX77513.1| BnaA07g06510D [Brassica napus]
Length=778

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR
Sbjct  600  YRQLSDARKYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYR  659

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q 
Sbjct  660  LNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQK  719

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  720  QIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  777



>ref|XP_002528810.1| methyltransferase, putative [Ricinus communis]
 gb|EEF33544.1| methyltransferase, putative [Ricinus communis]
Length=865

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLPD C+YDRIISCEM+EAVGHE+M +FF  CESVLA++G++VLQFISIP+ERY+EYR
Sbjct  688  YRQLPDTCKYDRIISCEMIEAVGHEYMEKFFSCCESVLAKDGVIVLQFISIPEERYEEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+T+AMAAS+RLCVEH+E+IGIHYYQTLR WR NF+E +S
Sbjct  748  RSSDFIKEYIFPGGCLPSLTRITTAMAASTRLCVEHVENIGIHYYQTLRYWRKNFVENKS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I+ LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGNV A G+PYK   +A
Sbjct  808  KIMALGFNEKFIRTWEYYFDYCAAGFKTLTLGNYQVVLSRPGNVAALGNPYKEFPAA  864



>ref|XP_006354535.1| PREDICTED: pavine N-methyltransferase-like [Solanum tuberosum]
Length=439

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 151/179 (84%), Gaps = 1/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +YDRII CE+LE VGHEF+ EFF  CES L E+G+LVLQFIS+PD  YDEYR
Sbjct  261  YRQMPNQDKYDRIIVCEVLEHVGHEFIGEFFSCCESALTEDGLLVLQFISMPDPMYDEYR  320

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S+ FI EYIFPGGCLP+LSRVTSAMAA+SRLCV HLEDIG+HYYQTLRCWR NFL+ +S
Sbjct  321  HSAGFINEYIFPGGCLPALSRVTSAMAAASRLCVVHLEDIGVHYYQTLRCWRKNFLKNKS  380

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK-GLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGNV  FGDPY   + SAY
Sbjct  381  QIHALGFDDKFIRTWEYYFDYCAAGFKTHTLGDYQIVFSRPGNVATFGDPYNVTMPSAY  439



>ref|XP_006406026.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
 gb|ESQ47479.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
Length=855

 Score =   302 bits (773),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL +  +YDRIISCEMLEAVGHEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR
Sbjct  677  YRQLSNAHKYDRIISCEMLEAVGHEFMETFFTHCEAALAEDGIFVLQFISIPEERYDEYR  736

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLER+ 
Sbjct  737  LSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRSWRKTFLEREK  796

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI+DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP+    SA
Sbjct  797  QIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFHSFPSA  853



>ref|XP_002314494.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
 gb|EEF00665.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
Length=460

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   +YDRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR
Sbjct  279  YRELPKGYKYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYR  338

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S
Sbjct  339  RSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKS  398

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL +GFD+KFIRTWEYYFDY +AGF + TL DYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  399  KILAMGFDEKFIRTWEYYFDYSSAGFKSYTLRDYQVVFSRPGNVEALGNPYKGFPSAY  456



>ref|XP_011030435.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
 ref|XP_011030436.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
Length=869

 Score =   301 bits (772),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVL ENG+ VLQFISIP+ERYD YR
Sbjct  692  YRQLPMTHKYDRIISCEMIEAVGHEYMEEFFGCCESVLDENGLFVLQFISIPEERYDLYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSL+++TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q 
Sbjct  752  QSSDFIKEYIFPGGCLPSLTKITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQR  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  812  EILSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVAALSNPYRGFPSAY  869



>ref|XP_011030438.1| PREDICTED: uncharacterized protein LOC105129890 isoform X3 [Populus 
euphratica]
Length=868

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVL ENG+ VLQFISIP+ERYD YR
Sbjct  691  YRQLPMTHKYDRIISCEMIEAVGHEYMEEFFGCCESVLDENGLFVLQFISIPEERYDLYR  750

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSL+++TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q 
Sbjct  751  QSSDFIKEYIFPGGCLPSLTKITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQR  810

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  811  EILSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVAALSNPYRGFPSAY  868



>emb|CDX94854.1| BnaC03g43340D [Brassica napus]
Length=892

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLEAVGHEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR
Sbjct  716  YRQLSDAHKYDRIISCEMLEAVGHEFMETFFRHCEAALAEDGIFVLQFISIPEERYDEYR  775

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ 
Sbjct  776  LSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQK  835

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP +   SA
Sbjct  836  QINDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPSRSFPSA  892



>gb|KGN61575.1| hypothetical protein Csa_2G171960 [Cucumis sativus]
Length=273

 Score =   284 bits (726),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISC MLE VGHEFM +FFG CES L ENG+LVLQFIS+PD++YDE+R
Sbjct  93   YRQLPNTHKYDRIISCGMLECVGHEFMEDFFGSCESALVENGLLVLQFISMPDDQYDEHR  152

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SS F++EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + 
Sbjct  153  LSSGFMREYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKR  212

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I++LGFD+ FIRTWEYYFDYCAAGF +  +GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  213  KIIELGFDESFIRTWEYYFDYCAAGFKSRIIGDYQIVFSRAGNVTTFNNPYQGIPSA  269



>ref|XP_004169418.1| PREDICTED: cyclopropane-fatty-acyl-phospholipid synthase-like, 
partial [Cucumis sativus]
Length=577

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISC +LE+VGHEFM +FFG CESVL ENG+LV+QFIS+PD+RYDE+R
Sbjct  397  YRQLPNTHKYDRIISCGLLESVGHEFMEDFFGLCESVLVENGLLVVQFISMPDDRYDEHR  456

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDF++EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + 
Sbjct  457  LSSDFMREYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKR  516

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I++LGFD+ FIRTWEYYFDYCAAGF + T+GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  517  KIIELGFDESFIRTWEYYFDYCAAGFKSRTIGDYQIVFSRAGNVTTFNNPYQGIPSA  573



>ref|XP_009102616.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
 ref|XP_009102617.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
Length=871

 Score =   300 bits (768),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR
Sbjct  693  YRQLSDARKYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYR  752

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q 
Sbjct  753  LNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQK  812

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  813  QIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  870



>ref|XP_002528379.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF34051.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=372

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLPD  + DRIISCEMLEAVGHE+M E+FG CESVLA++G++VLQF SIP+ERY+EYR
Sbjct  196  YRQLPDTYKCDRIISCEMLEAVGHEYMEEYFGCCESVLADDGLIVLQFTSIPEERYEEYR  255

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSD IKEYIFPG C+PSL+R+T AMAAS+RLCVEH+E+IG+HYYQTLR WR NFLE +S
Sbjct  256  RSSDVIKEYIFPGTCVPSLTRITIAMAASTRLCVEHVENIGMHYYQTLRLWRKNFLESKS  315

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I  LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGNV A G+PY    +A
Sbjct  316  KITALGFNEKFIRTWEYYFDYCAAGFKTLTLGNYQVVLSRPGNVAALGNPYNEFPAA  372



>ref|XP_009388106.1| PREDICTED: uncharacterized protein LOC103974927, partial [Musa 
acuminata subsp. malaccensis]
Length=341

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISCEM+E VGHE+M +FFG CES+LAE+GI VLQFISIPDERYDEYR
Sbjct  163  YRQLPNYNKYDRIISCEMIEGVGHEYMEQFFGCCESLLAEDGIFVLQFISIPDERYDEYR  222

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL R+T+AM ASSR C+EHLE+IGIHY QTLRCWR N    + 
Sbjct  223  RSSDFIKEYIFPGGCLPSLGRITTAMVASSRFCIEHLENIGIHYNQTLRCWRNNIFANKE  282

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGFD+KF RTWEYYF YCAAGF +CTL +YQIVFSRPGN+ AFG P+  + + 
Sbjct  283  KILALGFDEKFFRTWEYYFMYCAAGFKSCTLANYQIVFSRPGNLRAFGGPFNSIPAT  339



>ref|XP_004495453.1| PREDICTED: uncharacterized protein LOC101501999 [Cicer arietinum]
Length=864

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 159/174 (91%), Gaps = 2/174 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   ++DRIISCEM+EAVGHE+M EFFG CES+LA++G+LVLQFISIPDERYDEYR
Sbjct  688  YRQLPKTYKFDRIISCEMIEAVGHEYMEEFFGCCESLLADDGLLVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC--VEHLEDIGIHYYQTLRCWRANFLER  418
            +SSDFIKEYIFPGGCLPSLSR+TSAMA++S+LC  VEH+E++GIHYYQTLR WR NFLER
Sbjct  748  RSSDFIKEYIFPGGCLPSLSRITSAMASTSKLCCSVEHVENMGIHYYQTLRWWRKNFLER  807

Query  417  QSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            QS+ILDLGF++KFIRTWEYYFDYC  GF + TLG+YQ+VFSRPGNVT F DPYK
Sbjct  808  QSEILDLGFNEKFIRTWEYYFDYCGGGFKSRTLGNYQVVFSRPGNVTTFSDPYK  861



>ref|XP_010023868.1| PREDICTED: uncharacterized protein LOC104414445 [Eucalyptus grandis]
 gb|KCW60265.1| hypothetical protein EUGRSUZ_H02975 [Eucalyptus grandis]
Length=865

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFF  CESVLA+NG+LVLQFISIPDERYDE+R
Sbjct  688  YRQLPSTYKYDRIISCEMIEAVGHEYMEEFFSCCESVLAKNGLLVLQFISIPDERYDEHR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SS F+KEYIFPGGCLPSLSR+TSAMA++SRLCVEHL++IGIHYYQTL+CWR NFLE++ 
Sbjct  748  RSSSFMKEYIFPGGCLPSLSRITSAMASASRLCVEHLDNIGIHYYQTLQCWRKNFLEKKR  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGF+++FIRTWEYYFDYCAAGF + TLG+YQIVFSRPGN  AF DPY G  S+
Sbjct  808  KILALGFNEEFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNDAAFADPYVGFLSS  864



>ref|XP_004173332.1| PREDICTED: LOW QUALITY PROTEIN: probable fatty acid methyltransferase-like, 
partial [Cucumis sativus]
Length=325

 Score =   283 bits (724),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR +P   +YDRIISCEM+EAVGHEFM +FFG CESVLAENGI V QF ++PD RYD YR
Sbjct  148  YRNVPSTXKYDRIISCEMIEAVGHEFMEDFFGTCESVLAENGIFVQQFTAMPDARYDAYR  207

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SS+FIKEYIFPGGCLP LSRVT+AM  +SR C+EHLE+IGIHY+QTLR WR +FLE +S
Sbjct  208  LSSEFIKEYIFPGGCLPCLSRVTTAMTKASRFCIEHLENIGIHYHQTLRYWRKDFLENKS  267

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+ FIRTWEYYFDYCAAGF + TL +YQIV+SRPGNV  F +PY+G  SAY
Sbjct  268  KILQLGFDESFIRTWEYYFDYCAAGFKSRTLNNYQIVYSRPGNVAVFNNPYQGFPSAY  325



>gb|KDO40332.1| hypothetical protein CISIN_1g0240962mg [Citrus sinensis]
Length=272

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISC M+E VGH++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR
Sbjct  93   YRQLPKANKYDRIISCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYR  152

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS
Sbjct  153  LSPGFIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQS  212

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  213  EILALGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  270



>emb|CDX77514.1| BnaA07g06520D [Brassica napus]
Length=803

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR
Sbjct  625  YRQLSDAKKYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYR  684

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q 
Sbjct  685  LNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQK  744

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  745  QIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  802



>gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M +FFG CESVLA++G+LVLQFISIP+ERY+EYR
Sbjct  688  YRQLPSTYKYDRIISCEMIEAVGHEYMEDFFGCCESVLADDGLLVLQFISIPEERYNEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+T+AM A+S+LCVEH+E+IG+HYYQTLR WR NFLE+QS
Sbjct  748  RSSDFIKEYIFPGGCLPSLARITTAMNAASKLCVEHVENIGLHYYQTLRYWRKNFLEKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I  LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK   SA
Sbjct  808  KIHALGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVVALGNPYKDFPSA  864



>gb|KJB28514.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=865

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M +FFG CESVLA++G+LVLQFISIP+ERY+EYR
Sbjct  688  YRQLPSTYKYDRIISCEMIEAVGHEYMEDFFGCCESVLADDGLLVLQFISIPEERYNEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+T+AM A+S+LCVEH+E+IG+HYYQTLR WR NFLE+QS
Sbjct  748  RSSDFIKEYIFPGGCLPSLARITTAMNAASKLCVEHVENIGLHYYQTLRYWRKNFLEKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I  LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK   SA
Sbjct  808  KIHALGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVVALGNPYKDFPSA  864



>gb|KCW60259.1| hypothetical protein EUGRSUZ_H029682, partial [Eucalyptus grandis]
Length=458

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFF  CESVLA++G+LVLQF SIPDERY+EYR
Sbjct  281  YRQLPSAYKYDRIISCEMIEAVGHEYMEEFFSCCESVLAKDGLLVLQFTSIPDERYEEYR  340

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPG C+PSLSR+TSAMA++SRL VEH+++IGIH+YQTLRCWR NF+E+Q 
Sbjct  341  QSSDFIKEYIFPGCCVPSLSRITSAMASASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQR  400

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  259
            +IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGN  AF D Y
Sbjct  401  KILALGFNEKFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNEAAFTDLY  451



>ref|XP_008796359.1| PREDICTED: uncharacterized protein LOC103711840 isoform X6 [Phoenix 
dactylifera]
Length=558

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGHE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR
Sbjct  381  YRQLPCYRKYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYR  440

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + 
Sbjct  441  RSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKC  500

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  501  KILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  557



>gb|KJB38366.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=802

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M+EFFG CESVLAE+G+ VLQFISIP+ERY+ YR
Sbjct  625  YRQLPSTYKYDRIISCEMIEAVGHEYMDEFFGCCESVLAEDGLFVLQFISIPEERYNGYR  684

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS
Sbjct  685  RSSDFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQS  744

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +I+ LGF++KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  745  KIMSLGFNEKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  796



>gb|KHG28468.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=828

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M+EFFG CESVLAE+G+ VLQFISIP+ERY+ YR
Sbjct  651  YRQLPSTYKYDRIISCEMIEAVGHEYMDEFFGCCESVLAEDGLFVLQFISIPEERYNGYR  710

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS
Sbjct  711  RSSDFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQS  770

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +I+ LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  771  KIMSLGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  822



>gb|KJB38367.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=865

 Score =   296 bits (757),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M+EFFG CESVLAE+G+ VLQFISIP+ERY+ YR
Sbjct  688  YRQLPSTYKYDRIISCEMIEAVGHEYMDEFFGCCESVLAEDGLFVLQFISIPEERYNGYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS
Sbjct  748  RSSDFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +I+ LGF++KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  808  KIMSLGFNEKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  859



>gb|KHG28467.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=833

 Score =   295 bits (755),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M+EFFG CESVLAE+G+ VLQFISIP+ERY+ YR
Sbjct  656  YRQLPSTYKYDRIISCEMIEAVGHEYMDEFFGCCESVLAEDGLFVLQFISIPEERYNGYR  715

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS
Sbjct  716  RSSDFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQS  775

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +I+ LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  776  KIMSLGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  827



>ref|XP_010023867.1| PREDICTED: uncharacterized protein LOC104414444 [Eucalyptus grandis]
 gb|KCW60266.1| hypothetical protein EUGRSUZ_H02976 [Eucalyptus grandis]
Length=865

 Score =   296 bits (757),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFF  CESVLA++G++VLQFISIPDERYDEYR
Sbjct  688  YRQLPSTYKYDRIISCEMIEAVGHEYMEEFFSCCESVLAKDGLVVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAMA++SRLCVEHL++IGIHYYQTL+CWR NF+E++ 
Sbjct  748  RSSDFIKEYIFPGGCLPSLSRITSAMASASRLCVEHLDNIGIHYYQTLQCWRKNFMEKKR  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGF+++FIRTWEYYFDYCAAGF   TLG+YQIVFSRPGN  AF DPY    S+
Sbjct  808  KILALGFNEEFIRTWEYYFDYCAAGFKLHTLGNYQIVFSRPGNDDAFADPYVSFPSS  864



>ref|XP_009102765.1| PREDICTED: uncharacterized protein LOC103828879 [Brassica rapa]
Length=862

 Score =   296 bits (757),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR
Sbjct  684  YRQLSDARKYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYR  743

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q 
Sbjct  744  LNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQK  803

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  804  QIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  861



>ref|XP_002314497.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
 gb|EEF00668.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
Length=464

 Score =   286 bits (731),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP+  +YDRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR
Sbjct  283  YRELPEGYKYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYR  342

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S
Sbjct  343  RSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKS  402

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL +GFD+KFIRTWEYYFDY AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  403  KILAMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  460



>gb|KDO54091.1| hypothetical protein CISIN_1g0146251mg, partial [Citrus sinensis]
Length=389

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YDEYR
Sbjct  210  YRQLPKANKYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYR  269

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS
Sbjct  270  LSPGFLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQS  329

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPG+V AF +PY+GL SAY
Sbjct  330  EILALGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGDVAAFSNPYEGLPSAY  387



>ref|XP_010529627.1| PREDICTED: uncharacterized protein LOC104806424 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529635.1| PREDICTED: uncharacterized protein LOC104806424 isoform X2 [Tarenaya 
hassleriana]
Length=873

 Score =   295 bits (755),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIIS EMLE VGHEF+  FF RCESVLAE+G+LVLQ ISIP+ERYDEYR
Sbjct  688  YRQLSDSRKYDRIISIEMLEEVGHEFIETFFNRCESVLAEDGLLVLQTISIPEERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGC+ SL+R+TSAMA+SSRLC+E +E+IGIHYY+TLRCWR N LERQ 
Sbjct  748  LSSDFIKEYIFPGGCILSLARITSAMASSSRLCIEQVENIGIHYYRTLRCWRQNLLERQK  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I+DLGFD+KFIRTWEYYFDY AAGF T TLGDYQ+VFSRPGN   FGDPY+G  SA
Sbjct  808  RIVDLGFDEKFIRTWEYYFDYSAAGFKTLTLGDYQMVFSRPGNAALFGDPYRGFPSA  864



>gb|KFK39641.1| hypothetical protein AALP_AA3G270000 [Arabis alpina]
Length=438

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VG +F   FF  CE+ LAE+GI VLQFISIP+ERY+EYR
Sbjct  265  YRQLSDAKKYDRIISCEMIEHVGDKFFETFFSHCEAALAEDGIFVLQFISIPEERYNEYR  324

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFI+EYIFPGGCLPSL+RVTSAM++SSRLC+E +E+IGIHYY TL+ WR NFLE+Q 
Sbjct  325  LNSDFIREYIFPGGCLPSLARVTSAMSSSSRLCIESVENIGIHYYHTLKYWRKNFLEKQK  384

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  259
            +I+DLGF+ KFIRTWEYYFDYCAAGF T TLGDYQ+VFSRPGNV AFGDP+
Sbjct  385  EIMDLGFNDKFIRTWEYYFDYCAAGFKTLTLGDYQVVFSRPGNVAAFGDPF  435



>ref|XP_008796357.1| PREDICTED: uncharacterized protein LOC103711840 isoform X4 [Phoenix 
dactylifera]
Length=684

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGHE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR
Sbjct  507  YRQLPCYRKYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYR  566

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + 
Sbjct  567  RSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKC  626

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  627  KILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  683



>ref|XP_009586644.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
 ref|XP_009586645.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
Length=747

 Score =   290 bits (743),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +Y RIIS EM+E VGHEFM+EFF  CES LAE+G+LV+QF S+PDERYDEYR
Sbjct  570  YRQMPNKDKYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVVQFTSVPDERYDEYR  629

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QS
Sbjct  630  HSIGFIKEYIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQS  689

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI  LGFD KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  690  QIRVLGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  746



>ref|XP_006857466.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
 gb|ERN18933.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
Length=866

 Score =   293 bits (750),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP + +YDRIISCEM+EAVGHE++ EF  RC+S LAENGILVLQFISIPD+RYDEYR
Sbjct  688  YRQLPASHKYDRIISCEMIEAVGHEYIEEFLMRCDSHLAENGILVLQFISIPDQRYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPS SR+TSAMAA S+LCVEH+E+IGIHYYQTL  WR NF+  +S
Sbjct  748  RSSDFIKEYIFPGGCLPSFSRLTSAMAAVSKLCVEHVENIGIHYYQTLIKWRDNFMANKS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +I++LGFD+KFIRTWEYYF YCAAGF +CTL DYQ+VFSRPGNV AFG+PYK
Sbjct  808  KIMELGFDEKFIRTWEYYFIYCAAGFKSCTLEDYQVVFSRPGNVNAFGNPYK  859



>ref|XP_008796358.1| PREDICTED: uncharacterized protein LOC103711840 isoform X5 [Phoenix 
dactylifera]
Length=683

 Score =   289 bits (739),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGHE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR
Sbjct  506  YRQLPCYRKYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYR  565

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + 
Sbjct  566  RSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKC  625

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  626  KILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  682



>ref|NP_188989.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAV84488.1| At3g23470 [Arabidopsis thaliana]
 gb|AAW30030.1| At3g23470 [Arabidopsis thaliana]
 gb|AEE76768.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=461

 Score =   283 bits (723),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRII+CEM+EAVGHEFM++FF  CE  LAENGI VLQF +IP+  YDE R
Sbjct  279  YRQLSDARKYDRIIACEMIEAVGHEFMDKFFSCCEDALAENGIFVLQFTAIPEALYDESR  338

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +S FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLRCWR NFLERQ 
Sbjct  339  LTSGFITEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYHTLRCWRKNFLERQK  398

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD  265
            QI+DLGFD KFIRTWEYYFDYCAAGF T TL  YQIVFSRPGNV AFGD
Sbjct  399  QIIDLGFDDKFIRTWEYYFDYCAAGFKTLTLRSYQIVFSRPGNVAAFGD  447



>ref|XP_004247760.1| PREDICTED: uncharacterized protein LOC101261068 [Solanum lycopersicum]
Length=436

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +YDRII CE+LE VGHEF+ EFF  CES LAE+G+LVLQFIS+PD  YDE R
Sbjct  261  YRQMPNKDKYDRIIVCEVLEHVGHEFIGEFFSCCESALAEDGLLVLQFISLPDTMYDENR  320

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SS FIKEYIFPGG LP+LSRVTSAMA++SRLCV HLEDIG+HYYQTLRCWR NFL  +S
Sbjct  321  LSSGFIKEYIFPGGYLPALSRVTSAMASASRLCVVHLEDIGVHYYQTLRCWRKNFLNNKS  380

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PYK  256
            QI  LGFD+KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGNV  FGD PY 
Sbjct  381  QIRALGFDEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNVATFGDHPYN  433



>ref|XP_006299255.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
 gb|EOA32153.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
Length=424

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRII+CEM+EAVGHEFM +FF  CE+ LA+NGI VLQF +IP++ YDE R
Sbjct  242  YRQLSDARKYDRIIACEMIEAVGHEFMEKFFSCCEAALAQNGIFVLQFTAIPEKLYDESR  301

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SS FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+ GIHYY TLRCWR NFLERQ 
Sbjct  302  LSSGFITEYIFPGGCLPSLARVTSAMASSSRLCIENVENFGIHYYHTLRCWRKNFLERQK  361

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD  265
            QI+DLGFD KFIRTWEYYFDYCAAGF T TL +YQIVFSRPGN+ AFGD
Sbjct  362  QIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLKNYQIVFSRPGNLAAFGD  410



>ref|XP_009586642.1| PREDICTED: uncharacterized protein LOC104084479 isoform X3 [Nicotiana 
tomentosiformis]
Length=864

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +Y RIIS EM+E VGHEFM+EFF  CES LAE+G+LV+QF S+PDERYDEYR
Sbjct  687  YRQMPNKDKYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVVQFTSVPDERYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QS
Sbjct  747  HSIGFIKEYIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQS  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI  LGFD KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  807  QIRVLGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  863



>ref|XP_009586641.1| PREDICTED: uncharacterized protein LOC104084479 isoform X2 [Nicotiana 
tomentosiformis]
Length=864

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +Y RIIS EM+E VGHEFM+EFF  CES LAE+G+LV+QF S+PDERYDEYR
Sbjct  687  YRQMPNKDKYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVVQFTSVPDERYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QS
Sbjct  747  HSIGFIKEYIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQS  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI  LGFD KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  807  QIRVLGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  863



>ref|XP_006489667.1| PREDICTED: uncharacterized protein LOC102613225 isoform X2 [Citrus 
sinensis]
Length=603

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YDEYR
Sbjct  424  YRQLPKANKYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYR  483

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS
Sbjct  484  LSPGFLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQS  543

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SAY
Sbjct  544  EILALGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSAY  601



>ref|XP_002314496.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
 gb|EEF00667.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
Length=460

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   +YDRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR
Sbjct  279  YRELPQGYKYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYR  338

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPG C+PSLSR+TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S
Sbjct  339  RSSDFIKEYIFPGACVPSLSRITSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKS  398

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL +GFD+KFIRTWEYYFDY AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  399  KILAMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  456



>ref|XP_008796356.1| PREDICTED: uncharacterized protein LOC103711840 isoform X3 [Phoenix 
dactylifera]
Length=811

 Score =   289 bits (739),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGHE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR
Sbjct  634  YRQLPCYRKYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYR  693

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + 
Sbjct  694  RSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKC  753

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  754  KILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  810



>ref|XP_006378321.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
 gb|ERP56118.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
Length=466

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   +YDRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQ ISI DE YDE+R
Sbjct  285  YRELPKGYKYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQSISIADECYDEHR  344

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SS F++EYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR  FLE +S
Sbjct  345  RSSCFMREYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKTFLENKS  404

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL +GFD+KFIRTWEYYFDYCAAGF + TLGDYQIVFSRPGNV   G+PYKG  SAY
Sbjct  405  KILAMGFDEKFIRTWEYYFDYCAAGFKSYTLGDYQIVFSRPGNVGVLGNPYKGFPSAY  462



>ref|XP_008796355.1| PREDICTED: uncharacterized protein LOC103711840 isoform X2 [Phoenix 
dactylifera]
Length=864

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGHE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR
Sbjct  687  YRQLPCYRKYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + 
Sbjct  747  RSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKC  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  807  KILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  863



>ref|XP_008796354.1| PREDICTED: uncharacterized protein LOC103711840 isoform X1 [Phoenix 
dactylifera]
Length=865

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGHE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR
Sbjct  688  YRQLPCYRKYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + 
Sbjct  748  RSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKC  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  808  KILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  864



>ref|XP_004169247.1| PREDICTED: uncharacterized protein LOC101225338, partial [Cucumis 
sativus]
Length=800

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISC MLE VGHEFM +FFG CES L ENG+LVLQFIS+PD++YDE+R
Sbjct  620  YRQLPNTPKYDRIISCGMLECVGHEFMEDFFGSCESALVENGLLVLQFISMPDDQYDEHR  679

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SS F++EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + 
Sbjct  680  LSSGFMREYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKR  739

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I++LGFD+ FIRTWEYYFDYCAAGF +  +GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  740  KIIELGFDESFIRTWEYYFDYCAAGFKSRIIGDYQIVFSRAGNVTTFNNPYQGIPSA  796



>ref|XP_006489666.1| PREDICTED: uncharacterized protein LOC102613225 isoform X1 [Citrus 
sinensis]
Length=674

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YDEYR
Sbjct  495  YRQLPKANKYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYR  554

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS
Sbjct  555  LSPGFLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQS  614

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SAY
Sbjct  615  EILALGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSAY  672



>ref|XP_007035221.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
 gb|EOY06147.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
Length=858

 Score =   288 bits (737),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLPD  +YDRIISCEM+E +G E++ +FF  CES LAE+G+LVLQFISIP+ER++EYR
Sbjct  681  YRQLPDTRKYDRIISCEMIEHLGDEYVEQFFRCCESALAEDGLLVLQFISIPEERFEEYR  740

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+ + MAA+SRLCVEH+E+IG++YY TLRCWR NFLE QS
Sbjct  741  RSSDFIKEYIFPGGCLPSLNRIVTGMAAASRLCVEHVENIGMNYYLTLRCWRKNFLENQS  800

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGN  A G PY+G  SAY
Sbjct  801  KILALGFDEKFMRTWEYYFDYCAAGFRTYTLGDYQVVFSRPGNYKALGYPYQGFPSAY  858



>ref|XP_010532684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Tarenaya hassleriana]
Length=389

 Score =   276 bits (705),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIISCEM+EAVGH+FM  FF RCES LAE G+LVLQF ++PD RYDE R
Sbjct  208  YRQLSDSRKYDRIISCEMIEAVGHKFMETFFNRCESALAEEGLLVLQFSAVPDSRYDESR  267

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FI EYIFPG C PSL+RVTSAMA+SSRLC+EH+E+IGIHY++TLRCWR NFL+RQ 
Sbjct  268  LSPGFITEYIFPGACHPSLARVTSAMASSSRLCIEHVENIGIHYHKTLRCWRQNFLKRQE  327

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPGN T FGDPY    SA
Sbjct  328  EVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPGNTTMFGDPYMSYPSA  384



>ref|XP_011041574.1| PREDICTED: uncharacterized protein LOC105137508 [Populus euphratica]
Length=668

 Score =   283 bits (725),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP   +YD I+SCEM+E VGHE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR
Sbjct  245  YRELPKGYKYDIIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYR  304

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S
Sbjct  305  RSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKS  364

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL +GFD+KFIRTWEYYFDYCAAGF + TL +YQIVFSRPGNV   G+PYKG  SAY
Sbjct  365  KILAMGFDEKFIRTWEYYFDYCAAGFKSYTLWNYQIVFSRPGNVGVLGNPYKGFPSAY  422



>ref|XP_006350407.1| PREDICTED: uncharacterized protein LOC102579763 isoform X1 [Solanum 
tuberosum]
Length=866

 Score =   287 bits (735),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 150/179 (84%), Gaps = 1/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIIS  M+E VGH++M EFF  CES L E+G+L LQFIS+PD RYDEYR
Sbjct  688  YRQIPSKDKYDRIISIGMIEHVGHDYMEEFFTCCESALTEDGLLALQFISMPDGRYDEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S+ FIKEYIFPGGCLPSLSRVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR NF + +S
Sbjct  748  HSTGFIKEYIFPGGCLPSLSRVTSAMAATSRLCVVHLEEIGIHYYQTLRCWRKNFQKNKS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK-GLASAY  238
            QI  LGFD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  FGDPY   + SAY
Sbjct  808  QIHALGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVATFGDPYNDTMPSAY  866



>ref|XP_010532680.1| PREDICTED: uncharacterized protein LOC104808649 [Tarenaya hassleriana]
Length=868

 Score =   287 bits (735),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRII+C M+EAVGHEFM  FF RCE VLAE+G+LVLQFI++PD RYDE R
Sbjct  687  YRQLSDSRKYDRIIACGMIEAVGHEFMEIFFNRCEVVLAEDGLLVLQFITVPDSRYDEIR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FI EYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYY+TLRCWR NF ERQ 
Sbjct  747  LSPGFITEYIFPGGCLPSLTRVTSAMASSSRLCIEHVENIGIHYYKTLRCWRQNFKERQE  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I  +GFD+KFIR WEYYFDYCAAGF T T+GDYQ+VFSRPGN   FGDPY    SA
Sbjct  807  EIKAIGFDEKFIRKWEYYFDYCAAGFKTLTVGDYQVVFSRPGNTATFGDPYMNFPSA  863



>ref|XP_010532681.1| PREDICTED: uncharacterized protein LOC104808651 [Tarenaya hassleriana]
Length=871

 Score =   287 bits (735),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            Y QL D+ +YDRIISC M+E VGHEFM  FF RCES LAE G+LVLQF+SIPD RYDE R
Sbjct  690  YHQLSDSRKYDRIISCGMIEHVGHEFMEAFFNRCESALAEEGLLVLQFVSIPDSRYDENR  749

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKE+IFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGI+YY+TLRCWR NFLERQ 
Sbjct  750  LSSDFIKEHIFPGGCLPSLARVTSAMASSSRLCIEHVENIGINYYKTLRCWRHNFLERQE  809

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            Q+  LGFD+KFIR WEYY DY AAGF T TLGDYQ+VFSRPGN   FGDPY    SA
Sbjct  810  QVKALGFDEKFIRKWEYYLDYFAAGFKTLTLGDYQVVFSRPGNTAVFGDPYMSFPSA  866



>ref|XP_006489664.1| PREDICTED: uncharacterized protein LOC102612222 isoform X3 [Citrus 
sinensis]
Length=674

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISC M+E VGH++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR
Sbjct  495  YRQLPKANKYDRIISCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYR  554

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS
Sbjct  555  LSPGFIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQS  614

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  615  EILALGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  672



>gb|KCW60262.1| hypothetical protein EUGRSUZ_H02971, partial [Eucalyptus grandis]
Length=807

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   RYDRIISCEM+EAVGHE+M EFFG CESVLA++G+ VLQFISIPDERY+EYR
Sbjct  630  YRQLPSAYRYDRIISCEMIEAVGHEYMEEFFGCCESVLAKDGLFVLQFISIPDERYEEYR  689

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSRVTSAMA++SRL VEH+++IGIHY+QTLRCWR NF+E+Q 
Sbjct  690  RSSDFIKEYIFPGGCLPSLSRVTSAMASASRLSVEHVDNIGIHYHQTLRCWRKNFMEKQR  749

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  259
            +IL  GF++KFIRTW+YYFDYCAAGF + TLG+YQIVF RPGN  AF D Y
Sbjct  750  KILAPGFNEKFIRTWQYYFDYCAAGFKSHTLGNYQIVFLRPGNDAAFTDLY  800



>ref|XP_010532682.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIISCEM+EAVGH+FM  FF RCES LAE G+LVLQF ++PD RYDE R
Sbjct  259  YRQLSDSRKYDRIISCEMIEAVGHKFMETFFNRCESALAEEGLLVLQFSAVPDSRYDESR  318

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FI EYIFPG C PSL+RVTSAMA+SSRLC+EH+E+IGIHY++TLRCWR NFL+RQ 
Sbjct  319  LSPGFITEYIFPGACHPSLARVTSAMASSSRLCIEHVENIGIHYHKTLRCWRQNFLKRQE  378

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPGN T FGDPY    SA
Sbjct  379  EVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPGNTTMFGDPYMSYPSA  435



>ref|XP_010023866.1| PREDICTED: uncharacterized protein LOC104414443 [Eucalyptus grandis]
Length=865

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFF  CESVLA++G+LVLQF SIPDERY+EYR
Sbjct  688  YRQLPSAYKYDRIISCEMIEAVGHEYMEEFFSCCESVLAKDGLLVLQFTSIPDERYEEYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPG C+PSLSR+TSAMA++SRL VEH+++IGIH+YQTLRCWR NF+E+Q 
Sbjct  748  QSSDFIKEYIFPGCCVPSLSRITSAMASASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQR  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  259
            +IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGN  AF D Y
Sbjct  808  KILALGFNEKFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNEAAFTDLY  858



>ref|XP_010532685.1| PREDICTED: uncharacterized protein LOC104808653 isoform X1 [Tarenaya 
hassleriana]
Length=887

 Score =   285 bits (729),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+  YDRIISCEMLEAVGHEFM  FF  CE+ LAE+G+LV+QF  IPD+RYDEYR
Sbjct  695  YRQLSDSRVYDRIISCEMLEAVGHEFMETFFRSCEAALAEDGLLVMQFAWIPDQRYDEYR  754

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIF GGCLPSL+R+TSAMA+SSRL ++ +E+IG+HYYQT+RCWR NF ER+ 
Sbjct  755  LSSDFIKEYIFHGGCLPSLARLTSAMASSSRLYIQQVENIGVHYYQTIRCWRKNFTERRR  814

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            QI+DLGFD+KFIRTWEYYFDYC+AGF T TLG+YQ+VFSR G+ +AFGDPY+   SAY
Sbjct  815  QIMDLGFDEKFIRTWEYYFDYCSAGFRTFTLGNYQMVFSRLGSTSAFGDPYRSFPSAY  872



>ref|XP_010936015.1| PREDICTED: uncharacterized protein LOC105055750 isoform X2 [Elaeis 
guineensis]
Length=683

 Score =   281 bits (718),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGHE+M EFFG CE +LAE+G+ VLQFISIPDERYDEYR
Sbjct  506  YRQLPCYQKYDRIISCEMIEGVGHEYMEEFFGCCELLLAEDGLFVLQFISIPDERYDEYR  565

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEY+FPGGC+PSLSR+TSAMAA+SR CVEH+E+IGIHYY+TLRCWR N ++ + 
Sbjct  566  RSSDFIKEYVFPGGCIPSLSRITSAMAATSRFCVEHVENIGIHYYETLRCWRNNLMQNKC  625

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  259
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN+TA G  Y
Sbjct  626  KILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNLTALGSLY  676



>gb|KGN61574.1| hypothetical protein Csa_2G171950 [Cucumis sativus]
Length=865

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR +P   +YDRIISCEM+EAVGHEFM +FFG CESVLAENGI V QF ++PD RYD YR
Sbjct  688  YRNVPSTKKYDRIISCEMIEAVGHEFMEDFFGTCESVLAENGIFVQQFTAMPDARYDAYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SS+FIKEYIFPGGCLP LSRVT+AM  +SR C+EHLE+IGIHY+QTLR WR +FLE +S
Sbjct  748  LSSEFIKEYIFPGGCLPCLSRVTTAMTKASRFCIEHLENIGIHYHQTLRYWRKDFLENKS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+ FIRTWEYYFDYCAAGF + TL +YQIV+SRPGNV  F +PY+G  SAY
Sbjct  808  KILQLGFDESFIRTWEYYFDYCAAGFKSRTLNNYQIVYSRPGNVAVFNNPYQGFPSAY  865



>ref|XP_006489663.1| PREDICTED: uncharacterized protein LOC102612222 isoform X2 [Citrus 
sinensis]
Length=779

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISC M+E VGH++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR
Sbjct  600  YRQLPKANKYDRIISCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYR  659

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS
Sbjct  660  LSPGFIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQS  719

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  720  EILALGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  777



>ref|XP_006489662.1| PREDICTED: uncharacterized protein LOC102612222 isoform X1 [Citrus 
sinensis]
Length=871

 Score =   283 bits (724),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISC M+E VGH++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR
Sbjct  692  YRQLPKANKYDRIISCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS
Sbjct  752  LSPGFIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQS  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  812  EILALGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  869



>ref|NP_001189954.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76770.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=492

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 147/177 (83%), Gaps = 2/177 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VGH+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R
Sbjct  256  YRQLCDTQKYDRIISCEMIEHVGHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESR  315

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +S FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ 
Sbjct  316  LTSGFITEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQK  375

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYKGLA  247
            QI+DLGFD+KF+RTWEYYFDYCAAGF T TL +YQIVFSRPGNV AFG  DP+   A
Sbjct  376  QIIDLGFDEKFLRTWEYYFDYCAAGFKTLTLRNYQIVFSRPGNVAAFGNDDPFHSSA  432



>ref|XP_010936014.1| PREDICTED: uncharacterized protein LOC105055750 isoform X1 [Elaeis 
guineensis]
Length=864

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+E VGHE+M EFFG CE +LAE+G+ VLQFISIPDERYDEYR
Sbjct  687  YRQLPCYQKYDRIISCEMIEGVGHEYMEEFFGCCELLLAEDGLFVLQFISIPDERYDEYR  746

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEY+FPGGC+PSLSR+TSAMAA+SR CVEH+E+IGIHYY+TLRCWR N ++ + 
Sbjct  747  RSSDFIKEYVFPGGCIPSLSRITSAMAATSRFCVEHVENIGIHYYETLRCWRNNLMQNKC  806

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  259
            +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN+TA G  Y
Sbjct  807  KILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNLTALGSLY  857



>ref|XP_002531842.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF30540.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=868

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP++ +YDRIISC M+E VGHE+M EFF  CESVLAE+G+LVLQFI+IPD+RYDE R
Sbjct  688  YRELPESYKYDRIISCGMIEHVGHEYMEEFFDCCESVLAEDGLLVLQFIAIPDKRYDEVR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +S DF+KEYIFPGGCLPSL R+TSAM  +SRLC+EH+E+IG +YY TL+CWR NFL+ + 
Sbjct  748  KSIDFLKEYIFPGGCLPSLYRITSAMRTASRLCMEHVENIGSNYYLTLKCWRKNFLKNKE  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL +GFD+KFIRTWEYYFDYCAAGF + TL DYQIVFSRPGN+ A G+PYKG  SAY
Sbjct  808  KILAMGFDEKFIRTWEYYFDYCAAGFKSYTLLDYQIVFSRPGNIAALGNPYKGFPSAY  865



>ref|XP_006406025.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
 gb|ESQ47478.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
Length=869

 Score =   280 bits (715),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL +  +YDRIISCEM+E +GHEFM  FF  CE+ LAE+GI+V QFI+IP+ERY+EYR
Sbjct  691  YRQLSNAHKYDRIISCEMMEHIGHEFMETFFSHCEAALAEDGIIVHQFIAIPEERYNEYR  750

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDF++EYIFPGGCLPSL+RVTSAMA+SSRLCVE++E+IG HYY+TLR WR NFLE + 
Sbjct  751  LNSDFVREYIFPGGCLPSLARVTSAMASSSRLCVENVENIGNHYYKTLRSWRKNFLENEK  810

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI+DLGFD KFIRTWEYYFDY AA   T T+ DYQ+VFSRPGNV A GDP++   SA
Sbjct  811  QIMDLGFDDKFIRTWEYYFDYSAAALKTLTIADYQVVFSRPGNVAALGDPFRSFPSA  867



>ref|XP_004307322.2| PREDICTED: uncharacterized protein LOC101300392 [Fragaria vesca 
subsp. vesca]
Length=161

 Score =   260 bits (664),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -3

Query  720  MLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP  541
            M+E VGHE+M EFF  C+S LAENG+LVLQF S+PDE YDEYR+   FI+EYIFPGGCLP
Sbjct  1    MVEHVGHEYMEEFFACCDSALAENGLLVLQFTSLPDELYDEYRRCPSFIREYIFPGGCLP  60

Query  540  SLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEY  361
            SLSR+T+AMAASSRL VEHLE+IG HYY+TL+ WR  FLE+QS+IL LGFD KFIRTWEY
Sbjct  61   SLSRLTAAMAASSRLSVEHLENIGSHYYRTLKYWRKKFLEKQSEILALGFDDKFIRTWEY  120

Query  360  YFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            YFDYCAAGF+ CTLG+YQIVFSRPGNV    DPYKG  SAY
Sbjct  121  YFDYCAAGFNACTLGNYQIVFSRPGNVALLNDPYKGFPSAY  161



>gb|AES60365.2| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=825

 Score =   278 bits (712),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL    +YDRI+SCEM+EAVGHE+M EFFG C+SVLA++G+LVLQF SIPDERYD YR
Sbjct  650  YRQLSKTKKYDRIVSCEMIEAVGHEYMEEFFGCCDSVLADDGLLVLQFTSIPDERYDAYR  709

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SS+FIKEYIFPG C+PSLSRVT AMAA+SRLCVEH E+IGIHYY TLR WR NF+E  S
Sbjct  710  RSSEFIKEYIFPGCCIPSLSRVTLAMAAASRLCVEHAENIGIHYYPTLRWWRKNFMENHS  769

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLAS  244
            +IL LGFD+KFIR WEYYFDYCAAGF + TLG+YQ+VFSRPGN TAF +  K +AS
Sbjct  770  KILALGFDEKFIRIWEYYFDYCAAGFKSRTLGNYQMVFSRPGNKTAFSNLDKKMAS  825



>emb|CDY18120.1| BnaA01g23810D [Brassica napus]
Length=460

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +Y+RII+CEM+EAVGHEF   FF  CE  LA++GI V+QF ++P+E YDE R
Sbjct  279  YRQLSDAQKYNRIIACEMIEAVGHEFYEAFFSCCEVALAKDGIFVMQFTAVPEELYDETR  338

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SS FI EYIFPGGCLPSL+RVTSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q 
Sbjct  339  LSSGFITEYIFPGGCLPSLARVTSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQK  398

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI++LGFD KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ AFGDP+    SA
Sbjct  399  QIMELGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIAAFGDPFHSFPSA  455



>ref|XP_007035220.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06146.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=375

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISCEM+E VG+E++ EFF  CES+LA++G+ VLQFIS+ +E++ EY 
Sbjct  196  YRQLPETGKYDRIISCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQFISMTEEQFPEYL  255

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTLRCWR NFLE +S
Sbjct  256  RSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKS  315

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A GDPY+G  SAY
Sbjct  316  KILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALGDPYQGFPSAY  373



>ref|XP_009107970.1| PREDICTED: uncharacterized protein LOC103833648 [Brassica rapa]
Length=460

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  ++DRII+CEM+EAVGHEF   FFG CE  LA++GI V+QF ++P+E YDE R
Sbjct  279  YRQLSDAQKHDRIIACEMIEAVGHEFYEAFFGCCEVALAKDGIFVMQFTAVPEELYDETR  338

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SS FI EYIFPGGCLPSL+RVTSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q 
Sbjct  339  LSSGFITEYIFPGGCLPSLARVTSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQK  398

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            QI++LGFD KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ AFG P+    SA
Sbjct  399  QIMELGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIAAFGHPFHSFPSA  455



>ref|XP_010026810.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417196 
[Eucalyptus grandis]
Length=841

 Score =   277 bits (709),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 10/181 (6%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   RYDRIISCEM+EAVGHE+M EFFG CESVLA++G+ VLQFISIPDERY+EYR
Sbjct  654  YRQLPSAYRYDRIISCEMIEAVGHEYMEEFFGCCESVLAKDGLFVLQFISIPDERYEEYR  713

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL----------CVEHLEDIGIHYYQTLRC  442
            +SSDFIKEYIFPGGCLPSLSRVTSAMA++SRL           VEH+++IGIHY+QTLRC
Sbjct  714  RSSDFIKEYIFPGGCLPSLSRVTSAMASASRLRYNCITSSAQSVEHVDNIGIHYHQTLRC  773

Query  441  WRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDP  262
            WR NF+E+Q +IL  GF++KFIRTW+YYFDYCAAGF + TLG+YQIVF RPGN  AF D 
Sbjct  774  WRKNFMEKQRKILAPGFNEKFIRTWQYYFDYCAAGFKSHTLGNYQIVFLRPGNDAAFTDL  833

Query  261  Y  259
            Y
Sbjct  834  Y  834



>ref|XP_002460494.1| hypothetical protein SORBIDRAFT_02g029350 [Sorghum bicolor]
 gb|EER97015.1| hypothetical protein SORBIDRAFT_02g029350 [Sorghum bicolor]
Length=490

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P + +YDRIISCEM+E VGHE+M++FFG CE++LA++GI VLQFISIP+ERY+EYR
Sbjct  308  YRQIPTHRKYDRIISCEMIEGVGHEYMDDFFGCCETLLAQDGIFVLQFISIPEERYEEYR  367

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGC+PSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  + 
Sbjct  368  RSSDFIKEYIFPGGCIPSLARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMVNKD  427

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  241
             IL LGFD+KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN  ++  GDPY    +A
Sbjct  428  AILALGFDEKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGNDKLSNNGDPYASFPAA  486



>ref|XP_009758040.1| PREDICTED: uncharacterized protein LOC104210742, partial [Nicotiana 
sylvestris]
Length=251

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +Y RIIS  M+E VGHEFM+EFF  CES LAE+G+LVLQF+S+PDERYDEYR
Sbjct  94   YRQMPNKDKYHRIISIGMIEHVGHEFMDEFFTCCESSLAEDGLLVLQFVSMPDERYDEYR  153

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLP+LSRVTSAMAA+S+LCV HLE+IGIHYYQTLRCWR NFLE QS
Sbjct  154  YSIGFIKEYIFPGGCLPALSRVTSAMAAASKLCVVHLEEIGIHYYQTLRCWRKNFLENQS  213

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  304
            QI  LGFD KFIRTWEYYFDYCAAGF T T+GDYQ+
Sbjct  214  QIRALGFDDKFIRTWEYYFDYCAAGFKTRTIGDYQV  249



>ref|XP_010532683.1| PREDICTED: (S)-coclaurine N-methyltransferase-like isoform X2 
[Tarenaya hassleriana]
Length=438

 Score =   264 bits (675),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 142/177 (80%), Gaps = 2/177 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D+ +YDRIISCEM+EAVGH+FM  FF RCES LAE G+LVLQF ++PD RYDE R
Sbjct  259  YRQLSDSRKYDRIISCEMIEAVGHKFMETFFNRCESALAEEGLLVLQFSAVPDSRYDESR  318

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FI EYIFPG C PSL+RVTSAMA+SS   +EH+E+IGIHY++TLRCWR NFL+RQ 
Sbjct  319  LSPGFITEYIFPGACHPSLARVTSAMASSS--SIEHVENIGIHYHKTLRCWRQNFLKRQE  376

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPGN T FGDPY    SA
Sbjct  377  EVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPGNTTMFGDPYMSYPSA  433



>dbj|BAJ91247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR
Sbjct  147  YRQIPSRSKYDRIISCEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYR  206

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  + 
Sbjct  207  RSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKD  266

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  241
             IL LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  267  AILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  325



>ref|XP_006420311.1| hypothetical protein CICLE_v10005727mg [Citrus clementina]
 gb|ESR33551.1| hypothetical protein CICLE_v10005727mg [Citrus clementina]
Length=246

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -3

Query  723  EMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCL  544
            +M+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YDEYR S  F+ EYIFPGGC+
Sbjct  83   QMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYRLSPGFLNEYIFPGGCV  142

Query  543  PSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWE  364
            PSLSRVT+AM +SSRLCVEH+E+IGIHYYQTLRCWR NF+E+QS+IL LGF++KFIRTWE
Sbjct  143  PSLSRVTAAMTSSSRLCVEHVENIGIHYYQTLRCWRKNFMEKQSEILALGFNEKFIRTWE  202

Query  363  YYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            YYFDYCAA F +  +G+YQIVFSRPG+V+AF +PY+GL SAY
Sbjct  203  YYFDYCAASFKSRIIGNYQIVFSRPGDVSAFSNPYEGLPSAY  244



>ref|XP_007035218.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
 gb|EOY06144.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
Length=412

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISCEM+E VG+E++ EFF  CES+LA++G+ VLQFIS+ +E++ E+ 
Sbjct  233  YRQLPETGKYDRIISCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQFISMTEEQFPEHL  292

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTLRCWR NFLE +S
Sbjct  293  RSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKS  352

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A GDPY+G   AY
Sbjct  353  KILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALGDPYQGFPLAY  410



>ref|XP_007035217.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
 gb|EOY06143.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
Length=433

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP+  +YDRIISCEM+E VG+E++ EFF  CES+LA++G+ VLQFIS+ +E++ E+ 
Sbjct  254  YRQLPETGKYDRIISCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQFISMTEEQFPEHL  313

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTLRCWR NFLE +S
Sbjct  314  RSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKS  373

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A GDPY+G   AY
Sbjct  374  KILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALGDPYQGFPLAY  431



>ref|XP_010670959.1| PREDICTED: uncharacterized protein LOC104887889 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=877

 Score =   271 bits (694),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP  C+YDRIISC M+E VGHE+  +FF  CESVLA+NG+LVLQFIS+PDE YD +R
Sbjct  697  YRQLPAACKYDRIISCGMIEHVGHEYYEDFFRTCESVLADNGLLVLQFISVPDELYDGFR  756

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SS F+ EYIFPGGCLPSLSR+TSAM ++SRLCVEH+E+IGIHY QTLRCWR NFLE  S
Sbjct  757  RSSGFVYEYIFPGGCLPSLSRITSAMVSASRLCVEHVENIGIHYGQTLRCWRKNFLENHS  816

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I  LGFD+KF+R WEYYFDY A+ F T  LGDYQIVFSR GN+ AF DPY+ ++S+
Sbjct  817  KIRSLGFDEKFMRAWEYYFDYTASAFKTRALGDYQIVFSRLGNLVAFSDPYETISSS  873



>gb|KDO50392.1| hypothetical protein CISIN_1g0358701mg, partial [Citrus sinensis]
Length=784

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL    +YDRIISCEM+EAVGHEFM EFFG CES+LAE+G+LVLQFISIPDERY+EYR
Sbjct  630  YRQLAKANKYDRIISCEMIEAVGHEFMEEFFGCCESLLAEDGLLVLQFISIPDERYNEYR  689

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSLSR+TSAM+ +SRLCVE +E+IGIHYYQTLRCWR NF+E+QS
Sbjct  690  LSSDFIKEYIFPGGCLPSLSRITSAMSVASRLCVEQVENIGIHYYQTLRCWRKNFMEKQS  749

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  307
            +IL LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ
Sbjct  750  KILALGFNDKFIRTWEYYFDYCAAGFKSYTLGNYQ  784



>ref|XP_010466684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X2 [Camelina sativa]
Length=434

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 136/157 (87%), Gaps = 2/157 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRI+SCEMLE VGHEFM  FF  C++   E+GI VLQFISIP+ERY+EYR
Sbjct  276  YRQLSDVQKYDRIVSCEMLEHVGHEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYR  333

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ 
Sbjct  334  LNSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQK  393

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  301
            QI DLGFD KFIRTWEYY+DYCAAGF T TLGDYQ+ 
Sbjct  394  QITDLGFDNKFIRTWEYYYDYCAAGFKTRTLGDYQVT  430



>ref|XP_006420313.1| hypothetical protein CICLE_v10005536mg [Citrus clementina]
 gb|ESR33553.1| hypothetical protein CICLE_v10005536mg [Citrus clementina]
Length=296

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +YDRIISCEM+E VGHE++ EFFG CES+LAE G+L+LQF S+PD+ YD +R
Sbjct  120  YRQMPEVKKYDRIISCEMIENVGHEYIEEFFGCCESLLAEQGLLLLQFSSVPDQCYDGHR  179

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FI EY+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQT RCWR N +E+QS
Sbjct  180  LSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTRRCWRTNLMEKQS  239

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFS P NV AF +P++   SA
Sbjct  240  EILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSHPSNVAAFSNPHESFPSA  296



>ref|NP_001059618.1| Os07g0474600 [Oryza sativa Japonica Group]
 dbj|BAF21532.1| Os07g0474600, partial [Oryza sativa Japonica Group]
Length=390

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR
Sbjct  211  YRQIPTVRKYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYR  270

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + 
Sbjct  271  RSSDFIKEYIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANRE  330

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  241
            +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  331  EIKSLGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  390



>gb|ABG37642.1| cyclopropane fatty acid synthase [Populus trichocarpa]
Length=1664

 Score =   275 bits (702),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 150/177 (85%), Gaps = 3/177 (2%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YD IISCEM+EAVGHE+M EFFG CESVLAENG+ VLQFISIP+ERYDEYR
Sbjct  605  YRQLPKTHKYDTIISCEMIEAVGHEYMEEFFGCCESVLAENGLFVLQFISIPEERYDEYR  664

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q 
Sbjct  665  KSSDFIKEYIFPGGCLPSLTRITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQR  724

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVF-SRPGNVTAFGDPYKGLAS  244
            +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ++   RPG  T   DP   +A 
Sbjct  725  EILSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQLLNPDRPGGSTR--DPVDPVAG  779


 Score =   200 bits (508),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 114/156 (73%), Gaps = 27/156 (17%)
 Frame = -3

Query  771   YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
             YR+LP   +YDRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR
Sbjct  1210  YRELPKGYKYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYR  1269

Query  591   QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLC                           
Sbjct  1270  RSSDFIKEYIFPGGCLPSLSRITSAMGVASRLC---------------------------  1302

Query  411   QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  304
             +IL +GFD+KFIRTWEYYFDY +AGF + TLGDYQ+
Sbjct  1303  KILAMGFDEKFIRTWEYYFDYSSAGFKSYTLGDYQL  1338


 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 111/155 (72%), Gaps = 27/155 (17%)
 Frame = -3

Query  771   YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
             YR+LP+  +YDRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR
Sbjct  1497  YRELPEGYKYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYR  1556

Query  591   QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLC                           
Sbjct  1557  RSSDFIKEYIFPGGCLPSLSRITSAMGVASRLC---------------------------  1589

Query  411   QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  307
             +IL +GFD+KFIRTWEYYFDY AAGF +  LG+YQ
Sbjct  1590  KILAMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQ  1624



>ref|XP_006420314.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
 gb|ESR33554.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
Length=810

 Score =   268 bits (685),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGH++M EFFG CES+LAE+G+L+LQFIS+PD+ YDE+R
Sbjct  634  YRQLPKANKYDRIISCEMIEAVGHDYMEEFFGCCESLLAEHGLLLLQFISVPDQCYDEHR  693

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLPSL+R+TSAM +SSRLCVE LE+IGIHYYQTLRCWR NFLE+QS
Sbjct  694  LSPGFIKEYIFPGGCLPSLNRITSAMTSSSRLCVEDLENIGIHYYQTLRCWRKNFLEKQS  753

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGF +KFIRTWEYYFDYCAAGF + TLGDYQIVFSRP NV AF + ++   SA
Sbjct  754  KILALGFSEKFIRTWEYYFDYCAAGFKSRTLGDYQIVFSRPSNVAAFRNQHESFPSA  810



>ref|XP_010466683.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Camelina sativa]
Length=440

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRI+SCEMLE VGHEFM  FF  C++   E+GI VLQFISIP+ERY+EYR
Sbjct  276  YRQLSDVQKYDRIVSCEMLEHVGHEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYR  333

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ 
Sbjct  334  LNSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQK  393

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  307
            QI DLGFD KFIRTWEYY+DYCAAGF T TLGDYQ
Sbjct  394  QITDLGFDNKFIRTWEYYYDYCAAGFKTRTLGDYQ  428



>ref|XP_010466685.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Camelina sativa]
Length=428

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRI+SCEMLE VGHEFM  FF  C++   E+GI VLQFISIP+ERY+EYR
Sbjct  276  YRQLSDVQKYDRIVSCEMLEHVGHEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYR  333

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ 
Sbjct  334  LNSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQK  393

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  307
            QI DLGFD KFIRTWEYY+DYCAAGF T TLGDYQ
Sbjct  394  QITDLGFDNKFIRTWEYYYDYCAAGFKTRTLGDYQ  428



>ref|XP_011030437.1| PREDICTED: uncharacterized protein LOC105129890 isoform X2 [Populus 
euphratica]
Length=869

 Score =   268 bits (686),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVL ENG+ VLQFISIP+ERYD YR
Sbjct  692  YRQLPMTHKYDRIISCEMIEAVGHEYMEEFFGCCESVLDENGLFVLQFISIPEERYDLYR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPSL+++TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q 
Sbjct  752  QSSDFIKEYIFPGGCLPSLTKITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQR  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  304
            +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  812  EILSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQV  847



>ref|XP_003590114.1| Cyclopropane fatty acid synthase [Medicago truncatula]
Length=793

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 150/186 (81%), Gaps = 10/186 (5%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL    +YDRI+SCEM+EAVGHE+M EFFG C+SVLA++G+LVLQF SIPDERYD YR
Sbjct  608  YRQLSKTKKYDRIVSCEMIEAVGHEYMEEFFGCCDSVLADDGLLVLQFTSIPDERYDAYR  667

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC----------VEHLEDIGIHYYQTLRC  442
            +SS+FIKEYIFPG C+PSLSRVT AMAA+SRL           VEH E+IGIHYY TLR 
Sbjct  668  RSSEFIKEYIFPGCCIPSLSRVTLAMAAASRLWYMLYFNTANNVEHAENIGIHYYPTLRW  727

Query  441  WRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDP  262
            WR NF+E  S+IL LGFD+KFIR WEYYFDYCAAGF + TLG+YQ+VFSRPGN TAF + 
Sbjct  728  WRKNFMENHSKILALGFDEKFIRIWEYYFDYCAAGFKSRTLGNYQMVFSRPGNKTAFSNL  787

Query  261  YKGLAS  244
             K +AS
Sbjct  788  DKKMAS  793



>ref|XP_002883432.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59691.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCE LE VGH+FM  FF  CE+ LAE+GI VL FISIP+ERY+EYR
Sbjct  172  YRQLSDAQKYDRIISCERLEHVGHKFMETFFSHCEAALAEDGIFVLLFISIPEERYNEYR  231

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+E++E+IGIHYYQTLR WR NFLERQ 
Sbjct  232  LNSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIENVENIGIHYYQTLRLWRKNFLERQK  291

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  304
            QI+DLGFD KFIR WEYYFDYCAAGF T TLG +++
Sbjct  292  QIIDLGFDDKFIRIWEYYFDYCAAGFKTLTLGPWRL  327



>ref|XP_004147184.1| PREDICTED: uncharacterized protein LOC101213850 [Cucumis sativus]
Length=1611

 Score =   270 bits (691),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR +P   +YDRIISCEM+EAVGHEFM +FFG CESVLAENGI V QF ++PD RYD YR
Sbjct  609  YRNVPSTKKYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGIFVQQFTAMPDARYDAYR  668

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SS+FIKEYIFPGGCLP LSRVT+AM  +SR C+EHLE+IGIHY+QTLR WR +FLE +S
Sbjct  669  LSSEFIKEYIFPGGCLPCLSRVTTAMTKASRFCIEHLENIGIHYHQTLRYWRKDFLENKS  728

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN----VTAFGDPYKGLAS  244
            +IL LGFD+ FIRTWEYYFDYCAAGF + TL +YQIV+SRPGN    V   G    GL S
Sbjct  729  KILQLGFDESFIRTWEYYFDYCAAGFKSRTLNNYQIVYSRPGNVAMKVAVVGGGISGLVS  788

Query  243  AY  238
            A+
Sbjct  789  AF  790


 Score =   243 bits (621),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 135/178 (76%), Gaps = 27/178 (15%)
 Frame = -3

Query  771   YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
             YR+LP   +YDRIISCEM+EAVGHEFM +FFG CESVLAENG+ VLQFISIPDERY+EYR
Sbjct  1461  YRKLPSTEKYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYNEYR  1520

Query  591   QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
              SSDFIKEYIFPGGCLP LSR+T+AMA +SRLC                           
Sbjct  1521  LSSDFIKEYIFPGGCLPCLSRLTTAMANASRLC---------------------------  1553

Query  411   QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
             +IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  1554  KILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  1611



>gb|EMS55075.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=826

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P  C+YDRIISCEM+E VGHEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR
Sbjct  648  YRQIPGRCKYDRIISCEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYR  707

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  + 
Sbjct  708  RSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYSTLIRWRDNFMANKD  767

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  241
             IL LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +PY  L +A
Sbjct  768  AILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLACADNPYASLPAA  826



>ref|XP_006489661.1| PREDICTED: uncharacterized protein LOC102611924 [Citrus sinensis]
Length=864

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP + +YDRIISCEM+EAVGH++M EFFG CES+LAE+G+L+LQFIS+PD+ YDE+R
Sbjct  688  YRQLPKSNKYDRIISCEMIEAVGHDYMEEFFGCCESLLAEHGLLLLQFISVPDQCYDEHR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FIKEYIFPGGCLPSL+R+TSAM +SSRLCVE LE+IGIHY+QTLRCWR NFLE+QS
Sbjct  748  LSPGFIKEYIFPGGCLPSLNRITSAMTSSSRLCVEDLENIGIHYFQTLRCWRKNFLEKQS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I  LGF +KFIRTWEYYFDYCAAGF + TLGDYQIVFSRP NV AF + ++   SA
Sbjct  808  KIRALGFSEKFIRTWEYYFDYCAAGFKSRTLGDYQIVFSRPSNVAAFRNQHESFPSA  864



>ref|XP_006658552.1| PREDICTED: uncharacterized protein LOC102715408 [Oryza brachyantha]
Length=764

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 3/180 (2%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P + +YDRIISCEM+E VGHE+M+EFFG CES+LA++G+ VLQFISIP+ERY+EYR
Sbjct  585  YRQIPTSRKYDRIISCEMIEGVGHEYMDEFFGCCESLLAQDGLFVLQFISIPEERYEEYR  644

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAM+ASSRLC+EHLE+IG HYY TL  WR NF+  + 
Sbjct  645  RSSDFIKEYIFPGGCLPSLSRITSAMSASSRLCIEHLENIGYHYYPTLIRWRDNFMVNRE  704

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  241
            +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN  +  F D PY    +A
Sbjct  705  EISALGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGNDKLMPFADNPYTTFPAA  764



>ref|XP_008667917.1| PREDICTED: cyclopropane fatty acid synthase isoform X1 [Zea mays]
Length=807

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHE+M++FFG CES+LA++GI VLQFISIP+ERY+EYR
Sbjct  628  YRQIPTQRKYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGIFVLQFISIPEERYEEYR  687

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  + 
Sbjct  688  RSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMANKD  747

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
             IL LGFD+KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN
Sbjct  748  AILALGFDEKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGN  790



>ref|XP_010670925.1| PREDICTED: uncharacterized protein LOC104887860 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=793

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP + ++DRIISC MLE VG E+  +FF  CES+LA+ G+LVLQ ISIPDERYD +R
Sbjct  613  YRQLPASHKFDRIISCGMLEHVGDEYYEDFFRHCESLLADTGLLVLQTISIPDERYDGHR  672

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDF++EYIFPGGCLPSLSR+T+AMA++SRLCVEH+E+IG+HY Q LRCWR NFLE Q 
Sbjct  673  KSSDFMREYIFPGGCLPSLSRLTTAMASASRLCVEHVENIGVHYGQALRCWRKNFLENQG  732

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I  LGFD KF+R WEYYFDY A+ F T TLGDYQIVFSR GN+ AF DPY+ + S++
Sbjct  733  KIRSLGFDDKFMRAWEYYFDYMASMFKTRTLGDYQIVFSRQGNLVAFSDPYECIPSSH  790



>ref|NP_001147782.1| cyclopropane fatty acid synthase [Zea mays]
 gb|ACG28704.1| cyclopropane fatty acid synthase [Zea mays]
 tpg|DAA40492.1| TPA: cyclopropane fatty acid synthase [Zea mays]
Length=877

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHE+M++FFG CES+LA++GI VLQFISIP+ERY+EYR
Sbjct  698  YRQIPTQRKYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGIFVLQFISIPEERYEEYR  757

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  + 
Sbjct  758  RSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMANKD  817

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
             IL LGFD+KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN
Sbjct  818  AILALGFDEKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGN  860



>ref|XP_002467653.1| hypothetical protein SORBIDRAFT_01g031685 [Sorghum bicolor]
 gb|EER94651.1| hypothetical protein SORBIDRAFT_01g031685 [Sorghum bicolor]
Length=685

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHE+M++FF  CE  L E+G+ VLQFISIP+ERY+EYR
Sbjct  520  YRQIPMGHKYDRIISCEMIEHVGHEYMDDFFSCCEQHLKEHGLFVLQFISIPEERYEEYR  579

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+ +SRLC+EH+E+IG HYY TL CWR NF+  + 
Sbjct  580  RSSDFIKEYIFPGGCLPSLARITSAMSNASRLCIEHVENIGYHYYTTLMCWRDNFMTHRD  639

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  280
            ++L +GFD+KFIRTWEYYF YCAAGF + TLGDYQIVFSRPGNV
Sbjct  640  KVLAIGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIVFSRPGNV  683



>ref|XP_010670924.1| PREDICTED: uncharacterized protein LOC104887860 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=872

 Score =   263 bits (672),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP + ++DRIISC MLE VG E+  +FF  CES+LA+ G+LVLQ ISIPDERYD +R
Sbjct  692  YRQLPASHKFDRIISCGMLEHVGDEYYEDFFRHCESLLADTGLLVLQTISIPDERYDGHR  751

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDF++EYIFPGGCLPSLSR+T+AMA++SRLCVEH+E+IG+HY Q LRCWR NFLE Q 
Sbjct  752  KSSDFMREYIFPGGCLPSLSRLTTAMASASRLCVEHVENIGVHYGQALRCWRKNFLENQG  811

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +I  LGFD KF+R WEYYFDY A+ F T TLGDYQIVFSR GN+ AF DPY+ + S++
Sbjct  812  KIRSLGFDDKFMRAWEYYFDYMASMFKTRTLGDYQIVFSRQGNLVAFSDPYECIPSSH  869



>dbj|BAJ95828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =   261 bits (666),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR
Sbjct  571  YRQIPSRSKYDRIISCEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYR  630

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  + 
Sbjct  631  RSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKD  690

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  241
             IL LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  691  AILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  749



>ref|NP_001066537.1| Os12g0267200 [Oryza sativa Japonica Group]
 gb|ABA97030.2| cyclopropane fatty acid synthase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29556.1| Os12g0267200 [Oryza sativa Japonica Group]
 dbj|BAG91262.1| unnamed protein product [Oryza sativa Japonica Group]
Length=837

 Score =   262 bits (670),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR++P + +YDRII CEM+E VGHE+M+EFFG CES+LAENGI V QFISIP+ERYDEYR
Sbjct  669  YREIPCH-KYDRIICCEMIEEVGHEYMDEFFGCCESLLAENGIFVTQFISIPEERYDEYR  727

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + 
Sbjct  728  RSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKD  787

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  280
            +IL LGFD+KFIRTWEYYF YCAAGF + TLGDYQIVFSRPGN 
Sbjct  788  KILALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIVFSRPGNT  831



>ref|XP_004296401.1| PREDICTED: uncharacterized protein LOC101310979 [Fragaria vesca 
subsp. vesca]
Length=455

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP + +YDRIISCEM+E VGHEF++EFF  CESVL ENG+ +LQFIS+PD+RYD+YR
Sbjct  277  YRQLPSDHKYDRIISCEMIEHVGHEFVDEFFSCCESVLEENGLFILQFISMPDDRYDDYR  336

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLE-RQ  415
            + + FIKEYIFPGGCLPSL RV SAMAASSRLCVEHLE+IGI    T+  ++  FL    
Sbjct  337  RGTGFIKEYIFPGGCLPSLGRVISAMAASSRLCVEHLENIGIFMTATV-LYKMQFLFCIY  395

Query  414  SQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            S+IL LGF++ FIRTWEYYFDYCAAGF +  +GDYQIVFSRPGN   + +PYKG  SAY
Sbjct  396  SEILALGFNENFIRTWEYYFDYCAAGFKSHIVGDYQIVFSRPGNALTYNNPYKGFPSAY  454



>ref|XP_007035215.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06141.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=917

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP  C+YDRIISCEM E VG+E++ EFF  CES+LA++G+ VLQFIS+ +E + EY 
Sbjct  738  YRQLPKTCKYDRIISCEMTEHVGNEYIEEFFRCCESILAKDGLFVLQFISVTEELFHEYL  797

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +S  F KEYIFPGGCL SL+R+ SAM A SRL VEH+E+IG +Y QTLRCWR NFLE +S
Sbjct  798  RSPGFAKEYIFPGGCLLSLTRMLSAMGAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKS  857

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRP N  A GDPY+G  SAY
Sbjct  858  KILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPSNFAALGDPYQGFPSAY  915



>gb|EEE67149.1| hypothetical protein OsJ_24210 [Oryza sativa Japonica Group]
Length=719

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR
Sbjct  540  YRQIPTVRKYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYR  599

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + 
Sbjct  600  RSSDFIKEYIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANRE  659

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  241
            +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  660  EIKSLGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  719



>ref|XP_004957293.1| PREDICTED: uncharacterized protein LOC101772901 [Setaria italica]
Length=880

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR
Sbjct  698  YRQIPTRRKYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYR  757

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  + 
Sbjct  758  RSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEHLENIGYHYYPTLIRWRDNFMANKD  817

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGDPYKGLASA  241
             I  LGFD KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN      DPY    +A
Sbjct  818  AISALGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGNDKLGDNDPYASFPAA  875



>dbj|BAJ93367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR
Sbjct  694  YRQIPSRSKYDRIISCEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYR  753

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  + 
Sbjct  754  RSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKD  813

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  241
             IL LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  814  AILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  872



>dbj|BAB01740.1| cyclopocyclopropane fatty acid synthase-like protein [Arabidopsis 
thaliana]
Length=436

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VGH+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R
Sbjct  266  YRQLCDTQKYDRIISCEMIEHVGHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESR  325

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +S FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ 
Sbjct  326  LTSGFITEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQK  385

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  277
            QI+DLGFD+KF+RTWEYYFDYCAAGF T TL +YQ+  +    +T
Sbjct  386  QIIDLGFDEKFLRTWEYYFDYCAAGFKTLTLRNYQVTHTHSSTLT  430



>ref|NP_188990.4| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76769.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=447

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEM+E VGH+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R
Sbjct  277  YRQLCDTQKYDRIISCEMIEHVGHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESR  336

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +S FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ 
Sbjct  337  LTSGFITEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQK  396

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  277
            QI+DLGFD+KF+RTWEYYFDYCAAGF T TL +YQ+  +    +T
Sbjct  397  QIIDLGFDEKFLRTWEYYFDYCAAGFKTLTLRNYQVTHTHSSTLT  441



>ref|XP_011091266.1| PREDICTED: uncharacterized protein LOC105171752 isoform X2 [Sesamum 
indicum]
Length=813

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP NC+YDRIISCEM+EAVGHE++ EFF  CES L ENGILVLQFI+I DE+YDE+ 
Sbjct  635  YRQLPKNCKYDRIISCEMIEAVGHEYIEEFFRCCESALTENGILVLQFIAIADEKYDEFT  694

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S+ FIKEYIFPG  L SLSR+TSAMAA+SRL V HLE+ G+HY+QTL CWR N L  QS
Sbjct  695  HSAGFIKEYIFPGSWLASLSRLTSAMAAASRLSVVHLEERGLHYFQTLECWRENLLRNQS  754

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PYK  256
            +IL+LGFD+KF+RTW YYFDYCAAG     +G YQ+VF+RPG++ AFG+ PY 
Sbjct  755  KILELGFDEKFMRTWIYYFDYCAAGLKYGVVGSYQVVFTRPGDIAAFGNKPYN  807



>ref|XP_011091265.1| PREDICTED: uncharacterized protein LOC105171752 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 1/172 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP NC+YDRIISCEM+EAVGHE++ EFF  CES L ENGILVLQFI+I DE+YDE+ 
Sbjct  689  YRQLPKNCKYDRIISCEMIEAVGHEYIEEFFRCCESALTENGILVLQFIAIADEKYDEFT  748

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S+ FIKEYIFPG  L SLSR+TSAMAA+SRL V HLE+ G+HY+QTL CWR N L  QS
Sbjct  749  HSAGFIKEYIFPGSWLASLSRLTSAMAAASRLSVVHLEERGLHYFQTLECWRENLLRNQS  808

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PY  259
            +IL+LGFD+KF+RTW YYFDYCAAG     +G YQ+VF+RPG++ AFG+ PY
Sbjct  809  KILELGFDEKFMRTWIYYFDYCAAGLKYGVVGSYQVVFTRPGDIAAFGNKPY  860



>ref|XP_010239672.1| PREDICTED: uncharacterized protein LOC100842201 isoform X2 [Brachypodium 
distachyon]
Length=821

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHEFM++FFG CES+LA++G+LVLQFISIP+ERY+EYR
Sbjct  643  YRQIPILRKYDRIISCEMIEGVGHEFMDDFFGCCESLLAQDGLLVLQFISIPEERYEEYR  702

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF   + 
Sbjct  703  RSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKY  762

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  241
             I  LGFD KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  763  AISALGFDDKFIRIWEYYFMYCAAGFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  821



>ref|XP_006350427.1| PREDICTED: uncharacterized protein LOC102587606 [Solanum tuberosum]
Length=513

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +YDRIISCEMLE +GH+F+ +FF  CES LAE+G+LVLQFISIPDERYD +R
Sbjct  358  YRQIPNKDKYDRIISCEMLEHIGHDFIGKFFTCCESSLAEDGLLVLQFISIPDERYDSHR  417

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S+DF++EYIFPGG L + S+VTS MAA+SRLCVEHLE+IGIHYYQTL+CWR NF + QS
Sbjct  418  HSTDFMREYIFPGGGLNAPSQVTSVMAAASRLCVEHLENIGIHYYQTLKCWRRNFFKNQS  477

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  307
            QI  LGFD KFIRTWEYYFDYCAAG  TCT+GDYQ
Sbjct  478  QIRALGFDDKFIRTWEYYFDYCAAGLKTCTIGDYQ  512



>gb|EEC82010.1| hypothetical protein OsI_25960 [Oryza sativa Indica Group]
Length=890

 Score =   258 bits (660),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR
Sbjct  711  YRQIPTVRKYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYR  770

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + 
Sbjct  771  RSSDFIKEYIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANRE  830

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  241
            +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  831  EIKSLGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  890



>ref|XP_003581006.1| PREDICTED: uncharacterized protein LOC100842201 isoform X1 [Brachypodium 
distachyon]
Length=876

 Score =   258 bits (659),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P   +YDRIISCEM+E VGHEFM++FFG CES+LA++G+LVLQFISIP+ERY+EYR
Sbjct  698  YRQIPILRKYDRIISCEMIEGVGHEFMDDFFGCCESLLAQDGLLVLQFISIPEERYEEYR  757

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF   + 
Sbjct  758  RSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKY  817

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  241
             I  LGFD KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  818  AISALGFDDKFIRIWEYYFMYCAAGFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  876



>gb|EEC78767.1| hypothetical protein OsI_18995 [Oryza sativa Indica Group]
Length=1429

 Score =   261 bits (668),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  771   YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
             YR++P + +YDRII CEM+E VGHE+M+EFFG CES+LAENGI V QF SIP+ERYDEYR
Sbjct  1261  YREIPCH-KYDRIICCEMIEEVGHEYMDEFFGCCESLLAENGIFVTQFTSIPEERYDEYR  1319

Query  591   QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + 
Sbjct  1320  RSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKD  1379

Query  411   QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  280
             +IL LGFD+KFIRTWEYYF YCAAGF + TLGDYQIVFSRPGN 
Sbjct  1380  KILALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIVFSRPGNT  1423


 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -3

Query  636  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  457
            L+FISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY
Sbjct  557  LEFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYY  616



>gb|EEE62857.1| hypothetical protein OsJ_17660 [Oryza sativa Japonica Group]
Length=796

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 144/171 (84%), Gaps = 8/171 (5%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR++P + +YDRII CEM+E VGHE+M+EFFG CES+LAENGI V QFISIP+ERYDEYR
Sbjct  621  YREIPCH-KYDRIICCEMIEEVGHEYMDEFFGCCESLLAENGIFVTQFISIPEERYDEYR  679

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + 
Sbjct  680  RSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKD  739

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ-------IVFSRPGNV  280
            +IL LGFD+KFIRTWEYYF YCAAGF + TLGDYQ       IVFSRPGN 
Sbjct  740  KILALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQASTVLLYIVFSRPGNT  790



>gb|KDO54095.1| hypothetical protein CISIN_1g038410mg [Citrus sinensis]
Length=850

 Score =   255 bits (651),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +YD IISCEM+E VGHE++ EFFG CES+LAE+G+L+LQF S+PD+ YD +R
Sbjct  674  YRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHR  733

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FI EY+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQTLRCWR N +E+QS
Sbjct  734  LSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQS  793

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRP  V AF +P++   SA
Sbjct  794  EILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAFSNPHESFPSA  850



>ref|XP_006489756.1| PREDICTED: uncharacterized protein LOC102615557 [Citrus sinensis]
Length=875

 Score =   255 bits (652),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P+  +YD IISCEM+E VGHE++ EFFG CES+LAE+G+L+LQF S+PD+ YD +R
Sbjct  689  YRQMPEVKKYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHR  748

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             S  FI EY+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQTLRCWR N +E+QS
Sbjct  749  LSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQS  808

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRP NV AF +P++
Sbjct  809  EILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSNVAAFSNPHE  860



>gb|EMT03310.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=829

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 12/189 (6%)
 Frame = -3

Query  771  YRQLPDNCRYDRIIS----------CEMLEAVGHEFMNEFFGRCESVLAENGILVLQFIS  622
            YRQ+P  C+YDRIIS           EM+E VGHEFM++FFG CES+LA +G+ VLQFIS
Sbjct  641  YRQIPSRCKYDRIISWKYLPLVDTHSEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFIS  700

Query  621  IPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRC  442
            IP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+ +SRLC+E +E+IG HYY TL  
Sbjct  701  IPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSTASRLCIEQVENIGYHYYPTLIR  760

Query  441  WRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD  265
            WR NF+  +  IL LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN   A+ D
Sbjct  761  WRDNFMANKDAILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLAYAD  820

Query  264  -PYKGLASA  241
             PY  L +A
Sbjct  821  NPYASLPAA  829



>ref|XP_007035240.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06166.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=461

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP  C+YDRIISCEM E VG+E++ EFF  CES+LA++G+ VLQF S+ +  Y EY 
Sbjct  282  YRQLPKTCKYDRIISCEMSEHVGNEYIEEFFRCCESILAKDGLFVLQFTSVTEGLYHEYL  341

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +S  F KEYIFPG CL SL+R+ SAMA +SRL VEH+E+IG +Y QTL+ WR NFL+ +S
Sbjct  342  RSPGFAKEYIFPGACLLSLTRILSAMATASRLSVEHVENIGSNYVQTLKGWRKNFLKNKS  401

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGFD+KF RTWEY+FDY AAGF + TL  YQ+VFSRPGN  A GDPY+G  SAY
Sbjct  402  KILALGFDEKFTRTWEYFFDYAAAGFKSRTLETYQVVFSRPGNFAALGDPYQGFPSAY  459



>ref|XP_011091264.1| PREDICTED: uncharacterized protein LOC105171751 [Sesamum indicum]
Length=866

 Score =   253 bits (645),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP + +YDRIISC M+E VGHE M EFF  CES LAENG+LVLQFI+  DE+YDE R
Sbjct  688  YRQLPKSYKYDRIISCGMIEHVGHEVMEEFFRCCESALAENGLLVLQFIASADEKYDESR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +S  F+KEYIFPGGC PSLS V S MAA+SRL   HLE+IG HY+ TLR WR N L+  S
Sbjct  748  RSPGFVKEYIFPGGCTPSLSHVISCMAAASRLSAVHLEEIGCHYFHTLRRWRENLLKNHS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PYKGLASAY  238
            +IL +GF++KFIRTWEYYFDYCAAGF  C LGDYQIVFSRPG+V AF + PY  +   Y
Sbjct  808  KILAMGFNEKFIRTWEYYFDYCAAGFKYCILGDYQIVFSRPGDVAAFSNKPYNAVPGDY  866



>ref|XP_006664478.1| PREDICTED: uncharacterized protein LOC102701601 [Oryza brachyantha]
Length=822

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 142/172 (83%), Gaps = 1/172 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR++P   +YDRII CEM+E VGHE+M+EFFG CES+LAE+GI V+QF SIP+ERYDEYR
Sbjct  649  YREIPACHKYDRIICCEMIEEVGHEYMDEFFGCCESLLAEDGIFVIQFSSIPEERYDEYR  708

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SSDFIKEYIFPGGC+P L+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + 
Sbjct  709  RSSDFIKEYIFPGGCIPCLTRITSAMSAASRLCIEHVENIGHHYYPTLVRWRDNFMANKD  768

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  256
            +IL LGFD++F RTWEYYF Y AAGF + TLG YQIVFSRPGN    G  +K
Sbjct  769  KILALGFDERFTRTWEYYFMYSAAGFKSRTLGVYQIVFSRPGNAK-LGSGFK  819



>gb|AAM33848.1|AF470622_1 cyclopropane synthase [Sterculia foetida]
Length=864

 Score =   247 bits (631),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIIS EM+E VG E++ EFF  C+S+LAENG+ VLQFISIP+    E +
Sbjct  682  YRQLPKTFKYDRIISVEMVEHVGEEYIEEFFRCCDSLLAENGLFVLQFISIPEILSKEIQ  741

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            Q++ F+KEYIFPGG L SL R  SAMAA+SR  VEH+E+IGI YY TLR WR NFL  +S
Sbjct  742  QTAGFLKEYIFPGGTLLSLDRTLSAMAAASRFSVEHVENIGISYYHTLRWWRKNFLANES  801

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            ++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN  A GDPY G  SAY
Sbjct  802  KVLALGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFAALGDPYIGFPSAY  859



>gb|EMS56688.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=624

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P  C+YD IISC M+E VGHE+M+EFF  CES LAE+GILVLQFIS PDERY++YR
Sbjct  457  YRQIPP-CKYDAIISCGMIEHVGHEYMDEFFACCESYLAEDGILVLQFISAPDERYEQYR  515

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            + +DFIKEYIFPGGCLPSL RV SAM  SSR C+EH+E+IG HYY TL  WR NF+  + 
Sbjct  516  RRTDFIKEYIFPGGCLPSLGRVVSAMTTSSRFCIEHVENIGPHYYTTLMHWRDNFMTNKD  575

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
            Q+L LGFD+KF+R WE+Y  Y AAGF +  +GDYQ+VFSRPGN
Sbjct  576  QVLALGFDEKFMRIWEFYLIYSAAGFKSRAVGDYQVVFSRPGN  618



>ref|XP_010670965.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=436

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 139/178 (78%), Gaps = 2/178 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+L D  +YDRII+CEM+EAVG E++ EFF  C+S L  NG+LVLQF ++ DE Y+++R
Sbjct  259  YRELKDVNKYDRIIACEMIEAVGDEYIEEFFRCCDSSLTTNGLLVLQFTAVRDEGYEKFR  318

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +   FI EYIFPGG L SLSRVTSAM  +S+L VEH+E+IG HYYQTLRCWR NFLE QS
Sbjct  319  KCPGFIPEYIFPGGHLFSLSRVTSAMGTASKLSVEHVENIGEHYYQTLRCWRKNFLENQS  378

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            +IL LGF++KFI+TWEYYFDYCAAGF    L +YQIVFSR G  TAF DP   + SA+
Sbjct  379  KILSLGFNEKFIQTWEYYFDYCAAGFKMRFLKNYQIVFSRRG--TAFNDPSATIPSAH  434



>gb|EPS70161.1| hypothetical protein M569_04599, partial [Genlisea aurea]
Length=850

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR++P   +YDRIISCEMLE++G E+  EFF  CES+L E+G+LV+QF ++PD R++  R
Sbjct  680  YREVPKTRKYDRIISCEMLESIGVEYTKEFFSICESLLVEDGLLVVQFTTVPDSRFENNR  739

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            ++S FI EYIF G C+PSLS VTSAM A+SR  VEHLEDIG+HYY  LRCWR NFL  ++
Sbjct  740  RTSGFISEYIFQGSCIPSLSYVTSAMGAASRFWVEHLEDIGVHYYPALRCWRDNFLRNRN  799

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  259
            QI  LGFD KF+R +EYYFDYCA+ F TC +G+YQ+V SRPGNV  FGDPY
Sbjct  800  QIEALGFDDKFVRMFEYYFDYCASAFKTCAIGNYQLVLSRPGNVAIFGDPY  850



>dbj|BAJ86532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 130/163 (80%), Gaps = 1/163 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P  C+Y  IISC M+E VGHE+M+EFF  CES LAE+GILVLQFIS P+ERY++YR
Sbjct  92   YRQIPP-CKYGAIISCGMIEHVGHEYMDEFFACCESYLAEDGILVLQFISAPEERYEQYR  150

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            + +DFIKEYIFPGGCLPSL+RV SAM  SSR  +EH+E+IG HYY TL  WR NF+  + 
Sbjct  151  RRTDFIKEYIFPGGCLPSLARVMSAMTTSSRFSIEHVENIGPHYYTTLMRWRDNFMINKD  210

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
            +IL LGFD KF+R WEYY  + A+ F + TLGDYQ+VFSRPGN
Sbjct  211  EILALGFDDKFMRIWEYYLIFSASCFKSRTLGDYQVVFSRPGN  253



>gb|KHG13738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Gossypium arboreum]
Length=799

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   ++DRIIS EM+E VG E++ EF+  C+ +L E+G+ VLQFISIP+E   E +
Sbjct  617  YRQLPKEHQFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQ  676

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S
Sbjct  677  QTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTS  736

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            ++L LGFDKKF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  737  KVLALGFDKKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  794



>ref|XP_002964119.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
 ref|XP_002992048.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ06897.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ34452.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
Length=864

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR L    +Y+RIISCEM+EAVG E+ +EFF +C+ +LAE+G+ V+Q I++P+ERYDE R
Sbjct  688  YRCLEGCKKYNRIISCEMMEAVGPEYYDEFFAKCDYLLAEDGLAVIQVITVPEERYDELR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +SS+FIKEYIFPGG LP L+ +T+AM  +S LCVEHLE+IG+HYYQTL CWR NF  + S
Sbjct  748  RSSEFIKEYIFPGGSLPCLAALTAAMFRASSLCVEHLENIGLHYYQTLMCWRRNFNSKTS  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I  LGF + F+R W+YYF YCAAGF TCTLG+ QIVFSR GN  A G+PY+   +A
Sbjct  808  EIAKLGFSESFMRKWDYYFIYCAAGFLTCTLGNLQIVFSRSGNAAALGNPYRSFPTA  864



>gb|KJB12590.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
 gb|KJB12591.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
Length=873

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   ++DRIIS EM+E VG E++ EF+  C+ +L E+G+ VLQFISIP+E   E +
Sbjct  691  YRQLPKEHQFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQ  750

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S
Sbjct  751  QTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTS  810

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            ++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  811  KVLALGFDEKFMRTWEYYFDYCAAGFKTGTLTDYQVVFSRAGNFGTLGDPYKGFRSAY  868



>gb|AAT74601.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   237 bits (604),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   ++DRIIS EM+E VG E++ EF+  C+ +L E+G+ VLQFISIP+E   E +
Sbjct  683  YRQLPKEHQFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQ  742

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S
Sbjct  743  QTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTS  802

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            ++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  803  KVLALGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  860



>gb|KJB12595.1| hypothetical protein B456_002G026100 [Gossypium raimondii]
Length=865

 Score =   237 bits (604),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   ++DRIIS EM+E VG E++ EF+  C+ +L E+G+ VLQFISIP+E   E +
Sbjct  683  YRQLPKEHQFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQ  742

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S
Sbjct  743  QTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTS  802

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            ++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  803  KVLALGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  860



>gb|AAT74600.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=873

 Score =   236 bits (601),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   ++DRIIS EM+E VG E++ EF+  C+ +L E+G+ VLQFISIP+E   E +
Sbjct  691  YRQLPKEHQFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQ  750

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FL+  S
Sbjct  751  QTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLKNTS  810

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            ++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  811  KVLALGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  868



>dbj|BAK04927.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   218 bits (556),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = -3

Query  720  MLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP  541
            M+E VGHE+M+EFF  CES LAE+GILVLQFIS P+ERY++YR+ +DFIKEYIFPGGCLP
Sbjct  4    MIEHVGHEYMDEFFACCESYLAEDGILVLQFISAPEERYEQYRRRTDFIKEYIFPGGCLP  63

Query  540  SLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEY  361
            SL RV SAM  SSR C+EH+E+IG HYY TL  WR NF+  + Q+L LGFD+KFIR WE+
Sbjct  64   SLGRVMSAMTTSSRFCIEHVENIGPHYYTTLMHWRDNFMTNKDQVLALGFDEKFIRIWEF  123

Query  360  YFDYCAAGFHTCTLGDYQIVFSRPGN  283
            Y  Y AAGF + T+GDYQ+VFSRPGN
Sbjct  124  YLIYSAAGFKSRTVGDYQVVFSRPGN  149



>ref|XP_006406023.1| hypothetical protein EUTSA_v10022172mg, partial [Eutrema salsugineum]
 gb|ESQ47476.1| hypothetical protein EUTSA_v10022172mg, partial [Eutrema salsugineum]
Length=394

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRII+CEM+EAVG EF   FF  CE+VLA  GI V+QF ++PDERYDE R
Sbjct  242  YRQLSDAHKYDRIIACEMIEAVGDEFYETFFSCCEAVLAPYGIFVMQFTALPDERYDECR  301

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLCVE +E+IGIHYY TL+ WR +FLERQ 
Sbjct  302  LSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCVEDVENIGIHYYLTLKFWRKSFLERQK  361

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  313
            +I++LGFD KFIRTW YYF+Y AAGF   +L +
Sbjct  362  EIMNLGFDDKFIRTWVYYFNYYAAGFKAHSLKN  394



>ref|XP_001769171.1| predicted protein [Physcomitrella patens]
 gb|EDQ66043.1| predicted protein [Physcomitrella patens]
Length=864

 Score =   233 bits (595),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR +    +++RIISCEMLEAVGHE+  E+F RC+++LA++G++V+Q ISIP+ERYD YR
Sbjct  688  YRNVQGFHKFNRIISCEMLEAVGHEYYAEWFRRCDTLLAKDGLVVVQVISIPEERYDGYR  747

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            QSSDFIKEYIFPGGCLPS + +T+AM++ S  CVEH+E+IGIHY +TL  W+  F   ++
Sbjct  748  QSSDFIKEYIFPGGCLPSFAALTTAMSSGSSFCVEHMENIGIHYCETLLRWQEQFTRNRN  807

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I+ LGF +KFIRTW+YYF YCAAGF +CTLG  QIVFSRPGN    G PY    +A
Sbjct  808  KIMKLGFGEKFIRTWDYYFFYCAAGFKSCTLGVLQIVFSRPGNEAFLGCPYVSFPTA  864



>gb|KJB70811.1| hypothetical protein B456_011G092100 [Gossypium raimondii]
Length=865

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIIS EM+E VG E++ EF+  C+ +L ++G+ VLQFI++P+E   E +
Sbjct  683  YRQLPKTNQYDRIISVEMVEHVGKEYIEEFYRCCDQLLKKDGLFVLQFITLPEELSKEVQ  742

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            Q++ FIKEYIFPGG L S +   SAMAA+S  CVEH+E+IG  YY TLR WR NFLE  S
Sbjct  743  QTAGFIKEYIFPGGMLLSFNTHLSAMAAASGFCVEHVENIGSSYYHTLRWWRKNFLENTS  802

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  238
            ++L LGFD KF+RTWEYYFDYCAAGF T TL DYQ+VFSR  N    GDPYKG  SAY
Sbjct  803  KVLALGFDDKFMRTWEYYFDYCAAGFKTGTLLDYQVVFSRADNFATLGDPYKGFPSAY  860



>ref|XP_002862681.1| hypothetical protein ARALYDRAFT_359447 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38939.1| hypothetical protein ARALYDRAFT_359447 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 118/169 (70%), Gaps = 34/169 (20%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQL D  +YDRIISCEMLE VGH+FM  FF  CE+ LAE+GI VLQFISIP+ERY+EYR
Sbjct  64   YRQLSDAQKYDRIISCEMLEHVGHKFMETFFSHCEAALAEDGIFVLQFISIPEERYNEYR  123

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDFIKEYIFPGGCLPSL+RVTSA+                                  
Sbjct  124  LNSDFIKEYIFPGGCLPSLARVTSAI----------------------------------  149

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD  265
            QI+DLGFD KFIR WEYYFDYCAAGF T TLGDYQI FSRPGNV AFGD
Sbjct  150  QIIDLGFDDKFIRIWEYYFDYCAAGFKTLTLGDYQIFFSRPGNVVAFGD  198



>gb|EMS47377.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=640

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 125/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR++P  C+YD IIS  M+E VGHE++ EFF  CES LAE+GI+ LQFIS+PDERY++YR
Sbjct  469  YRKIPP-CKYDAIISICMIEHVGHEYLGEFFACCESYLAEDGIMALQFISVPDERYEQYR  527

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +  DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH E+IG HYY TL CW  N++  + 
Sbjct  528  RKPDFIKEYIFPGGCLPSLSRVMSAMTTSSRFSIEHAENIGPHYYTTLMCWMDNYIANRD  587

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
            +IL LGFD+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  588  KILALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  630



>gb|EMT01203.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=198

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 124/163 (76%), Gaps = 1/163 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR +P   +YD IIS  M+E VGHE M+EFF  CES LAE+GI+ LQFIS P+ERY++YR
Sbjct  27   YRHIPPY-KYDAIISICMIEHVGHECMDEFFACCESYLAEDGIMALQFISAPEERYEQYR  85

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +  DF+ EYIFPGGCLPSL+RV SAM+ SSR C+EH+E+IG +YY TL CW  NF   + 
Sbjct  86   KRPDFLTEYIFPGGCLPSLARVVSAMSTSSRFCIEHVENIGPNYYPTLMCWMDNFTANKD  145

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
            ++L LGFD+KFIR WEYY  + AA   + TLG YQ+VFSRPGN
Sbjct  146  KMLALGFDEKFIRIWEYYLIFSAACMKSRTLGVYQVVFSRPGN  188



>emb|CDY09025.1| BnaC01g30660D [Brassica napus]
Length=137

 Score =   207 bits (528),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  636  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  457
            +QF ++P+E YDE R SS FI EYIFPGGCLPSL+RVTSAM+ SS+LC+E +E+IGIHYY
Sbjct  1    MQFTAVPEELYDEIRLSSGFITEYIFPGGCLPSLARVTSAMSFSSKLCIEDVENIGIHYY  60

Query  456  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  277
             TLRCWR  FLE Q QI++LGFD KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ 
Sbjct  61   YTLRCWRKRFLENQKQIMELGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIA  120

Query  276  AFGDPYKGLASA  241
            AFGDP++   SA
Sbjct  121  AFGDPFRSFPSA  132



>ref|XP_004956057.1| PREDICTED: uncharacterized protein LOC101762231 isoform X2 [Setaria 
italica]
Length=872

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P + ++DRIISCEM+E VGHE+M++FFG CE  LAE+G+ VLQFI+IP+E YD+ R
Sbjct  700  YRQIPTDQKFDRIISCEMIEHVGHEYMDDFFGSCEYHLAEHGLFVLQFIAIPEELYDKLR  759

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
               +F+KEYIFPGGCLPSL+RV SAM  +SRLC++H+E+IG HYY TL  WR NF+  + 
Sbjct  760  TRPEFLKEYIFPGGCLPSLARVVSAMTNASRLCIQHVENIGDHYYPTLMHWRDNFMANRK  819

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  280
            ++  LGFD+KF+ TW+YY  YCAA F + TL DYQIVFSR G+ 
Sbjct  820  KVAALGFDEKFMLTWQYYLTYCAAMFRSRTLMDYQIVFSRSGDA  863



>ref|XP_004956056.1| PREDICTED: uncharacterized protein LOC101762231 isoform X1 [Setaria 
italica]
Length=912

 Score =   224 bits (570),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P + ++DRIISCEM+E VGHE+M++FFG CE  LAE+G+ VLQFI+IP+E YD+ R
Sbjct  740  YRQIPTDQKFDRIISCEMIEHVGHEYMDDFFGSCEYHLAEHGLFVLQFIAIPEELYDKLR  799

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
               +F+KEYIFPGGCLPSL+RV SAM  +SRLC++H+E+IG HYY TL  WR NF+  + 
Sbjct  800  TRPEFLKEYIFPGGCLPSLARVVSAMTNASRLCIQHVENIGDHYYPTLMHWRDNFMANRK  859

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  280
            ++  LGFD+KF+ TW+YY  YCAA F + TL DYQIVFSR G+ 
Sbjct  860  KVAALGFDEKFMLTWQYYLTYCAAMFRSRTLMDYQIVFSRSGDA  903



>ref|XP_004972625.1| PREDICTED: uncharacterized protein LOC101764920 [Setaria italica]
Length=871

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQ+P + ++DRIISCEM+E VGHE+M++FFG CE  LAE+G+ VLQFI+IP+E YD+ R
Sbjct  699  YRQIPTDQKFDRIISCEMIEHVGHEYMDDFFGSCEYHLAEHGLFVLQFIAIPEELYDKMR  758

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
               +F+KEYIFPGGCLPSL+RV SAM  +SRLC++H+E+IG HYY TL  WR NF+  + 
Sbjct  759  TRPEFLKEYIFPGGCLPSLARVVSAMTNASRLCIQHVENIGDHYYPTLMHWRDNFMANRK  818

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  280
            ++  LGFD+KF+ TW+YY  YCAA F + TL DYQIVFSR G+ 
Sbjct  819  KVAALGFDEKFMLTWQYYLTYCAAMFRSRTLMDYQIVFSRSGDA  862



>gb|KDO54094.1| hypothetical protein CISIN_1g048309mg, partial [Citrus sinensis]
Length=288

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 132/184 (72%), Gaps = 29/184 (16%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   +YDRIISCEM+EAVGHE+M E+FG CES+LA++G+LVLQF S PD RY+EYR
Sbjct  128  YRQLPKAKKYDRIISCEMMEAVGHEYMEEYFGCCESLLAKDGLLVLQFSSTPDARYNEYR  187

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             SSDFIKEYIFPGGCLPSLSR+TSAMAA+S                             S
Sbjct  188  LSSDFIKEYIFPGGCLPSLSRITSAMAAAS---------------------------SLS  220

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY*A  232
            +IL LGF++KFI TWEYYFDY AAGF   TLG+YQIV SRPGNV+ F +PYKG  SAY  
Sbjct  221  KILALGFNEKFIWTWEYYFDYSAAGFKPRTLGNYQIVLSRPGNVSVFSNPYKGFPSAY--  278

Query  231  HSLL  220
            H +L
Sbjct  279  HQIL  282



>dbj|BAK05892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   222 bits (566),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR++P  C+YD IIS  M+E VGHE++++FF  CES LAE+GI+ LQFIS+PDERY++YR
Sbjct  701  YRKIPP-CKYDAIISICMIEHVGHEYLDDFFACCESYLAEDGIMALQFISVPDERYEQYR  759

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +  DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH+E+IG HYY TL CW  N+   + 
Sbjct  760  RKPDFIKEYIFPGGCLPSLSRVMSAMTRSSRFSIEHVENIGPHYYTTLMCWMDNYTANRD  819

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
            +IL LGFD+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  820  KILALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  862



>dbj|BAK05129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR++P  C+YD IIS  M+E VGHE++++FF  CES LAE+GI+ LQFIS+PDERY++YR
Sbjct  701  YRKIPP-CKYDAIISICMIEHVGHEYLDDFFACCESYLAEDGIMALQFISVPDERYEQYR  759

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +  DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH+E+IG HYY TL CW  N+   + 
Sbjct  760  RKPDFIKEYIFPGGCLPSLSRVMSAMTRSSRFSIEHVENIGPHYYTTLMCWMDNYTANRD  819

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
            +IL LGFD+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  820  KILALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  862



>ref|XP_007035214.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
 gb|EOY06140.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
Length=924

 Score =   222 bits (565),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR+LP + + DRIISCEM+E VG E++ EFFG CE VL E+G+LVLQF S  DE Y +YR
Sbjct  746  YRKLPSSYKCDRIISCEMIEHVGDEYLEEFFGWCEKVLTEDGLLVLQFSSTSDEGYHDYR  805

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
             +SDF+KEYIFPG C PSL R++SAMAA++RLCVEH+E+IG  Y++T+R W+   L+ +S
Sbjct  806  HTSDFLKEYIFPGICPPSLGRISSAMAATTRLCVEHVENIGSQYHRTVRFWKNKLLDNKS  865

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  241
            +I+ LGF+++FIR WEYY DY AAG ++ T  +YQ+VFSR G   A G+P KG +SA
Sbjct  866  KIVALGFNEEFIRMWEYYLDYVAAGMNSRTHLNYQVVFSRHGYPAAPGNPDKGFSSA  922



>gb|AFW60130.1| hypothetical protein ZEAMMB73_361545 [Zea mays]
Length=430

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YRQLP   ++DRIISCEM+E VGHE+M++FFG CE  LAE+G+LVLQ I++P+E YD+ R
Sbjct  258  YRQLPAGDKFDRIISCEMIEHVGHEYMDDFFGCCEYHLAEHGLLVLQSIALPEELYDKMR  317

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
               +F+K YIFPGGCLPSL R+ SAM+ +SRL ++HLE+IG HYY TL  WR NF+  + 
Sbjct  318  MRPEFLKTYIFPGGCLPSLGRIVSAMSNASRLNIQHLENIGDHYYTTLMNWRDNFVANRE  377

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
            +   LGFD KFIRTWEYY  Y AA F + T  DYQIVF+RPG+
Sbjct  378  KASALGFDDKFIRTWEYYLSYAAALFKSRTAIDYQIVFARPGD  420



>gb|EMS47376.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=676

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  771  YRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYR  592
            YR +P   +YD IISC M+E VGHE+M+EFF  CES LAE+GILVLQFISI +ERY++YR
Sbjct  509  YRLIPPY-KYDAIISCGMIEHVGHEYMDEFFACCESYLAEDGILVLQFISIAEERYEQYR  567

Query  591  QSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQS  412
            +   F+KEYIFPGGC+PSL+RV SAM  SSR  +EH+E+IG +YY TL  WR NF+  + 
Sbjct  568  RRPHFVKEYIFPGGCIPSLARVMSAMTTSSRFSIEHVENIGPNYYTTLMHWRDNFMANKD  627

Query  411  QILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  283
            Q+L+LGFD+KFI  WE+Y  Y AAGF +  +GDYQ+VFSRPGN
Sbjct  628  QVLELGFDEKFILIWEFYLIYSAAGFKSRAVGDYQVVFSRPGN  670



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310