BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF021O24

Length=782
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621779.1|  PREDICTED: probable LRR receptor-like serine...    276   3e-85   
ref|XP_009621778.1|  PREDICTED: probable LRR receptor-like serine...    275   6e-84   Nicotiana tomentosiformis
ref|XP_011081555.1|  PREDICTED: probable LRR receptor-like serine...    275   1e-83   Sesamum indicum [beniseed]
ref|XP_002309634.2|  hypothetical protein POPTR_0006s27120g             269   9e-83   
ref|XP_009759495.1|  PREDICTED: probable LRR receptor-like serine...    267   1e-81   Nicotiana sylvestris
gb|KDO61746.1|  hypothetical protein CISIN_1g006206mg                   265   1e-80   Citrus sinensis [apfelsine]
ref|XP_006450419.1|  hypothetical protein CICLE_v10007687mg             266   1e-80   Citrus clementina [clementine]
ref|XP_009759487.1|  PREDICTED: probable LRR receptor-like serine...    266   2e-80   Nicotiana sylvestris
ref|XP_006483373.1|  PREDICTED: probable LRR receptor-like serine...    265   5e-80   Citrus sinensis [apfelsine]
gb|KDO61744.1|  hypothetical protein CISIN_1g006206mg                   265   6e-80   Citrus sinensis [apfelsine]
ref|XP_011039729.1|  PREDICTED: probable LRR receptor-like serine...    264   5e-78   Populus euphratica
ref|XP_002324865.1|  hypothetical protein POPTR_0018s01800g             258   9e-78   
ref|XP_002515504.1|  ATP binding protein, putative                      263   2e-77   
gb|EYU20256.1|  hypothetical protein MIMGU_mgv1a002601mg                257   4e-77   Erythranthe guttata [common monkey flower]
ref|XP_011036739.1|  PREDICTED: probable LRR receptor-like serine...    258   5e-77   Populus euphratica
ref|XP_010090613.1|  putative LRR receptor-like serine/threonine-...    253   3e-76   
emb|CBI21051.3|  unnamed protein product                                254   4e-76   Vitis vinifera
gb|KDP33585.1|  hypothetical protein JCGZ_07156                         251   7e-75   Jatropha curcas
ref|XP_010648817.1|  PREDICTED: probable LRR receptor-like serine...    254   8e-75   
gb|KJB07626.1|  hypothetical protein B456_001G034000                    251   1e-74   Gossypium raimondii
ref|XP_008219685.1|  PREDICTED: probable LRR receptor-like serine...    248   3e-73   
ref|XP_010040282.1|  PREDICTED: probable LRR receptor-like serine...    247   3e-73   Eucalyptus grandis [rose gum]
ref|XP_007224199.1|  hypothetical protein PRUPE_ppa017326mg             247   4e-73   Prunus persica
ref|XP_007011844.1|  Leucine-rich repeat transmembrane protein ki...    245   3e-71   
ref|XP_011459850.1|  PREDICTED: probable LRR receptor-like serine...    240   3e-69   Fragaria vesca subsp. vesca
gb|KCW81385.1|  hypothetical protein EUGRSUZ_C02767                     232   7e-68   Eucalyptus grandis [rose gum]
ref|XP_009420716.1|  PREDICTED: probable LRR receptor-like serine...    187   8e-55   
ref|XP_009420717.1|  PREDICTED: probable LRR receptor-like serine...    187   1e-54   
gb|KGN44274.1|  hypothetical protein Csa_7G237890                       185   2e-49   Cucumis sativus [cucumbers]
ref|XP_004139892.1|  PREDICTED: probable LRR receptor-like serine...    185   3e-49   
ref|XP_008447120.1|  PREDICTED: probable LRR receptor-like serine...    184   5e-49   Cucumis melo [Oriental melon]
gb|KCW71214.1|  hypothetical protein EUGRSUZ_F043061                    172   2e-48   Eucalyptus grandis [rose gum]
ref|XP_009128532.1|  PREDICTED: probable LRR receptor-like serine...    178   1e-47   
gb|KDP25093.1|  hypothetical protein JCGZ_22628                         180   2e-47   Jatropha curcas
ref|XP_009127785.1|  PREDICTED: probable LRR receptor-like serine...    178   6e-47   Brassica rapa
emb|CDY43003.1|  BnaC02g19770D                                          179   7e-47   Brassica napus [oilseed rape]
gb|KHM98861.1|  Putative LRR receptor-like serine/threonine-prote...    175   8e-47   Glycine soja [wild soybean]
gb|KHG01148.1|  hypothetical protein F383_22594                         177   1e-46   Gossypium arboreum [tree cotton]
ref|XP_006585736.1|  PREDICTED: probable LRR receptor-like serine...    176   2e-46   
ref|XP_010557141.1|  PREDICTED: probable LRR receptor-like serine...    177   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_010557133.1|  PREDICTED: probable LRR receptor-like serine...    177   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_010557130.1|  PREDICTED: probable LRR receptor-like serine...    177   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_010065125.1|  PREDICTED: probable LRR receptor-like serine...    174   4e-46   
emb|CBI20016.3|  unnamed protein product                                177   5e-46   Vitis vinifera
emb|CDY03757.1|  BnaA02g14800D                                          177   5e-46   
ref|XP_007024832.1|  Leucine-rich repeat transmembrane protein ki...    174   1e-45   
ref|XP_008806782.1|  PREDICTED: probable LRR receptor-like serine...    173   2e-45   
gb|KJB34924.1|  hypothetical protein B456_006G091400                    173   2e-45   Gossypium raimondii
ref|XP_008779611.1|  PREDICTED: probable LRR receptor-like serine...    164   2e-45   
ref|XP_010655872.1|  PREDICTED: probable LRR receptor-like serine...    172   3e-45   Vitis vinifera
gb|AFW59458.1|  putative leucine-rich repeat receptor-like protei...    166   4e-45   
emb|CAN74435.1|  hypothetical protein VITISV_041450                     173   4e-45   Vitis vinifera
ref|XP_002272816.2|  PREDICTED: probable LRR receptor-like serine...    173   5e-45   Vitis vinifera
ref|XP_010557120.1|  PREDICTED: probable LRR receptor-like serine...    172   5e-45   Tarenaya hassleriana [spider flower]
ref|XP_010557111.1|  PREDICTED: probable LRR receptor-like serine...    173   6e-45   Tarenaya hassleriana [spider flower]
ref|XP_010557103.1|  PREDICTED: probable LRR receptor-like serine...    172   7e-45   Tarenaya hassleriana [spider flower]
ref|XP_006853421.1|  hypothetical protein AMTR_s00032p00162420          171   7e-45   
gb|KFK35534.1|  hypothetical protein AALP_AA4G003100                    172   8e-45   Arabis alpina [alpine rockcress]
ref|XP_002513383.1|  ATP binding protein, putative                      172   8e-45   
gb|KCW71353.1|  hypothetical protein EUGRSUZ_F04434                     172   1e-44   Eucalyptus grandis [rose gum]
gb|KCW71354.1|  hypothetical protein EUGRSUZ_F04434                     172   1e-44   Eucalyptus grandis [rose gum]
emb|CBI39030.3|  unnamed protein product                                173   1e-44   Vitis vinifera
ref|XP_006853422.1|  hypothetical protein AMTR_s00032p00163130          169   2e-44   
ref|XP_010942352.1|  PREDICTED: probable LRR receptor-like serine...    171   2e-44   Elaeis guineensis
emb|CAN66709.1|  hypothetical protein VITISV_006396                     171   2e-44   Vitis vinifera
gb|EYU27557.1|  hypothetical protein MIMGU_mgv1a018669mg                171   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_009412046.1|  PREDICTED: probable LRR receptor-like serine...    171   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010480180.1|  PREDICTED: probable LRR receptor-like serine...    171   3e-44   
ref|XP_010480178.1|  PREDICTED: probable LRR receptor-like serine...    171   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010480179.1|  PREDICTED: probable LRR receptor-like serine...    170   4e-44   
ref|XP_010093040.1|  putative LRR receptor-like serine/threonine-...    170   5e-44   
ref|XP_009389704.1|  PREDICTED: probable LRR receptor-like serine...    167   5e-44   
ref|XP_010064054.1|  PREDICTED: probable LRR receptor-like serine...    170   5e-44   Eucalyptus grandis [rose gum]
gb|KCW71360.1|  hypothetical protein EUGRSUZ_F04441                     167   5e-44   Eucalyptus grandis [rose gum]
emb|CDY10508.1|  BnaC03g71060D                                          170   5e-44   Brassica napus [oilseed rape]
ref|XP_010480176.1|  PREDICTED: probable LRR receptor-like serine...    170   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010064057.1|  PREDICTED: probable LRR receptor-like serine...    169   7e-44   
ref|XP_002303698.2|  hypothetical protein POPTR_0003s14780g             169   7e-44   
gb|KFK41450.1|  hypothetical protein AALP_AA2G132100                    169   7e-44   Arabis alpina [alpine rockcress]
ref|XP_010910216.1|  PREDICTED: probable LRR receptor-like serine...    164   7e-44   
ref|XP_010657566.1|  PREDICTED: probable LRR receptor-like serine...    169   8e-44   
ref|XP_010064056.1|  PREDICTED: probable LRR receptor-like serine...    169   9e-44   
ref|XP_010501248.1|  PREDICTED: probable LRR receptor-like serine...    169   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010064055.1|  PREDICTED: probable LRR receptor-like serine...    169   1e-43   Eucalyptus grandis [rose gum]
emb|CDP20736.1|  unnamed protein product                                169   1e-43   Coffea canephora [robusta coffee]
gb|KDO61621.1|  hypothetical protein CISIN_1g001658mg                   169   1e-43   Citrus sinensis [apfelsine]
gb|KJB14002.1|  hypothetical protein B456_002G105800                    169   1e-43   Gossypium raimondii
ref|XP_002267129.1|  PREDICTED: probable LRR receptor-like serine...    169   1e-43   Vitis vinifera
ref|XP_010657565.1|  PREDICTED: probable LRR receptor-like serine...    168   2e-43   
ref|XP_007133315.1|  hypothetical protein PHAVU_011G169300g             168   2e-43   Phaseolus vulgaris [French bean]
ref|XP_010064059.1|  PREDICTED: probable LRR receptor-like serine...    168   2e-43   Eucalyptus grandis [rose gum]
gb|AAF02836.1|AC009894_7  Very similar to receptor-like serine/th...    167   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AFW59459.1|  putative leucine-rich repeat receptor-like protei...    165   3e-43   
gb|KFK44732.1|  hypothetical protein AALP_AA1G295500                    167   3e-43   Arabis alpina [alpine rockcress]
ref|XP_010064058.1|  PREDICTED: probable LRR receptor-like serine...    167   4e-43   Eucalyptus grandis [rose gum]
gb|KJB69988.1|  hypothetical protein B456_011G052400                    167   4e-43   Gossypium raimondii
gb|KJB69989.1|  hypothetical protein B456_011G052400                    166   4e-43   Gossypium raimondii
ref|XP_002964542.1|  hypothetical protein SELMODRAFT_438852             165   5e-43   
ref|XP_008361649.1|  PREDICTED: probable LRR receptor-like serine...    164   5e-43   
ref|XP_010462494.1|  PREDICTED: probable LRR receptor-like serine...    167   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010462496.1|  PREDICTED: probable LRR receptor-like serine...    167   5e-43   
ref|NP_176008.4|  Leucine-rich repeat transmembrane protein kinase      167   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564709.2|  leucine-rich repeat transmembrane protein kinase      167   6e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAF02840.1|AC009894_11  Similar to serine/threonine kinases          167   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908219.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    166   7e-43   
ref|NP_176009.1|  putative LRR receptor-like serine/threonine-pro...    166   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480195.1|  PREDICTED: probable LRR receptor-like serine...    166   9e-43   Camelina sativa [gold-of-pleasure]
gb|AAF02838.1|AC009894_9  Similar to serine/threonine kinases           166   9e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894561.1|  leucine-rich repeat family protein                 166   1e-42   
ref|XP_009361862.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    164   1e-42   
gb|KEH19476.1|  LRR receptor-like kinase, putative                      165   1e-42   Medicago truncatula
ref|XP_009106802.1|  PREDICTED: probable LRR receptor-like serine...    166   1e-42   Brassica rapa
ref|XP_010064741.1|  PREDICTED: probable LRR receptor-like serine...    166   1e-42   Eucalyptus grandis [rose gum]
ref|XP_009105697.1|  PREDICTED: probable LRR receptor-like serine...    164   1e-42   Brassica rapa
gb|KCW68790.1|  hypothetical protein EUGRSUZ_F023912                    166   1e-42   Eucalyptus grandis [rose gum]
ref|XP_010501252.1|  PREDICTED: probable LRR receptor-like serine...    166   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002993125.1|  hypothetical protein SELMODRAFT_431263             164   1e-42   
ref|XP_009106801.1|  PREDICTED: probable LRR receptor-like serine...    166   1e-42   Brassica rapa
emb|CDY42407.1|  BnaA08g00070D                                          166   1e-42   Brassica napus [oilseed rape]
gb|AAG50909.1|AC069159_10  receptor protein kinase, putative            167   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007214107.1|  hypothetical protein PRUPE_ppa017049mg             166   1e-42   Prunus persica
ref|XP_002894562.1|  leucine-rich repeat family protein                 166   1e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_006390899.1|  hypothetical protein EUTSA_v10018064mg             166   1e-42   Eutrema salsugineum [saltwater cress]
gb|KDP29558.1|  hypothetical protein JCGZ_19271                         158   2e-42   Jatropha curcas
emb|CDY11604.1|  BnaC06g31350D                                          163   2e-42   Brassica napus [oilseed rape]
emb|CAN83900.1|  hypothetical protein VITISV_034202                     165   2e-42   Vitis vinifera
ref|XP_010501250.1|  PREDICTED: probable LRR receptor-like serine...    165   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010501251.1|  PREDICTED: probable LRR receptor-like serine...    165   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_008663599.1|  PREDICTED: probable LRR receptor-like serine...    165   3e-42   Zea mays [maize]
gb|KHM98859.1|  Putative LRR receptor-like serine/threonine-prote...    165   3e-42   Glycine soja [wild soybean]
gb|KDO77515.1|  hypothetical protein CISIN_1g0025621mg                  162   3e-42   Citrus sinensis [apfelsine]
ref|XP_002894563.1|  predicted protein                                  166   3e-42   
gb|KFK35535.1|  hypothetical protein AALP_AA4G003200                    164   4e-42   Arabis alpina [alpine rockcress]
ref|XP_011069383.1|  PREDICTED: probable LRR receptor-like serine...    164   4e-42   Sesamum indicum [beniseed]
ref|XP_010463512.1|  PREDICTED: probable LRR receptor-like serine...    162   4e-42   
gb|KEH19475.1|  LRR receptor-like kinase, putative                      164   4e-42   Medicago truncatula
ref|XP_008371856.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    162   5e-42   
gb|KJB84220.1|  hypothetical protein B456_N011200                       164   5e-42   Gossypium raimondii
ref|XP_008226109.1|  PREDICTED: probable LRR receptor-like serine...    164   6e-42   Prunus mume [ume]
emb|CBI20535.3|  unnamed protein product                                164   6e-42   Vitis vinifera
ref|XP_006346232.1|  PREDICTED: probable LRR receptor-like serine...    165   6e-42   
gb|KDO77514.1|  hypothetical protein CISIN_1g0025621mg                  162   6e-42   Citrus sinensis [apfelsine]
ref|XP_010645959.1|  PREDICTED: probable LRR receptor-like serine...    163   7e-42   Vitis vinifera
gb|KHN30298.1|  Putative LRR receptor-like serine/threonine-prote...    162   7e-42   Glycine soja [wild soybean]
ref|XP_011462047.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    164   8e-42   Fragaria vesca subsp. vesca
ref|XP_006303851.1|  hypothetical protein CARUB_v10012587mg             163   8e-42   
ref|XP_002271607.3|  PREDICTED: probable LRR receptor-like serine...    164   8e-42   Vitis vinifera
ref|XP_010645957.1|  PREDICTED: probable LRR receptor-like serine...    164   9e-42   Vitis vinifera
ref|XP_002310677.1|  leucine-rich repeat family protein                 164   9e-42   
ref|XP_002894560.1|  leucine-rich repeat family protein                 164   9e-42   
ref|XP_002970734.1|  hypothetical protein SELMODRAFT_411551             161   1e-41   
emb|CDY38804.1|  BnaA07g28760D                                          161   1e-41   Brassica napus [oilseed rape]
ref|XP_003531816.1|  PREDICTED: probable LRR receptor-like serine...    163   1e-41   Glycine max [soybeans]
ref|XP_004243974.1|  PREDICTED: probable LRR receptor-like serine...    163   1e-41   Solanum lycopersicum
ref|XP_007022387.1|  Leucine-rich repeat transmembrane protein ki...    163   1e-41   
ref|XP_007211341.1|  hypothetical protein PRUPE_ppa001211mg             162   1e-41   
ref|XP_010324206.1|  PREDICTED: probable LRR receptor-like serine...    163   1e-41   
ref|XP_006587157.1|  PREDICTED: probable LRR receptor-like serine...    163   1e-41   
ref|XP_008225769.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    164   1e-41   
ref|XP_007024836.1|  Leucine-rich repeat transmembrane protein ki...    163   1e-41   
gb|KCW44835.1|  hypothetical protein EUGRSUZ_L01594                     162   2e-41   Eucalyptus grandis [rose gum]
emb|CDY10509.1|  BnaC03g71050D                                          162   2e-41   Brassica napus [oilseed rape]
ref|XP_009608510.1|  PREDICTED: probable LRR receptor-like serine...    162   2e-41   Nicotiana tomentosiformis
ref|XP_006392562.1|  hypothetical protein EUTSA_v10011215mg             162   2e-41   
ref|XP_010244460.1|  PREDICTED: probable LRR receptor-like serine...    163   2e-41   
ref|XP_011006995.1|  PREDICTED: probable LRR receptor-like serine...    162   3e-41   Populus euphratica
ref|XP_010480181.1|  PREDICTED: probable LRR receptor-like serine...    162   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_007024834.1|  Leucine-rich repeat transmembrane protein ki...    162   3e-41   
ref|XP_010501246.1|  PREDICTED: probable LRR receptor-like serine...    162   3e-41   Camelina sativa [gold-of-pleasure]
dbj|BAF01001.1|  putative receptor-like protein kinase                  161   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022401.1|  PREDICTED: probable LRR receptor-like serine...    161   4e-41   Populus euphratica
ref|XP_011022400.1|  PREDICTED: probable LRR receptor-like serine...    162   4e-41   Populus euphratica
ref|XP_010040869.1|  PREDICTED: probable LRR receptor-like serine...    162   5e-41   
ref|XP_006468414.1|  PREDICTED: probable LRR receptor-like serine...    161   5e-41   Citrus sinensis [apfelsine]
ref|XP_006306656.1|  hypothetical protein CARUB_v10008172mg             161   5e-41   Capsella rubella
ref|XP_006448781.1|  hypothetical protein CICLE_v10018029mg             161   5e-41   
gb|EEE68221.1|  hypothetical protein OsJ_26393                          160   7e-41   Oryza sativa Japonica Group [Japonica rice]
gb|AAF02839.1|AC009894_10  Similar to serine/threonine kinases          160   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564710.1|  leucine-rich repeat transmembrane protein kinase      160   9e-41   Arabidopsis thaliana [mouse-ear cress]
gb|EYU33781.1|  hypothetical protein MIMGU_mgv1a000612mg                160   9e-41   Erythranthe guttata [common monkey flower]
ref|NP_001185247.1|  leucine-rich repeat transmembrane protein ki...    160   9e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004516051.1|  PREDICTED: probable LRR receptor-like serine...    160   9e-41   
ref|XP_009409824.1|  PREDICTED: probable LRR receptor-like serine...    159   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002273016.1|  PREDICTED: probable LRR receptor-like serine...    160   9e-41   Vitis vinifera
ref|NP_001061223.1|  Os08g0203400                                       160   1e-40   
ref|XP_004516049.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   Cicer arietinum [garbanzo]
ref|XP_010941603.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   Elaeis guineensis
ref|XP_009771802.1|  PREDICTED: probable LRR receptor-like serine...    160   1e-40   Nicotiana sylvestris
ref|XP_008353269.1|  PREDICTED: probable LRR receptor-like serine...    158   1e-40   
gb|KDP36457.1|  hypothetical protein JCGZ_08587                         160   1e-40   Jatropha curcas
ref|XP_004516050.1|  PREDICTED: probable LRR receptor-like serine...    160   2e-40   
gb|EEE61688.1|  hypothetical protein OsJ_16161                          159   2e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010244452.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010244453.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010244456.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006448778.1|  hypothetical protein CICLE_v10014641mg             157   2e-40   
ref|XP_010244449.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   Nelumbo nucifera [Indian lotus]
emb|CBI39037.3|  unnamed protein product                                159   2e-40   Vitis vinifera
ref|XP_010244454.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_003633055.2|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   Vitis vinifera
ref|XP_010244451.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010244448.1|  PREDICTED: probable LRR receptor-like serine...    159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006659918.1|  PREDICTED: uncharacterized protein LOC102723075    160   2e-40   
ref|XP_010244450.1|  PREDICTED: probable LRR receptor-like serine...    159   3e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010244447.1|  PREDICTED: probable LRR receptor-like serine...    159   3e-40   
gb|EEC83075.1|  hypothetical protein OsI_28198                          159   3e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_006659921.1|  PREDICTED: probable LRR receptor-like serine...    159   3e-40   Oryza brachyantha
ref|XP_007211340.1|  hypothetical protein PRUPE_ppa001152mg             158   4e-40   
ref|XP_008368361.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    158   4e-40   
gb|KCW71355.1|  hypothetical protein EUGRSUZ_F04436                     158   4e-40   Eucalyptus grandis [rose gum]
gb|KDO77511.1|  hypothetical protein CISIN_1g0025811mg                  157   5e-40   Citrus sinensis [apfelsine]
gb|AFW56974.1|  putative leucine-rich repeat receptor-like protei...    157   6e-40   
ref|XP_008374902.1|  PREDICTED: probable LRR receptor-like serine...    158   6e-40   
ref|XP_006653770.1|  PREDICTED: probable LRR receptor-like serine...    159   6e-40   
gb|KDO77509.1|  hypothetical protein CISIN_1g0380191mg                  156   7e-40   Citrus sinensis [apfelsine]
ref|XP_009389705.1|  PREDICTED: probable LRR receptor-like serine...    155   7e-40   
emb|CAJ86314.1|  H0525G02.11                                            158   8e-40   Oryza sativa [red rice]
ref|XP_006847777.1|  hypothetical protein AMTR_s00162p00061440          151   8e-40   
gb|EMT28000.1|  Putative LRR receptor-like serine/threonine-prote...    157   1e-39   
ref|XP_010645976.1|  PREDICTED: probable LRR receptor-like serine...    157   2e-39   
ref|XP_006448777.1|  hypothetical protein CICLE_v10018038mg             157   2e-39   
ref|XP_009106800.1|  PREDICTED: probable LRR receptor-like serine...    157   2e-39   Brassica rapa
ref|XP_008662731.1|  PREDICTED: probable LRR receptor-like serine...    157   2e-39   
ref|XP_010098477.1|  putative LRR receptor-like serine/threonine-...    156   2e-39   
gb|EEC78008.1|  hypothetical protein OsI_17411                          158   2e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_011069399.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-39   
ref|XP_006468413.1|  PREDICTED: probable LRR receptor-like serine...    156   3e-39   
ref|XP_006468410.1|  PREDICTED: probable LRR receptor-like serine...    156   3e-39   Citrus sinensis [apfelsine]
ref|XP_002529290.1|  ATP binding protein, putative                      154   3e-39   
gb|KCW71359.1|  hypothetical protein EUGRSUZ_F044401                    150   3e-39   Eucalyptus grandis [rose gum]
ref|XP_008371858.1|  PREDICTED: probable LRR receptor-like serine...    155   3e-39   
ref|XP_006659920.1|  PREDICTED: probable LRR receptor-like serine...    156   3e-39   
gb|KCW71361.1|  hypothetical protein EUGRSUZ_F04443                     154   4e-39   Eucalyptus grandis [rose gum]
emb|CAD41884.2|  OSJNBa0093O08.3                                        156   4e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006448775.1|  hypothetical protein CICLE_v10014117mg             156   4e-39   Citrus clementina [clementine]
ref|XP_006468409.1|  PREDICTED: probable LRR receptor-like serine...    156   4e-39   Citrus sinensis [apfelsine]
emb|CAN66040.1|  hypothetical protein VITISV_035756                     153   4e-39   Vitis vinifera
ref|NP_001061222.1|  Os08g0203300                                       154   4e-39   
emb|CAD41885.2|  OSJNBa0093O08.4                                        155   6e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010645958.1|  PREDICTED: probable LRR receptor-like serine...    155   6e-39   Vitis vinifera
ref|XP_006422235.1|  hypothetical protein CICLE_v10007054mg             155   6e-39   
gb|EEE61689.1|  hypothetical protein OsJ_16162                          155   7e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009341192.1|  PREDICTED: probable LRR receptor-like serine...    155   7e-39   
gb|KJB69971.1|  hypothetical protein B456_011G052300                    153   8e-39   Gossypium raimondii
ref|XP_004972617.1|  PREDICTED: probable LRR receptor-like serine...    155   8e-39   
ref|XP_006659919.1|  PREDICTED: probable LRR receptor-like serine...    155   8e-39   
ref|XP_006392563.1|  hypothetical protein EUTSA_v10012222mg             155   1e-38   
gb|KJB69970.1|  hypothetical protein B456_011G052300                    153   1e-38   Gossypium raimondii
gb|KJB69969.1|  hypothetical protein B456_011G052300                    152   1e-38   Gossypium raimondii
ref|XP_009341189.1|  PREDICTED: probable LRR receptor-like serine...    154   1e-38   
gb|EEE61686.1|  hypothetical protein OsJ_16159                          154   1e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CAD41882.2|  OSJNBa0093O08.1                                        154   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004972616.1|  PREDICTED: probable LRR receptor-like serine...    154   1e-38   Setaria italica
ref|XP_004976817.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-38   Setaria italica
emb|CAJ86064.1|  H0818E11.1                                             155   2e-38   Oryza sativa [red rice]
ref|XP_004972615.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-38   
gb|EAY95562.1|  hypothetical protein OsI_17410                          154   2e-38   Oryza sativa Indica Group [Indian rice]
gb|EEC83074.1|  hypothetical protein OsI_28197                          153   2e-38   Oryza sativa Indica Group [Indian rice]
emb|CAJ86313.1|  H0525G02.10                                            154   2e-38   Oryza sativa [red rice]
gb|EEE68220.1|  hypothetical protein OsJ_26392                          154   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011026778.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-38   Populus euphratica
ref|XP_010655871.1|  PREDICTED: probable LRR receptor-like serine...    154   2e-38   Vitis vinifera
ref|XP_007203797.1|  hypothetical protein PRUPE_ppa000802mg             154   2e-38   
gb|EEC83072.1|  hypothetical protein OsI_28195                          153   3e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_008355565.1|  PREDICTED: probable LRR receptor-like serine...    150   3e-38   
dbj|BAG98816.1|  unnamed protein product                                146   3e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CAD41800.2|  OSJNBa0008M17.16                                       153   3e-38   Oryza sativa Japonica Group [Japonica rice]
gb|KHG20508.1|  hypothetical protein F383_03730                         153   4e-38   Gossypium arboreum [tree cotton]
ref|XP_002983367.1|  hypothetical protein SELMODRAFT_180094             150   4e-38   
gb|AAY67902.1|  SHR5-receptor-like kinase                               153   4e-38   Saccharum hybrid cultivar SP70-1143
ref|XP_002448532.1|  hypothetical protein SORBIDRAFT_06g028570          152   5e-38   
ref|XP_008795773.1|  PREDICTED: probable LRR receptor-like serine...    153   5e-38   Phoenix dactylifera
ref|XP_008795771.1|  PREDICTED: probable LRR receptor-like serine...    153   5e-38   Phoenix dactylifera
ref|NP_001053881.1|  Os04g0616700                                       152   5e-38   
emb|CAD41886.2|  OSJNBa0093O08.5                                        152   5e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CAN73906.1|  hypothetical protein VITISV_029158                     150   6e-38   Vitis vinifera
gb|EEE61690.1|  hypothetical protein OsJ_16163                          152   6e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007024833.1|  Leucine-rich repeat transmembrane protein ki...    153   6e-38   
ref|XP_002448531.1|  hypothetical protein SORBIDRAFT_06g028560          152   6e-38   
ref|XP_010684922.1|  PREDICTED: probable LRR receptor-like serine...    152   7e-38   
ref|XP_010098478.1|  putative LRR receptor-like serine/threonine-...    152   7e-38   
gb|KJB69968.1|  hypothetical protein B456_011G052300                    152   7e-38   
gb|EMT06735.1|  Putative LRR receptor-like serine/threonine-prote...    152   7e-38   
gb|KJB69967.1|  hypothetical protein B456_011G052300                    152   8e-38   
ref|XP_007021941.1|  Leucine-rich repeat transmembrane protein ki...    152   9e-38   
emb|CDX67736.1|  BnaA07g17760D                                          152   9e-38   
ref|XP_011097808.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    152   9e-38   
emb|CDY59119.1|  BnaCnng34350D                                          152   1e-37   
emb|CDX98288.1|  BnaC06g16490D                                          152   1e-37   
ref|XP_007021935.1|  Leucine-rich repeat transmembrane protein ki...    152   1e-37   
ref|XP_009104133.1|  PREDICTED: probable LRR receptor-like serine...    152   1e-37   
ref|XP_007214789.1|  hypothetical protein PRUPE_ppa015982mg             150   1e-37   
ref|XP_006392561.1|  hypothetical protein EUTSA_v10012006mg             152   1e-37   
ref|XP_007021942.1|  Leucine-rich repeat transmembrane protein ki...    151   1e-37   
ref|XP_007021940.1|  Leucine-rich repeat transmembrane protein ki...    151   1e-37   
ref|XP_011460820.1|  PREDICTED: probable leucine-rich repeat rece...    151   2e-37   
ref|XP_006659922.1|  PREDICTED: probable LRR receptor-like serine...    151   2e-37   
ref|XP_002444009.1|  hypothetical protein SORBIDRAFT_07g005820          151   2e-37   
gb|KJB69980.1|  hypothetical protein B456_011G052100                    151   2e-37   
ref|XP_010921615.1|  PREDICTED: probable LRR receptor-like serine...    151   2e-37   
ref|XP_004295664.2|  PREDICTED: probable leucine-rich repeat rece...    151   2e-37   
ref|XP_004955901.1|  PREDICTED: probable LRR receptor-like serine...    151   2e-37   
ref|XP_010684924.1|  PREDICTED: probable LRR receptor-like serine...    150   3e-37   
ref|XP_002526908.1|  ATP binding protein, putative                      150   3e-37   
ref|XP_004976815.1|  PREDICTED: probable LRR receptor-like serine...    150   3e-37   
ref|XP_010272733.1|  PREDICTED: probable LRR receptor-like serine...    150   4e-37   
gb|KHF97788.1|  hypothetical protein F383_13818                         147   4e-37   
ref|XP_006653768.1|  PREDICTED: probable LRR receptor-like serine...    150   4e-37   
ref|XP_006306665.1|  hypothetical protein CARUB_v10008183mg             150   5e-37   
ref|XP_004955903.1|  PREDICTED: probable LRR receptor-like serine...    150   5e-37   
ref|XP_004955904.1|  PREDICTED: probable LRR receptor-like serine...    150   5e-37   
ref|XP_004955905.1|  PREDICTED: probable LRR receptor-like serine...    150   5e-37   
ref|XP_008792302.1|  PREDICTED: probable LRR receptor-like serine...    150   5e-37   
ref|XP_004955902.1|  PREDICTED: probable LRR receptor-like serine...    150   5e-37   
dbj|BAJ53166.1|  JHL10I11.12                                            149   5e-37   
ref|XP_008355564.1|  PREDICTED: probable LRR receptor-like serine...    150   5e-37   
ref|XP_009386587.1|  PREDICTED: probable LRR receptor-like serine...    150   5e-37   
gb|KJB45807.1|  hypothetical protein B456_007G329800                    147   5e-37   
dbj|BAD03114.1|  Receptor-like serine/threonine kinase(RFK1)-like...    146   5e-37   
ref|XP_002436559.1|  hypothetical protein SORBIDRAFT_10g004730          147   6e-37   
gb|AGT17045.1|  SHR5-receptor-like kinase                               149   6e-37   
ref|XP_010240425.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    149   6e-37   
ref|XP_008353273.1|  PREDICTED: probable LRR receptor-like serine...    148   6e-37   
ref|XP_002532988.1|  conserved hypothetical protein                     149   7e-37   
ref|XP_009341191.1|  PREDICTED: probable LRR receptor-like serine...    149   8e-37   
gb|KDP20042.1|  hypothetical protein JCGZ_05811                         149   8e-37   
gb|EEE68222.1|  hypothetical protein OsJ_26394                          149   9e-37   
ref|XP_010272732.1|  PREDICTED: probable LRR receptor-like serine...    149   1e-36   
gb|EMT28001.1|  Putative LRR receptor-like serine/threonine-prote...    149   1e-36   
ref|XP_004976816.1|  PREDICTED: probable LRR receptor-like serine...    149   1e-36   
dbj|BAJ95627.1|  predicted protein                                      149   1e-36   
gb|EEE68215.1|  hypothetical protein OsJ_26387                          146   1e-36   
ref|XP_007214280.1|  hypothetical protein PRUPE_ppa026535mg             149   1e-36   
ref|XP_003581672.1|  PREDICTED: probable LRR receptor-like serine...    149   1e-36   
gb|KJB61521.1|  hypothetical protein B456_009G363600                    149   1e-36   
gb|EEE61687.1|  hypothetical protein OsJ_16160                          148   2e-36   
ref|XP_006653769.1|  PREDICTED: probable LRR receptor-like serine...    148   2e-36   
gb|EEE63024.1|  hypothetical protein OsJ_17832                          148   2e-36   
ref|NP_001061218.2|  Os08g0202300                                       146   2e-36   
ref|XP_006853337.1|  hypothetical protein AMTR_s00032p00079260          148   2e-36   
gb|AHG54200.1|  LRR receptor-like protein kinase 2                      148   2e-36   
gb|AHG54199.1|  LRR receptor-like protein kinase 1                      148   2e-36   
ref|XP_003617471.1|  BED finger-nbs resistance protein                  148   2e-36   
emb|CAD41883.2|  OSJNBa0093O08.2                                        148   2e-36   
gb|KDP35216.1|  hypothetical protein JCGZ_09375                         147   3e-36   
gb|EAY97291.1|  hypothetical protein OsI_19212                          147   3e-36   
gb|KJB69978.1|  hypothetical protein B456_011G052000                    147   3e-36   
gb|KEH28415.1|  LRR receptor-like kinase                                147   4e-36   
gb|EEC80088.1|  hypothetical protein OsI_21825                          145   4e-36   
gb|KEH28414.1|  LRR receptor-like kinase                                147   4e-36   
ref|XP_010274130.1|  PREDICTED: probable LRR receptor-like serine...    147   5e-36   
ref|XP_008668504.1|  PREDICTED: uncharacterized protein LOC100384...    144   5e-36   
tpg|DAA36010.1|  TPA: putative leucine-rich repeat receptor-like ...    144   5e-36   
ref|XP_008465063.1|  PREDICTED: probable LRR receptor-like serine...    147   5e-36   
ref|XP_010670584.1|  PREDICTED: probable LRR receptor-like serine...    147   5e-36   
ref|XP_010924705.1|  PREDICTED: probable LRR receptor-like serine...    146   5e-36   
ref|XP_008465065.1|  PREDICTED: probable LRR receptor-like serine...    147   5e-36   
ref|XP_008465062.1|  PREDICTED: probable LRR receptor-like serine...    147   5e-36   
emb|CDY47811.1|  BnaC07g17020D                                          147   6e-36   
gb|KCW71209.1|  hypothetical protein EUGRSUZ_F04301                     145   6e-36   
dbj|BAD27712.1|  disease resistance protein Cf-2.1-like                 145   6e-36   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...    147   6e-36   
gb|AET00430.2|  LRR receptor-like kinase                                147   7e-36   
ref|XP_010065123.1|  PREDICTED: probable LRR receptor-like serine...    146   9e-36   
ref|NP_001056921.1|  Os06g0167500                                       144   1e-35   
ref|XP_006847778.1|  hypothetical protein AMTR_s00162p00065340          145   1e-35   
ref|XP_008668505.1|  PREDICTED: uncharacterized protein LOC100384...    143   1e-35   
dbj|BAD03117.1|  putative Receptor-like serine/threonine kinase(R...    145   2e-35   
ref|XP_004964739.1|  PREDICTED: probable LRR receptor-like serine...    143   2e-35   
gb|KDO52103.1|  hypothetical protein CISIN_1g043333mg                   144   2e-35   
gb|EEC83071.1|  hypothetical protein OsI_28194                          145   2e-35   
ref|XP_010098476.1|  putative LRR receptor-like serine/threonine-...    145   2e-35   
gb|EEC72788.1|  hypothetical protein OsI_06468                          145   2e-35   
ref|NP_001061225.1|  Os08g0203700                                       145   2e-35   
ref|XP_006442308.1|  hypothetical protein CICLE_v10024314mg             145   2e-35   
gb|EEE63012.1|  hypothetical protein OsJ_17820                          144   2e-35   
emb|CBI20543.3|  unnamed protein product                                145   3e-35   
gb|KEH38568.1|  LRR receptor-like kinase                                144   3e-35   
gb|EEC83070.1|  hypothetical protein OsI_28191                          144   3e-35   
ref|XP_010645966.1|  PREDICTED: probable LRR receptor-like serine...    145   3e-35   
ref|XP_010645965.1|  PREDICTED: probable LRR receptor-like serine...    144   4e-35   
ref|XP_002270976.3|  PREDICTED: probable LRR receptor-like serine...    144   4e-35   
ref|XP_010242177.1|  PREDICTED: probable LRR receptor-like serine...    144   4e-35   
gb|EEE56614.1|  hypothetical protein OsJ_05994                          144   5e-35   
gb|KEH38567.1|  LRR receptor-like kinase                                144   5e-35   
ref|XP_008648855.1|  PREDICTED: probable LRR receptor-like serine...    140   5e-35   
ref|XP_010247776.1|  PREDICTED: probable LRR receptor-like serine...    144   5e-35   
gb|EEC78859.1|  hypothetical protein OsI_19211                          144   5e-35   
gb|KEH38566.1|  LRR receptor-like kinase                                144   6e-35   
gb|AAT73682.1|  hypothetical protein, contains protein kinase domain    144   7e-35   
emb|CDY22357.1|  BnaA06g36790D                                          144   7e-35   
ref|XP_008648854.1|  PREDICTED: probable LRR receptor-like serine...    140   7e-35   
ref|XP_009101796.1|  PREDICTED: probable LRR receptor-like serine...    144   7e-35   
gb|KEH19252.1|  LRR receptor-like kinase, putative                      143   8e-35   
gb|KEH19253.1|  LRR receptor-like kinase, putative                      143   8e-35   
gb|EEC78860.1|  hypothetical protein OsI_19213                          144   8e-35   
ref|XP_007021933.1|  Leucine-rich repeat transmembrane protein ki...    143   9e-35   
dbj|BAD29102.1|  leucine-rich repeat family protein /protein kina...    142   9e-35   
emb|CBI20124.3|  unnamed protein product                                143   1e-34   
ref|XP_007021934.1|  Leucine-rich repeat transmembrane protein ki...    143   1e-34   
gb|EAY95560.1|  hypothetical protein OsI_17408                          143   1e-34   
gb|KEH19251.1|  LRR receptor-like kinase, putative                      143   1e-34   
gb|KDO42390.1|  hypothetical protein CISIN_1g001767mg                   142   1e-34   
ref|XP_002283596.2|  PREDICTED: probable leucine-rich repeat rece...    143   1e-34   
ref|XP_011460815.1|  PREDICTED: probable LRR receptor-like serine...    143   1e-34   
ref|XP_006477832.1|  PREDICTED: probable leucine-rich repeat rece...    143   1e-34   
ref|XP_008663597.1|  PREDICTED: probable LRR receptor-like serine...    142   1e-34   
ref|XP_008663598.1|  PREDICTED: probable LRR receptor-like serine...    142   1e-34   
ref|XP_004513262.1|  PREDICTED: probable LRR receptor-like serine...    143   1e-34   
ref|XP_011098190.1|  PREDICTED: probable LRR receptor-like serine...    143   1e-34   
emb|CAN81779.1|  hypothetical protein VITISV_034284                     142   1e-34   
gb|AFW59454.1|  putative leucine-rich repeat receptor-like protei...    142   1e-34   
ref|XP_006655140.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-34   
ref|XP_008663594.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-34   
ref|XP_007021938.1|  Leucine-rich repeat transmembrane protein ki...    142   2e-34   
ref|XP_007214610.1|  hypothetical protein PRUPE_ppa000890mg             142   2e-34   
ref|XP_010644091.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-34   
gb|KJB12984.1|  hypothetical protein B456_002G048600                    142   2e-34   
gb|KEH19394.1|  LRR receptor-like kinase                                142   2e-34   
ref|XP_006477836.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-34   
gb|KDO42388.1|  hypothetical protein CISIN_1g001767mg                   142   2e-34   
gb|AES66492.2|  LRR receptor-like kinase                                142   2e-34   
gb|KCW44680.1|  hypothetical protein EUGRSUZ_L01787                     142   2e-34   
ref|XP_006659917.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-34   
gb|AFW59455.1|  putative leucine-rich repeat receptor-like protei...    142   2e-34   
ref|XP_006410027.1|  hypothetical protein EUTSA_v10016175mg             141   2e-34   
gb|KHN36924.1|  Putative LRR receptor-like serine/threonine-prote...    140   2e-34   
ref|XP_006442369.1|  hypothetical protein CICLE_v10018721mg             142   2e-34   
ref|XP_011082787.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-34   
gb|KHG23625.1|  hypothetical protein F383_06517                         140   2e-34   
gb|EMT27999.1|  Putative LRR receptor-like serine/threonine-prote...    142   3e-34   
ref|XP_006348929.1|  PREDICTED: probable LRR receptor-like serine...    142   3e-34   
ref|XP_003628439.1|  Leucine-rich repeat family protein / protein...    142   3e-34   
gb|KEH38591.1|  LRR receptor-like kinase                                142   3e-34   
emb|CBI20154.3|  unnamed protein product                                142   3e-34   
dbj|BAD73822.1|  putative Receptor-like serine/threonine kinase(R...    141   3e-34   
gb|EEE68212.1|  hypothetical protein OsJ_26381                          142   3e-34   
gb|EEE69521.1|  hypothetical protein OsJ_28982                          142   3e-34   
gb|EEC84403.1|  hypothetical protein OsI_30981                          142   3e-34   
gb|AET02915.2|  LRR receptor-like kinase                                142   3e-34   
gb|KEH19393.1|  LRR receptor-like kinase                                141   3e-34   
ref|XP_007149536.1|  hypothetical protein PHAVU_005G078400g             142   3e-34   
ref|XP_003596262.1|  Receptor-like serine/threonine kinase              142   4e-34   
ref|XP_006306727.1|  hypothetical protein CARUB_v10008256mg             141   4e-34   
emb|CDY12693.1|  BnaA02g13610D                                          141   4e-34   
ref|XP_010045443.1|  PREDICTED: probable LRR receptor-like serine...    141   4e-34   
gb|KCW84086.1|  hypothetical protein EUGRSUZ_B00972                     141   4e-34   
gb|KEH38570.1|  cysteine-rich RLK (receptor-like kinase) protein        140   5e-34   
ref|XP_010678919.1|  PREDICTED: probable LRR receptor-like serine...    141   5e-34   
ref|XP_009127600.1|  PREDICTED: probable LRR receptor-like serine...    141   5e-34   
ref|XP_006477831.1|  PREDICTED: probable leucine-rich repeat rece...    141   5e-34   
ref|XP_006477830.1|  PREDICTED: probable leucine-rich repeat rece...    141   5e-34   
ref|XP_011462168.1|  PREDICTED: probable LRR receptor-like serine...    136   5e-34   
emb|CAJ86312.1|  H0525G02.9                                             141   5e-34   
ref|XP_006410026.1|  hypothetical protein EUTSA_v10016175mg             141   6e-34   
ref|XP_010234448.1|  PREDICTED: probable LRR receptor-like serine...    141   6e-34   
gb|ABF70100.1|  protein kinase, putative                                141   6e-34   
ref|XP_009619428.1|  PREDICTED: probable LRR receptor-like serine...    141   6e-34   
ref|XP_010045980.1|  PREDICTED: probable LRR receptor-like serine...    140   7e-34   
ref|XP_010234084.1|  PREDICTED: probable LRR receptor-like serine...    140   7e-34   
ref|XP_010045761.1|  PREDICTED: probable LRR receptor-like serine...    140   7e-34   
gb|KCW84082.1|  hypothetical protein EUGRSUZ_B00963                     140   7e-34   
gb|KJB09256.1|  hypothetical protein B456_001G131900                    140   8e-34   
ref|XP_011082789.1|  PREDICTED: probable leucine-rich repeat rece...    140   8e-34   
ref|XP_010234085.1|  PREDICTED: probable LRR receptor-like serine...    140   8e-34   
emb|CBI20145.3|  unnamed protein product                                140   9e-34   
ref|XP_002283497.2|  PREDICTED: probable LRR receptor-like serine...    140   1e-33   
gb|EYU29543.1|  hypothetical protein MIMGU_mgv1a0269213mg               134   1e-33   
ref|XP_010234449.1|  PREDICTED: probable LRR receptor-like serine...    140   1e-33   
gb|EEE61685.1|  hypothetical protein OsJ_16158                          140   1e-33   
gb|EEE63023.1|  hypothetical protein OsJ_17831                          140   1e-33   
ref|XP_007133298.1|  hypothetical protein PHAVU_011G167800g             140   1e-33   
ref|XP_006594719.1|  PREDICTED: probable leucine-rich repeat rece...    140   1e-33   
ref|XP_009802915.1|  PREDICTED: probable LRR receptor-like serine...    140   1e-33   
ref|XP_009802917.1|  PREDICTED: probable LRR receptor-like serine...    140   1e-33   
ref|XP_009802916.1|  PREDICTED: probable LRR receptor-like serine...    140   1e-33   
gb|KCW67553.1|  hypothetical protein EUGRSUZ_F013051                    137   1e-33   
gb|KCW84079.1|  hypothetical protein EUGRSUZ_B00960                     137   2e-33   
ref|XP_008226376.1|  PREDICTED: probable leucine-rich repeat rece...    140   2e-33   
ref|XP_010096458.1|  putative LRR receptor-like serine/threonine-...    139   2e-33   
ref|XP_009406148.1|  PREDICTED: probable LRR receptor-like serine...    140   2e-33   
ref|NP_001055034.1|  Os05g0253200                                       135   2e-33   
ref|XP_006417782.1|  hypothetical protein EUTSA_v10006761mg             137   2e-33   
ref|XP_002283521.1|  PREDICTED: probable LRR receptor-like serine...    139   2e-33   
gb|ABF72026.1|  leucine-rich repeat-containing protein kinase fam...    139   2e-33   
emb|CBI20142.3|  unnamed protein product                                139   2e-33   
ref|XP_004243241.1|  PREDICTED: probable LRR receptor-like serine...    139   2e-33   
gb|EEC83073.1|  hypothetical protein OsI_28196                          139   2e-33   
ref|XP_004951372.1|  PREDICTED: probable LRR receptor-like serine...    139   2e-33   
emb|CDY68250.1|  BnaCnng58230D                                          139   2e-33   
ref|XP_004951371.1|  PREDICTED: probable LRR receptor-like serine...    139   2e-33   
ref|XP_009334012.1|  PREDICTED: probable leucine-rich repeat rece...    139   2e-33   
ref|XP_004491355.1|  PREDICTED: probable LRR receptor-like serine...    139   3e-33   
emb|CAN81226.1|  hypothetical protein VITISV_038168                     139   3e-33   
gb|EEC78867.1|  hypothetical protein OsI_19224                          139   3e-33   
gb|KHN36920.1|  Putative LRR receptor-like serine/threonine-prote...    139   3e-33   
gb|AAT85158.1|  hypothetical protein                                    139   3e-33   
gb|KCW71079.1|  hypothetical protein EUGRSUZ_F04178                     137   3e-33   
gb|KJB45813.1|  hypothetical protein B456_007G330300                    139   3e-33   
ref|XP_010065088.1|  PREDICTED: probable LRR receptor-like serine...    136   3e-33   



>ref|XP_009621779.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Nicotiana tomentosiformis]
Length=548

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            GQNY A + SQI +TLD ELYK+ARISP+SLRYYG GL  G Y+VELHFAEIQMDD   S
Sbjct  352  GQNYIAETGSQITSTLDSELYKSARISPNSLRYYGFGLSNGRYKVELHFAEIQMDD-SHS  410

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGE+VL DFN+++EAGGSKRA+VK F+ANVTN +++IHF WAGKGTC
Sbjct  411  WKGLGRRLFDVYIQGEKVLEDFNIQKEAGGSKRAIVKTFEANVTNRMMEIHFLWAGKGTC  470

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIHV Q V  +  S  S KKRVG I GI  GSAAG+LI+ S+FY+WW
Sbjct  471  CIPFQSTYGPLVSAIHVTQ-VATNGGSSKSKKKRVGIIFGIVAGSAAGILIVSSVFYLWW  529

Query  238  TKKKSPTYKGF*LDSTTK  185
              ++ PT+     DS TK
Sbjct  530  ANRRGPTHMKVATDSPTK  547



>ref|XP_009621778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Nicotiana tomentosiformis]
Length=649

 Score =   275 bits (704),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 156/198 (79%), Gaps = 2/198 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            GQNY A + SQI +TLD ELYK+ARISP+SLRYYG GL  G Y+VELHFAEIQMDD   S
Sbjct  453  GQNYIAETGSQITSTLDSELYKSARISPNSLRYYGFGLSNGRYKVELHFAEIQMDD-SHS  511

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGE+VL DFN+++EAGGSKRA+VK F+ANVTN +++IHF WAGKGTC
Sbjct  512  WKGLGRRLFDVYIQGEKVLEDFNIQKEAGGSKRAIVKTFEANVTNRMMEIHFLWAGKGTC  571

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIHV Q V  +  S  S KKRVG I GI  GSAAG+LI+ S+FY+WW
Sbjct  572  CIPFQSTYGPLVSAIHVTQ-VATNGGSSKSKKKRVGIIFGIVAGSAAGILIVSSVFYLWW  630

Query  238  TKKKSPTYKGF*LDSTTK  185
              ++ PT+     DS TK
Sbjct  631  ANRRGPTHMKVATDSPTK  648



>ref|XP_011081555.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Sesamum indicum]
Length=678

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 152/185 (82%), Gaps = 1/185 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  YTA + SQI  TLD ELYKTARISPSS+RYYG+GL+ G+YRVELHFAEIQM D   S
Sbjct  485  GPQYTAQTDSQITGTLDSELYKTARISPSSMRYYGLGLENGVYRVELHFAEIQMMDDPTS  544

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WK LGRR FDV IQG +V++DFN+  EAGGSKRAL+K F+ANVTN V+DIH  WAGKGTC
Sbjct  545  WKALGRRVFDVYIQGVKVVQDFNILNEAGGSKRALIKTFEANVTNTVMDIHLLWAGKGTC  604

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIHV Q     DSS  S+K+RVGKI+GI++G AAGVLIICS+FY+W 
Sbjct  605  CIPFQSTYGPLVSAIHVSQVTEFKDSSK-SNKRRVGKILGISIGCAAGVLIICSVFYLWQ  663

Query  238  TKKKS  224
            TKK++
Sbjct  664  TKKEA  668



>ref|XP_002309634.2| hypothetical protein POPTR_0006s27120g [Populus trichocarpa]
 gb|EEE93157.2| hypothetical protein POPTR_0006s27120g [Populus trichocarpa]
Length=523

 Score =   269 bits (687),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TLD ELYKTARISPSSLRYYG+GLK GIY VELHFAEI M D   S
Sbjct  328  GPQYIAQTGSQITGTLDSELYKTARISPSSLRYYGLGLKNGIYSVELHFAEIGMVD-SHS  386

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERVL+DFN+K+ AGGSK+AL+K  +ANVTN ++DIHFFWAGKGTC
Sbjct  387  WKGLGRRIFDVYIQGERVLKDFNIKEAAGGSKKALIKTLEANVTNTIMDIHFFWAGKGTC  446

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIHV +  +   SS G DKKR+GK+IGI++   AG++II S+FY+WW
Sbjct  447  CIPYQSTYGPLVSAIHVSRASDAAGSSKG-DKKRIGKLIGISVACVAGLVIISSVFYLWW  505

Query  238  TKKKSPTYKGF*LDSTTK  185
             K+ SP +K    DS  K
Sbjct  506  IKEDSPKHKRIYTDSPRK  523



>ref|XP_009759495.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Nicotiana sylvestris]
Length=548

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            GQNY A + SQI +TLD ELYKTAR+SP+SLRYYG GL  G Y+VELHFAEIQMDD   S
Sbjct  352  GQNYIAETGSQITSTLDSELYKTARMSPNSLRYYGFGLSDGKYKVELHFAEIQMDD-SHS  410

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGE+VL D N+++EAGGSKRALVK F+ANVTN V++IHF WAGKGTC
Sbjct  411  WKGLGRRLFDVYIQGEKVLEDLNIQKEAGGSKRALVKTFEANVTNRVMEIHFLWAGKGTC  470

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIHV Q      SS  + KKRVG I GI  GSAAGVLI+ S+FY+ W
Sbjct  471  CIPFQSTYGPLVSAIHVTQVEKYGGSSK-NKKKRVGIIFGIVAGSAAGVLIVSSVFYLCW  529

Query  238  TKKKSPTYKGF*LDSTTK  185
              +K P +     DS TK
Sbjct  530  ANRKGPIHMKVATDSPTK  547



>gb|KDO61746.1| hypothetical protein CISIN_1g006206mg [Citrus sinensis]
Length=579

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 149/185 (81%), Gaps = 2/185 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TLD ELYKTARISPSSLRYYG+GL+ G YR++LHFAEI M+D   S
Sbjct  381  GPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMED-SLS  439

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERVLRD N+K+EAGGSKRALVK F+ANVTN +++IHFFWAGKGTC
Sbjct  440  WKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTC  499

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP Q T+GP+VSAIH  Q    + SS G DKK VGKI+GIT+G AA ++II S+FY+WW
Sbjct  500  CIPFQGTYGPLVSAIHASQVSTGNGSSKG-DKKHVGKIVGITVGCAAALVIISSVFYLWW  558

Query  238  TKKKS  224
            TK  S
Sbjct  559  TKDSS  563



>ref|XP_006450419.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
 ref|XP_006450420.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
 gb|ESR63659.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
 gb|ESR63660.1| hypothetical protein CICLE_v10007687mg [Citrus clementina]
Length=657

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TLD ELYKTARISPSSLRYYG+GLK G YR++LHFAEI M+D   S
Sbjct  459  GPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLKNGKYRIDLHFAEITMED-SLS  517

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERVLRD N+K+EAGGSKRALVK F+ANVTN +++IHFFWAGKGTC
Sbjct  518  WKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTC  577

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP Q T+GP+VSAIH  Q    + SS G DKK VGKI+GIT+G AA ++II S+FY+WW
Sbjct  578  CIPFQGTYGPLVSAIHASQVSTGNGSSKG-DKKHVGKIVGITVGCAAALVIISSVFYLWW  636

Query  238  TKKKSPTYKGF  206
            TK  S   + F
Sbjct  637  TKDSSSHIRIF  647



>ref|XP_009759487.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Nicotiana sylvestris]
Length=649

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            GQNY A + SQI +TLD ELYKTAR+SP+SLRYYG GL  G Y+VELHFAEIQMDD   S
Sbjct  453  GQNYIAETGSQITSTLDSELYKTARMSPNSLRYYGFGLSDGKYKVELHFAEIQMDD-SHS  511

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGE+VL D N+++EAGGSKRALVK F+ANVTN V++IHF WAGKGTC
Sbjct  512  WKGLGRRLFDVYIQGEKVLEDLNIQKEAGGSKRALVKTFEANVTNRVMEIHFLWAGKGTC  571

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIHV Q      SS  + KKRVG I GI  GSAAGVLI+ S+FY+ W
Sbjct  572  CIPFQSTYGPLVSAIHVTQVEKYGGSSK-NKKKRVGIIFGIVAGSAAGVLIVSSVFYLCW  630

Query  238  TKKKSPTYKGF*LDSTTK  185
              +K P +     DS TK
Sbjct  631  ANRKGPIHMKVATDSPTK  648



>ref|XP_006483373.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Citrus sinensis]
 gb|KDO61745.1| hypothetical protein CISIN_1g006206mg [Citrus sinensis]
Length=657

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TLD ELYKTARISPSSLRYYG+GL+ G YR++LHFAEI M+D   S
Sbjct  459  GPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMED-SLS  517

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERVLRD N+K+EAGGSKRALVK F+ANVTN +++IHFFWAGKGTC
Sbjct  518  WKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTC  577

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP Q T+GP+VSAIH  Q    + SS G DKK VGKI+GIT+G AA ++II S+FY+WW
Sbjct  578  CIPFQGTYGPLVSAIHASQVSTGNGSSKG-DKKHVGKIVGITVGCAAALVIISSVFYLWW  636

Query  238  TKKKSPTYKGF  206
            TK  S   + F
Sbjct  637  TKDSSSHIRIF  647



>gb|KDO61744.1| hypothetical protein CISIN_1g006206mg [Citrus sinensis]
Length=642

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 149/185 (81%), Gaps = 2/185 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TLD ELYKTARISPSSLRYYG+GL+ G YR++LHFAEI M+D   S
Sbjct  444  GPLYIAQTDSQITGTLDSELYKTARISPSSLRYYGLGLENGKYRIDLHFAEITMED-SLS  502

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERVLRD N+K+EAGGSKRALVK F+ANVTN +++IHFFWAGKGTC
Sbjct  503  WKGLGRRVFDVYIQGERVLRDLNIKKEAGGSKRALVKTFEANVTNTIIEIHFFWAGKGTC  562

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP Q T+GP+VSAIH  Q    + SS G DKK VGKI+GIT+G AA ++II S+FY+WW
Sbjct  563  CIPFQGTYGPLVSAIHASQVSTGNGSSKG-DKKHVGKIVGITVGCAAALVIISSVFYLWW  621

Query  238  TKKKS  224
            TK  S
Sbjct  622  TKDSS  626



>ref|XP_011039729.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Populus euphratica]
Length=902

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TLD ELYKTARISPSSLRYYG+GLK GIY VELHFAEI M D   S
Sbjct  701  GPQYIAETGSQITGTLDSELYKTARISPSSLRYYGLGLKNGIYSVELHFAEIGMVD-SHS  759

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WK LGRR FD+ IQGERVL+DFN+K+ AGGSK+AL+K F+ NVTN ++DIHFFWAGKGTC
Sbjct  760  WKALGRRIFDIYIQGERVLKDFNIKEAAGGSKKALIKTFETNVTNTIMDIHFFWAGKGTC  819

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIHV +  +   SS   DKKR+GK+IGI++   AG++II S+FY+WW
Sbjct  820  CIPYQSTYGPLVSAIHVSRASDAAGSSK-RDKKRIGKLIGISVACVAGIVIISSVFYLWW  878

Query  238  TKKKSPTYKGF*LDSTTK  185
             K+ SP +K    DS  K
Sbjct  879  IKEDSPKHKRIYTDSPRK  896



>ref|XP_002324865.1| hypothetical protein POPTR_0018s01800g [Populus trichocarpa]
 gb|EEF03430.1| hypothetical protein POPTR_0018s01800g [Populus trichocarpa]
Length=608

 Score =   258 bits (659),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 147/188 (78%), Gaps = 2/188 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y   + SQI  TLD ELYKTARISPSSLRYYG+GLK G Y VELHFAEI MDD   S
Sbjct  399  GPQYLTQTGSQITGTLDSELYKTARISPSSLRYYGLGLKNGRYSVELHFAEIGMDD-SHS  457

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FD+ IQGE VL+DFN+K EAGGSK+AL+K F+ANVTN ++DIHFFWAGKGTC
Sbjct  458  WKGLGRRLFDIYIQGEIVLKDFNIKNEAGGSKKALIKTFEANVTNTIMDIHFFWAGKGTC  517

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP Q T+GP+VSAIHV Q V+    S   DKKRVGK++GI++   AG++II S+FY+WW
Sbjct  518  CIPYQGTYGPLVSAIHVSQ-VSDGAGSSKRDKKRVGKLVGISMACVAGLVIISSVFYLWW  576

Query  238  TKKKSPTY  215
             K+ S  +
Sbjct  577  IKEDSSQH  584



>ref|XP_002515504.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46953.1| ATP binding protein, putative [Ricinus communis]
Length=895

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y   + SQI  TL+ ELYKTARIS SSLRYYG+GLK G Y +ELHFAEI MDD+  SWKG
Sbjct  702  YIKQTDSQIAETLESELYKTARISASSLRYYGLGLKNGRYSIELHFAEIGMDDVSQSWKG  761

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
            LGRR FDV IQG RVL+DFN++ EAGGSKRALVK F+ANVTN+++DIHFFWAGKGTCCIP
Sbjct  762  LGRRIFDVYIQGGRVLQDFNLQNEAGGSKRALVKTFEANVTNSIMDIHFFWAGKGTCCIP  821

Query  409  VQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWTKK  230
             QST+GP+VSAIHV Q  +  DSS+  DKK VGK++GI +G A G++II S+FY+WWTK 
Sbjct  822  QQSTYGPLVSAIHVSQVSDSTDSSN-RDKKHVGKLVGIAVGCATGLVIISSVFYIWWTKD  880

Query  229  KS  224
             +
Sbjct  881  ST  882



>gb|EYU20256.1| hypothetical protein MIMGU_mgv1a002601mg [Erythranthe guttata]
Length=655

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 145/185 (78%), Gaps = 1/185 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKD  602
            G  Y A + SQI NTLD ELYKTAR+SP+SLRYYG+GL+ G+YR+ELHFAEIQMDD    
Sbjct  457  GPRYIAQTDSQITNTLDSELYKTARVSPNSLRYYGLGLENGVYRIELHFAEIQMDDDSTP  516

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGT  422
            SWKGL RR FDV IQGERV+ DFN+  EAGGSK+AL+K F+ANVTN V+DIH FWAGKGT
Sbjct  517  SWKGLARRLFDVYIQGERVIEDFNILNEAGGSKKALIKTFEANVTNTVIDIHLFWAGKGT  576

Query  421  CCIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            CCIP+QST+GP+VSAIHV Q      SS  SD+KRVG+I GI +G  A  ++I S+ Y+W
Sbjct  577  CCIPLQSTYGPLVSAIHVSQVSEFKVSSSESDRKRVGRIAGIVIGCVAVFVVIGSVVYLW  636

Query  241  WTKKK  227
              KK+
Sbjct  637  RAKKE  641



>ref|XP_011036739.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Populus euphratica]
Length=700

 Score =   258 bits (659),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 147/188 (78%), Gaps = 2/188 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y   + SQI  TLD ELYKTARISPSSLRYYG+GLK G Y VELHFAEI MDD   S
Sbjct  504  GPQYLTQTGSQITGTLDSELYKTARISPSSLRYYGLGLKNGRYSVELHFAEIGMDD-SHS  562

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FD+ IQGE VL+DFN+K EAGGSK+AL+K F+ANVTN ++DIHFFWAGKGTC
Sbjct  563  WKGLGRRLFDIYIQGEIVLKDFNIKNEAGGSKKALIKTFEANVTNTIMDIHFFWAGKGTC  622

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP Q T+GP+VSAIHV Q V+    S   DKKRVGK++GI++   AG++II S+FY+WW
Sbjct  623  CIPYQGTYGPLVSAIHVSQ-VSDGAGSSKRDKKRVGKLVGISMACVAGLVIISSVFYLWW  681

Query  238  TKKKSPTY  215
             K+ S  +
Sbjct  682  IKEDSSQH  689



>ref|XP_010090613.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB40149.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=565

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 149/198 (75%), Gaps = 2/198 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  + A + SQI  TLD ELYKTAR+SPSSLRY+G  +  G Y VELHFAEI MDD   S
Sbjct  370  GPQFIAKTDSQITKTLDSELYKTARVSPSSLRYFGYDMMNGKYAVELHFAEIAMDDT-GS  428

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WK LGRR FDV IQGE+VL+DF++K+EAGGSKRALVK F+ANVTN +++IHFFWAGKGTC
Sbjct  429  WKALGRRLFDVYIQGEKVLKDFDIKKEAGGSKRALVKTFEANVTNKIMEIHFFWAGKGTC  488

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP Q T+GP+VSA+HV Q   +  SS   +KKR+G+++GITLG AAG  I+ S+ Y+WW
Sbjct  489  CIPFQGTYGPLVSAVHVYQATGVGSSSK-ENKKRIGRLVGITLGCAAGFGIVLSMLYLWW  547

Query  238  TKKKSPTYKGF*LDSTTK  185
            TK+ S  +     DS  K
Sbjct  548  TKRASSAHMPVQTDSPKK  565



>emb|CBI21051.3| unnamed protein product [Vitis vinifera]
Length=649

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 147/185 (79%), Gaps = 1/185 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TL+ ELYKTAR+SPSSLRYYG+GLK G YRVELHFAEI M+D   S
Sbjct  454  GPQYIAKTDSQIRGTLESELYKTARVSPSSLRYYGLGLKNGKYRVELHFAEIAMED-SVS  512

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERVL  FN+++EAGGSKRALVK  +ANVTN +++IHF WAG+GTC
Sbjct  513  WKGLGRRLFDVYIQGERVLEGFNIQREAGGSKRALVKTLEANVTNTIMEIHFLWAGRGTC  572

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIH  Q  +   SS  S+KKR+GK++GI +G A GV+II SIFY+WW
Sbjct  573  CIPFQSTYGPLVSAIHAYQVSDETSSSSESNKKRIGKVVGIVVGCAGGVVIISSIFYLWW  632

Query  238  TKKKS  224
             K+ S
Sbjct  633  KKEAS  637



>gb|KDP33585.1| hypothetical protein JCGZ_07156 [Jatropha curcas]
Length=650

 Score =   251 bits (642),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A + SQI  TL+ ELYKTARIS SSLRYYG+GLK G Y VELHFAEI MDDI  SWKG
Sbjct  457  YIAQTDSQITVTLESELYKTARISASSLRYYGLGLKNGRYNVELHFAEIVMDDISQSWKG  516

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
            LGRR FDV IQG++VL+DFN+++EAGGSKRALV+ F+ANVTN V+ IHFFWAGKGTCCIP
Sbjct  517  LGRRIFDVYIQGKKVLQDFNIQKEAGGSKRALVRTFEANVTNTVMVIHFFWAGKGTCCIP  576

Query  409  VQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAG-VLIICSIFYVW  242
            +QST+GP+VSAIHV Q  +  DSS   DKK VGK++GI +G AA  V+IICS+ Y+W
Sbjct  577  LQSTYGPLVSAIHVSQVSDGTDSSK-RDKKHVGKVVGIAVGCAAALVIIICSVVYLW  632



>ref|XP_010648817.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Vitis vinifera]
Length=812

 Score =   254 bits (649),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 147/185 (79%), Gaps = 1/185 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TL+ ELYKTAR+SPSSLRYYG+GLK G YRVELHFAEI M+D   S
Sbjct  617  GPQYIAKTDSQIRGTLESELYKTARVSPSSLRYYGLGLKNGKYRVELHFAEIAMED-SVS  675

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERVL  FN+++EAGGSKRALVK  +ANVTN +++IHF WAG+GTC
Sbjct  676  WKGLGRRLFDVYIQGERVLEGFNIQREAGGSKRALVKTLEANVTNTIMEIHFLWAGRGTC  735

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIH  Q  +   SS  S+KKR+GK++GI +G A GV+II SIFY+WW
Sbjct  736  CIPFQSTYGPLVSAIHAYQVSDETSSSSESNKKRIGKVVGIVVGCAGGVVIISSIFYLWW  795

Query  238  TKKKS  224
             K+ S
Sbjct  796  KKEAS  800



>gb|KJB07626.1| hypothetical protein B456_001G034000 [Gossypium raimondii]
Length=650

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 146/186 (78%), Gaps = 5/186 (3%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TL+ ELYKT+RISPSSLRYYG+ LK G Y VELHFAEI+M+D   S
Sbjct  454  GNRYVAMTDSQITETLESELYKTSRISPSSLRYYGLNLKNGKYSVELHFAEIEMED-SSS  512

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W GLGRR FDV IQGE+VL DFN+++EAGGSK+ALVK F+ANVTN +++IHFFWAGKGTC
Sbjct  513  WNGLGRRLFDVYIQGEKVLEDFNIQKEAGGSKKALVKTFEANVTNAIMEIHFFWAGKGTC  572

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIH  Q     D+S  S +K VG+I GI +G+ AGV+I+ S+FY+WW
Sbjct  573  CIPYQSTYGPLVSAIHASQVSEAADAS--SSRKHVGRIAGIVIGAVAGVVILSSVFYLWW  630

Query  238  TKKKSP  221
              KK P
Sbjct  631  --KKDP  634



>ref|XP_008219685.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Prunus mume]
Length=664

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TL+ ELYKTAR+SPSSLRY+G+ L  G Y VELHFAEI M+D   S
Sbjct  468  GPQYIASTDSQITETLESELYKTARLSPSSLRYFGLDLMNGKYIVELHFAEITMEDDTSS  527

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERVL+DFN+++EAGGSKRAL+K F+ NV+N +++IHF WAGKGTC
Sbjct  528  WKGLGRRIFDVYIQGERVLQDFNIQKEAGGSKRALIKTFETNVSNTIMNIHFMWAGKGTC  587

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP+Q T+GP+VSAI+V Q     +S++   +KRVG+I+GI+LG AA V+I+ S FY+WW
Sbjct  588  CIPLQGTYGPLVSAINVRQVPGAGNSAN-RGRKRVGRIVGISLGCAAAVVIVSSAFYLWW  646

Query  238  TKKKSPTY  215
             K  +P +
Sbjct  647  IKDDAPGH  654



>ref|XP_010040282.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=655

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQM-DDIKD  602
            G  Y   + SQI  TL+ ELYKTAR+S SSLRYYG+GLK G Y VELHFAEI+M DD   
Sbjct  455  GPQYIVKTDSQITGTLESELYKTARVSASSLRYYGLGLKNGKYSVELHFAEIKMEDDDSG  514

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGT  422
            SWKGLGRR FDV IQGERVL+DF+++++AGGS +ALVK F ANVTN VLDIHF WAGKGT
Sbjct  515  SWKGLGRRVFDVYIQGERVLQDFDIRKQAGGSNKALVKTFDANVTNTVLDIHFRWAGKGT  574

Query  421  CCIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            CCIP QST+GP+VSAI   Q   +  +S   +KKRVGKI+GI  G AAG++I+ S FY+W
Sbjct  575  CCIPSQSTYGPLVSAISASQVSGVGGTSSDDNKKRVGKIVGIAFGCAAGLVIVSSAFYLW  634

Query  241  WTKKKSPT  218
            W  +++PT
Sbjct  635  WA-REAPT  641



>ref|XP_007224199.1| hypothetical protein PRUPE_ppa017326mg [Prunus persica]
 gb|EMJ25398.1| hypothetical protein PRUPE_ppa017326mg [Prunus persica]
Length=653

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TL+ ELYKTAR+SPSSLRY+G+ L  G Y V+LHFAEI M+D   S
Sbjct  457  GPRYIASTDSQITETLESELYKTARLSPSSLRYFGLDLMNGKYIVQLHFAEIAMEDDTSS  516

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERVL+DFN+++EAGGSKRAL+K F+ NV+N V++IHF WAGKGTC
Sbjct  517  WKGLGRRIFDVYIQGERVLQDFNIQKEAGGSKRALIKTFETNVSNTVMNIHFMWAGKGTC  576

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP+Q T+GP+VSAI+V Q     +S++   +K+VG+I+GI+LG AA V+I+ S+FY+WW
Sbjct  577  CIPLQGTYGPLVSAINVRQVPGAGNSAN-RGRKQVGRIVGISLGCAAAVMIVSSVFYLWW  635

Query  238  TKKKSPTY  215
             K  +P +
Sbjct  636  IKDDAPGH  643



>ref|XP_007011844.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY29463.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=879

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 3/182 (2%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TL+ ELY+TAR+SPSSLRYYG+GLK G Y V+LHFAEI MDD   S
Sbjct  683  GNIYIAKTDSQITGTLESELYQTARVSPSSLRYYGLGLKNGKYIVKLHFAEIAMDD-SLS  741

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGE+VL+DFN++ EAGGSK+AL++ F+ANVTN +++IHFFWAGKGTC
Sbjct  742  WKGLGRRLFDVYIQGEKVLQDFNIQHEAGGSKKALIRTFEANVTNTIMEIHFFWAGKGTC  801

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP QST+GP+VSAIH  Q    + ++  S++KRVG I GI +G AAG++I+ SIFY+WW
Sbjct  802  CIPYQSTYGPLVSAIHASQVS--EGAAATSNRKRVGLIAGIVIGGAAGIVIVSSIFYLWW  859

Query  238  TK  233
             K
Sbjct  860  KK  861



>ref|XP_011459850.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Fragaria vesca subsp. vesca]
Length=930

 Score =   240 bits (613),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 148/182 (81%), Gaps = 2/182 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G  Y A + SQI  TL+ ELYKTARISP+SLRYYG+ LK G Y VELHFAE+QM+D   S
Sbjct  734  GPQYIASTDSQIKGTLESELYKTARISPTSLRYYGLDLKNGKYVVELHFAELQMEDTA-S  792

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WKGLGRR FDV IQGERV++D N+++EAGGSK+AL+KKF+ NV+N ++DIHF WAGKGTC
Sbjct  793  WKGLGRRLFDVYIQGERVVQDLNIQKEAGGSKKALIKKFETNVSNTIMDIHFLWAGKGTC  852

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            CIP Q T+GP+VSAIHV Q V+  +SS  S++KRVG I+G++LG AA ++I+ S+FY+WW
Sbjct  853  CIPYQGTYGPLVSAIHVHQ-VSGAESSSSSERKRVGTIVGVSLGCAAVMIIMSSVFYLWW  911

Query  238  TK  233
             K
Sbjct  912  IK  913



>gb|KCW81385.1| hypothetical protein EUGRSUZ_C02767 [Eucalyptus grandis]
Length=627

 Score =   232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQM-DDIKD  602
            G  Y   + SQI  TL+ ELYKTAR+S SSLRYYG+GLK G Y VELHFAEI+M DD   
Sbjct  455  GPQYIVKTDSQITGTLESELYKTARVSASSLRYYGLGLKNGKYSVELHFAEIKMEDDDSR  514

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGT  422
            SWKGLGRR FDV IQGERVL+DF+++++AGGS RALV+ F ANVTN VLDIHF WAGKGT
Sbjct  515  SWKGLGRRVFDVYIQGERVLQDFDIQKQAGGSNRALVRTFDANVTNTVLDIHFRWAGKGT  574

Query  421  CCIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLII  263
            CCIP QST+GP+VSAI       +D +S   +KKRVGKI+GI  G AAG++I+
Sbjct  575  CCIPSQSTYGPLVSAISASPVSGVDGTSSDDNKKRVGKIVGIAFGCAAGLVIV  627



>ref|XP_009420716.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X1 [Musa acuminata subsp. malaccensis]
Length=219

 Score =   187 bits (476),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 125/184 (68%), Gaps = 8/184 (4%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G N+  ++   +P     +LY+TARIS  SLRYY VGL+ G Y+VEL FAEI MDD   S
Sbjct  26   GSNFIVNTDEPMP-----KLYQTARISTRSLRYYVVGLQNGTYKVELLFAEIVMDDTP-S  79

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W GLGRR F++ IQ + V +DFN+  EA GSK+   K +K  V NN+LDIH  W+G+GTC
Sbjct  80   WTGLGRRIFNIYIQNQLVEQDFNIIAEAKGSKKPYNKTYKITVANNILDIHLLWSGRGTC  139

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDS--SDGSDKKRVGKIIGITLGSAAGVLIICSIFYV  245
            CIP + T+GP+VSAI+V +E +   S  S  ++++R G I+GI  G AA V+I+ SI Y+
Sbjct  140  CIPAEGTYGPLVSAINVTREDHFTPSPTSSSNNERRAGIIVGIAAGCAAAVIILSSIVYL  199

Query  244  WWTK  233
            WW +
Sbjct  200  WWKR  203



>ref|XP_009420717.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X2 [Musa acuminata subsp. malaccensis]
Length=217

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 125/184 (68%), Gaps = 8/184 (4%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G N+  ++   +P     +LY+TARIS  SLRYY VGL+ G Y+VEL FAEI MDD   S
Sbjct  26   GSNFIVNTDEPMP-----KLYQTARISTRSLRYYVVGLQNGTYKVELLFAEIVMDDTP-S  79

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W GLGRR F++ IQ + V +DFN+  EA GSK+   K +K  V NN+LDIH  W+G+GTC
Sbjct  80   WTGLGRRIFNIYIQNQLVEQDFNIIAEAKGSKKPYNKTYKITVANNILDIHLLWSGRGTC  139

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDS--SDGSDKKRVGKIIGITLGSAAGVLIICSIFYV  245
            CIP + T+GP+VSAI+V +E +   S  S  ++++R G I+GI  G AA V+I+ SI Y+
Sbjct  140  CIPAEGTYGPLVSAINVTREDHFTPSPTSSSNNERRAGIIVGIAAGCAAAVIILSSIVYL  199

Query  244  WWTK  233
            WW +
Sbjct  200  WWKR  203



>gb|KGN44274.1| hypothetical protein Csa_7G237890 [Cucumis sativus]
Length=1035

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            NYTA + SQ  NTL+ EL++T RIS SSLRYYG+GL+ G Y V LHFAEI   +  ++W+
Sbjct  482  NYTASTMSQFSNTLESELFQTQRISASSLRYYGLGLENGNYTVNLHFAEIAFPN-SNTWQ  540

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LGRR FD+ IQG RVL++F++++EAGGS  AL + F A VT N L+IH FWAGKGTCCI
Sbjct  541  SLGRRLFDIYIQGNRVLQNFDIRKEAGGSFLALTRNFTAEVTENFLEIHLFWAGKGTCCI  600

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFYVW  242
            P Q  FGP VSAI         + +    +   R G I+G+ +G  +   LI+ ++F+V 
Sbjct  601  PRQGDFGPAVSAISATPNFVPTVSNVPPTTKVTRTGLIVGLVVGLGSVFFLIVGAVFFVV  660

Query  241  WTKKKSPTYK  212
              +K+   Y+
Sbjct  661  QRRKRRRAYE  670



>ref|XP_004139892.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Cucumis sativus]
 ref|XP_004159184.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Cucumis sativus]
Length=1122

 Score =   185 bits (470),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            NYTA + SQ  NTL+ EL++T RIS SSLRYYG+GL+ G Y V LHFAEI   +  ++W+
Sbjct  569  NYTASTMSQFSNTLESELFQTQRISASSLRYYGLGLENGNYTVNLHFAEIAFPN-SNTWQ  627

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LGRR FD+ IQG RVL++F++++EAGGS  AL + F A VT N L+IH FWAGKGTCCI
Sbjct  628  SLGRRLFDIYIQGNRVLQNFDIRKEAGGSFLALTRNFTAEVTENFLEIHLFWAGKGTCCI  687

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFYVW  242
            P Q  FGP VSAI         + +    +   R G I+G+ +G  +   LI+ ++F+V 
Sbjct  688  PRQGDFGPAVSAISATPNFVPTVSNVPPTTKVTRTGLIVGLVVGLGSVFFLIVGAVFFVV  747

Query  241  WTKKKSPTYK  212
              +K+   Y+
Sbjct  748  QRRKRRRAYE  757



>ref|XP_008447120.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Cucumis melo]
Length=1034

 Score =   184 bits (467),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 129/189 (68%), Gaps = 4/189 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+++ +Q PNT+D ELY+T R+S SSLRYYG+GL+ G Y V LHFAEI   D  ++W+ 
Sbjct  482  YTSNTPAQFPNTIDTELYQTQRLSASSLRYYGLGLENGNYTVNLHFAEIAFPD-SNTWQS  540

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
             GRR FD+ IQG RVL++F++++EAGGS  A+ + F A VT N L+IH FWAGKGTCCIP
Sbjct  541  RGRRLFDIYIQGNRVLQNFDIRKEAGGSFLAVRRNFTAEVTENFLEIHLFWAGKGTCCIP  600

Query  409  VQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGV-LIICSIFYVWW  239
             Q  FGP VSAI    +    + ++   + + R G I+G+ +G  + + LI+ ++F+V  
Sbjct  601  DQGDFGPAVSAISATPDFVPTVRNTPPSTKETRTGLIVGLVVGLGSVLFLIVGAVFFVVQ  660

Query  238  TKKKSPTYK  212
             +K+   Y+
Sbjct  661  RRKRRRAYE  669



>gb|KCW71214.1| hypothetical protein EUGRSUZ_F043061, partial [Eucalyptus grandis]
Length=257

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 126/196 (64%), Gaps = 18/196 (9%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y+A S SQ  NTLD EL+ TAR+S SSLRYYG+GL+ G Y V L FAEIQ+ D +  WK 
Sbjct  56   YSAPSLSQFTNTLDTELFHTARVSASSLRYYGLGLENGNYNVTLQFAEIQIQDTE--WKR  113

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  V +DF++++EAGG+   A++K ++A VT N L+IHFFWAGKGTCC+
Sbjct  114  LGRRLFDIYIQGNLVAKDFDIRKEAGGASFTAVLKLYQAQVTANYLEIHFFWAGKGTCCV  173

Query  412  PVQSTFGPIVSAIHVVQEV---------NLD-----DSSDGSDKKRVGKIIGITLGSAAG  275
            P Q+T+GP++SAI  V +           LD     D+S    K R G I+G+  G    
Sbjct  174  PKQATYGPLISAISAVPDFVPTVSNNPPTLDNPPTLDNSPSRKKDRSGLIVGVATGVGVV  233

Query  274  VLI-ICSIFYVWWTKK  230
              + +  + YV W ++
Sbjct  234  GFMAVLPVLYVVWRRR  249



>ref|XP_009128532.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Brassica rapa]
Length=727

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NT D EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQM+   +SWKG
Sbjct  186  YIASSLSQFTNTSDSELFQTARLSASSLRYYGLGLENGGYTVTLQFAEIQME-ASNSWKG  244

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGS-KRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  V +DF+V + AGGS  RA+ K +KANVT N +++H FWAGKGTCCI
Sbjct  245  LGRRRFDIYVQGRLVEKDFDVLRTAGGSTNRAVHKVYKANVTENYIEVHLFWAGKGTCCI  304

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P+Q  +GPI+SA+    +    +D+      K + G I+G+ +G   G+L I +   ++ 
Sbjct  305  PIQGAYGPIISAVSAAPDFRPTVDNKPPSKGKNKTGIIVGVIVG--LGLLSILAGLGIFI  362

Query  238  TKKKSPTY  215
             +K+   Y
Sbjct  363  IRKRRKPY  370



>gb|KDP25093.1| hypothetical protein JCGZ_22628 [Jatropha curcas]
Length=1035

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 127/189 (67%), Gaps = 5/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YTA S SQ  NTLD EL++TARIS SSLRYYG+GL+ G Y ++L FAEI ++D  ++WK 
Sbjct  480  YTASSSSQSTNTLDPELFQTARISASSLRYYGLGLENGNYTIKLQFAEIVIED-GNTWKS  538

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FDV +QG RVL+DF++++EAGG SKRA+ + +KA V+ N LDIH FWAGKGTCCI
Sbjct  539  LGRRVFDVYVQGNRVLKDFDIRKEAGGVSKRAVERSYKAQVSENYLDIHLFWAGKGTCCI  598

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVG-KIIGITLGSAAGVLIICSIFYVW  242
            P   T+GP +SAI    +    + +    S K R G  +  +     A  L++  +F+V 
Sbjct  599  PSPGTYGPSISAIIATPDFIPTVSNKPPTSKKDRTGLIVGIVVGIGVASFLLVSLVFFVI  658

Query  241  WTKKKSPTY  215
              +K+  TY
Sbjct  659  QRRKRQSTY  667



>ref|XP_009127785.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Brassica rapa]
Length=1014

 Score =   178 bits (452),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NT D EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQM+   +SWKG
Sbjct  473  YIASSLSQFTNTSDSELFQTARLSASSLRYYGLGLENGGYTVTLQFAEIQME-ASNSWKG  531

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGS-KRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  V +DF+V + AGGS  RA+ K +KANVT N +++H FWAGKGTCCI
Sbjct  532  LGRRRFDIYVQGRLVEKDFDVLRTAGGSTNRAVHKVYKANVTENYIEVHLFWAGKGTCCI  591

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P+Q  +GPI+SA+    +    +D+      K + G I+G+ +G   G+L I +   ++ 
Sbjct  592  PIQGAYGPIISAVSAAPDFRPTVDNKPPSKGKNKTGIIVGVIVG--LGLLSILAGLGIFI  649

Query  238  TKKKSPTY  215
             +K+   Y
Sbjct  650  IRKRRKPY  657



>emb|CDY43003.1| BnaC02g19770D [Brassica napus]
Length=2098

 Score =   179 bits (455),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NT D EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQM+   +SWKG
Sbjct  478  YIASSLSQFTNTSDSELFQTARLSASSLRYYGLGLENGGYTVTLQFAEIQMEG-SNSWKG  536

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGS-KRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG  V +DF+V++ AGGS  RA+ +++KANVT N L++H FWAGKGTCCI
Sbjct  537  VGRRRFDIYVQGRLVEKDFDVRRTAGGSTNRAVHREYKANVTENYLEVHLFWAGKGTCCI  596

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P+Q  +GPI+SA+    +    +D+      K + G I+G+ +G   G+L I     V+ 
Sbjct  597  PIQGAYGPIISAVSATPDFRPTVDNKPPSKGKNKTGIIVGVIVG--LGLLSILVGVVVFI  654

Query  238  TKKKSPTY  215
             +K+   Y
Sbjct  655  IRKRRKPY  662


 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 116/172 (67%), Gaps = 5/172 (3%)
 Frame = -2

Query  769   YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
             Y     SQ  NT D EL++TAR+SPSS+RYYG+ L+ G+Y V L FAEIQM    +SW G
Sbjct  1526  YIETLLSQFTNTSDSELFQTARLSPSSIRYYGLELENGVYNVTLQFAEIQMTS-SNSWTG  1584

Query  589   LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LGRR FD+ +QG  V +DF+V++ AGG + RA+ +++KANVT N +++H FWAGKGTCCI
Sbjct  1585  LGRRRFDIYVQGRLVEKDFDVRRTAGGFTDRAVRREYKANVTENYIEVHLFWAGKGTCCI  1644

Query  412   PVQSTFGPIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITLGS-AAGVLI  266
             P Q T+GPI+ A+    +      +    K+  R G I+G+ L S  AGV+I
Sbjct  1645  PDQGTYGPIILAVSAAADFTPTVGNKPPSKRNNRTGVIVGVGLFSFLAGVVI  1696



>gb|KHM98861.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=630

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 121/180 (67%), Gaps = 5/180 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y +   +Q   T++ EL++TAR+S SSLRYYG+GL+ G Y + L FAE  + D   +W+ 
Sbjct  79   YKSFVPNQFAGTVNPELFQTARLSASSLRYYGLGLENGFYNITLQFAETAILDSNRTWES  138

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG RVL+DF++++EAGG S RA+ ++F+  VT N L+IH FWAGKGTCCI
Sbjct  139  LGRRVFDIYIQGTRVLKDFDIQKEAGGISYRAIQRQFRFEVTENYLEIHLFWAGKGTCCI  198

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP++ AIH + +    + +    S    +G I+GI  G   GV+ + SIF +++
Sbjct  199  PTQGTYGPLIQAIHAIPDFIPTVSNKPPSSSNNNIGLILGIVFG--VGVVSVLSIFAIFY  256



>gb|KHG01148.1| hypothetical protein F383_22594 [Gossypium arboreum]
Length=1039

 Score =   177 bits (450),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 92/190 (48%), Positives = 121/190 (64%), Gaps = 11/190 (6%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-S  599
            Q Y  ++ +Q+  T   ELY+T+R+SP SLRYYG+GLK G+Y V L FAE    D    S
Sbjct  479  QLYVQNTLAQVTRTTTPELYQTSRLSPGSLRYYGLGLKNGLYTVNLFFAETAFSDQSTRS  538

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W+ LGRR FDV IQG R LRDF + +EAGG +RA+VK F ANVT+N L+IH FWAGKGTC
Sbjct  539  WRSLGRRIFDVYIQGTRQLRDFEISKEAGGVERAIVKNFTANVTDNHLEIHLFWAGKGTC  598

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDG------SDKKRVGKIIGITLGSAAGVLIICS  257
            C P Q  +GP +SAI+VV   N   +  G        K + G I+GIT+      LI+  
Sbjct  599  CTPEQGYYGPSISAINVVP--NFIPTVSGIPPGTHEGKNQTGFIVGITVPIVFVALIL--  654

Query  256  IFYVWWTKKK  227
            +F + + K++
Sbjct  655  VFVIIYIKRR  664



>ref|XP_006585736.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Glycine max]
Length=925

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 119/179 (66%), Gaps = 4/179 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y +   +Q   T++ EL++TAR+S SSLRYYG+GL+ G Y + L FAE  + D   +W+ 
Sbjct  371  YKSFVPNQFAGTVNPELFQTARLSASSLRYYGLGLENGFYNITLQFAETAILDSNRTWES  430

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG RVL+DF++++EAGG S RA+ ++F+  VT N L+IH FWAGKGTCCI
Sbjct  431  LGRRVFDIYIQGTRVLKDFDIQKEAGGISYRAIQRQFRFEVTENYLEIHLFWAGKGTCCI  490

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFYV  245
            P Q T+GP++ AIH + +    + +    S    +G I+GI  G     VL I +IFY+
Sbjct  491  PTQGTYGPLIQAIHAIPDFIPTVSNKPPSSSNNNIGLILGIVFGVGVVSVLSIFAIFYI  549



>ref|XP_010557141.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Tarenaya hassleriana]
Length=1000

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+    ++W+G
Sbjct  470  YIAFSQAQFTNTLDSELFQTARLSASSLRYYGLGLENGGYTVMLQFAEIQIQG-SNTWRG  528

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR+FD+ IQG  V +DF+V + A GS  RA    +KA V+ N L+IH FWAGKGTCCI
Sbjct  529  LGRRFFDIYIQGRLVEKDFDVHRTANGSNTRAAQSVYKAKVSENYLEIHLFWAGKGTCCI  588

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GPIVSAI    +    + +++   D  R G I+G  +G   G+ I  +I +V+ 
Sbjct  589  PAQGTYGPIVSAITATPDFIPTVSNTTPSEDNNRTGTIVGSVVG--VGIAIFLTIVFVFI  646

Query  238  TKKKSPTYK  212
             +++   Y+
Sbjct  647  IRRRRKQYR  655



>ref|XP_010557133.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Tarenaya hassleriana]
Length=1015

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+    ++W+G
Sbjct  485  YIAFSQAQFTNTLDSELFQTARLSASSLRYYGLGLENGGYTVMLQFAEIQIQG-SNTWRG  543

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR+FD+ IQG  V +DF+V + A GS  RA    +KA V+ N L+IH FWAGKGTCCI
Sbjct  544  LGRRFFDIYIQGRLVEKDFDVHRTANGSNTRAAQSVYKAKVSENYLEIHLFWAGKGTCCI  603

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GPIVSAI    +    + +++   D  R G I+G  +G   G+ I  +I +V+ 
Sbjct  604  PAQGTYGPIVSAITATPDFIPTVSNTTPSEDNNRTGTIVGSVVG--VGIAIFLTIVFVFI  661

Query  238  TKKKSPTYK  212
             +++   Y+
Sbjct  662  IRRRRKQYR  670



>ref|XP_010557130.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Tarenaya hassleriana]
Length=1047

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+    ++W+G
Sbjct  485  YIAFSQAQFTNTLDSELFQTARLSASSLRYYGLGLENGGYTVMLQFAEIQIQG-SNTWRG  543

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR+FD+ IQG  V +DF+V + A GS  RA    +KA V+ N L+IH FWAGKGTCCI
Sbjct  544  LGRRFFDIYIQGRLVEKDFDVHRTANGSNTRAAQSVYKAKVSENYLEIHLFWAGKGTCCI  603

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GPIVSAI    +    + +++   D  R G I+G  +G   G+ I  +I +V+ 
Sbjct  604  PAQGTYGPIVSAITATPDFIPTVSNTTPSEDNNRTGTIVGSVVG--VGIAIFLTIVFVFI  661

Query  238  TKKKSPTYK  212
             +++   Y+
Sbjct  662  IRRRRKQYR  670



>ref|XP_010065125.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=673

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 126/196 (64%), Gaps = 18/196 (9%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y+A S SQ  NTLD EL+ TAR+S SSLRYYG+GL+ G Y V L FAEIQ+ D +  WK 
Sbjct  459  YSAPSLSQFTNTLDTELFHTARVSASSLRYYGLGLENGNYNVTLQFAEIQIQDTE--WKR  516

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  V +DF++++EAGG+   A++K ++A VT N L+IHFFWAGKGTCC+
Sbjct  517  LGRRLFDIYIQGNLVAKDFDIRKEAGGASFTAVLKLYQAQVTANYLEIHFFWAGKGTCCV  576

Query  412  PVQSTFGPIVSAIHVVQEV---------NLD-----DSSDGSDKKRVGKIIGITLGSAAG  275
            P Q+T+GP++SAI  V +           LD     D+S    K R G I+G+  G    
Sbjct  577  PKQATYGPLISAISAVPDFVPTVSNNPPTLDNPPTLDNSPSRKKDRSGLIVGVATGVGVV  636

Query  274  VLI-ICSIFYVWWTKK  230
              + +  + YV W ++
Sbjct  637  GFMAVLPVLYVVWRRR  652



>emb|CBI20016.3| unnamed protein product [Vitis vinifera]
Length=2193

 Score =   177 bits (449),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 128/189 (68%), Gaps = 8/189 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  NTLD EL++TARIS  SLRYYG+GL+ G Y + L FAE  + +  +SWK 
Sbjct  556  YTSTSSSQFTNTLDSELFQTARISAGSLRYYGLGLENGNYTLTLQFAETAIVN-SNSWKS  614

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FDV IQG+ VL+DF++++EAGG S +A+ K+F A V  N ++IH FWAGKGTCC+
Sbjct  615  LGRRVFDVYIQGDLVLKDFDIRKEAGGVSFQAVKKEFTAQVLENYIEIHLFWAGKGTCCV  674

Query  412  PVQSTFGPIVSAIHVVQ--EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP +SAI      E  + +++    K R G I+GI +G   GV+   S+F +++
Sbjct  675  PAQGTYGPSISAISATPDFEPTVSNTAPNGKKNRTGLIVGIAVG--LGVVCFLSVFALYY  732

Query  238  --TKKKSPT  218
               ++K P+
Sbjct  733  FVLRRKKPS  741


 Score =   166 bits (421),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 121/178 (68%), Gaps = 8/178 (4%)
 Frame = -2

Query  739   NTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYFDVSI  560
             NTLD EL++TARIS  SLRYYG+GLK G Y + L FAE  + +  +SWK LGRR FD+ I
Sbjct  1641  NTLDSELFQTARISAGSLRYYGLGLKNGNYTLTLQFAETAIVN-SNSWKTLGRRVFDIYI  1699

Query  559   QGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIV  383
             QG+ +L+DF++++EAGG S +A+ K+F A V  N ++IH FWAGKGTCC+P Q T+GP +
Sbjct  1700  QGDLILKDFDIRKEAGGVSFQAVKKEFTAQVLENYIEIHLFWAGKGTCCVPAQGTYGPSI  1759

Query  382   SAIHVVQ--EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW--TKKKSP  221
             SAI      E  + +++    K R G I+GI +  A G++   ++F V++   ++K P
Sbjct  1760  SAISATPNFEPTVPNTAPNGKKHRTGLIVGIAV--ALGLVCFLAVFSVYYFVLRRKKP  1815



>emb|CDY03757.1| BnaA02g14800D [Brassica napus]
Length=2043

 Score =   177 bits (449),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NT D EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQM+   +SWKG
Sbjct  477  YIASSLSQFTNTSDSELFQTARLSASSLRYYGLGLENGGYTVTLQFAEIQME-ASNSWKG  535

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGS-KRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  V +DF+V + AGGS  RA+ + +KANVT N +++H FWAGKGTCCI
Sbjct  536  LGRRRFDIYVQGRLVEKDFDVLRTAGGSTNRAVHRVYKANVTENYIEVHLFWAGKGTCCI  595

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P+Q  +GPI+SA+    +    +D+      K + G I+G+ +G   G+L I +   ++ 
Sbjct  596  PIQGAYGPIISAVSAAPDFRPTVDNKPPSKGKNKTGIIVGVIVG--LGLLSILAGLGIFI  653

Query  238  TKKKSPTY  215
             +K+   Y
Sbjct  654  IRKRRKPY  661


 Score =   167 bits (424),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = -2

Query  769   YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
             YT    SQ  NT D EL++TAR+SPSS+RYYG+ L+ G+Y V L FAEIQM    +SW G
Sbjct  1501  YTETLLSQFTNTSDSELFQTARLSPSSIRYYGLELENGVYNVTLQFAEIQMTS-SNSWTG  1559

Query  589   LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LGRR FD+ +QG  V +DF+V++ AGG + RA+ +++KANVT N L++H FWAGKGTCCI
Sbjct  1560  LGRRRFDIYVQGRLVEKDFDVRRTAGGFTDRAVRREYKANVTENYLEVHLFWAGKGTCCI  1619

Query  412   PVQSTFGPIVSAIHVVQE  359
             P+Q  +GPI+SA+    +
Sbjct  1620  PIQGAYGPIISAVSAAAD  1637



>ref|XP_007024832.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27454.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1034

 Score =   174 bits (442),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 120/188 (64%), Gaps = 7/188 (4%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDS  599
            Q Y  ++F+Q+ NT   ELY+T+R+SP SLRYYG+GL+ G+Y V L FAE    D    +
Sbjct  475  QKYVENTFAQVRNTGTPELYQTSRLSPGSLRYYGLGLQNGLYTVNLFFAETGFPDRSTQT  534

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            WK L RR FDV +QG R LRDF++ +EAGG +RA+ K F ANVT N L+IH FWAGKGTC
Sbjct  535  WKSLARRVFDVYVQGTRQLRDFDISKEAGGVQRAITKNFTANVTENHLEIHLFWAGKGTC  594

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDS--SDGSDKKR--VGKIIGITLGSAAGVLIICSIF  251
            C P Q  +GP +SAI VV       S    G+ KK+     I+GI +  A   LI+  IF
Sbjct  595  CEPEQGYYGPSISAISVVPNFKPTVSGIPPGTPKKKNQTALIVGIAVPVAVVALIL--IF  652

Query  250  YVWWTKKK  227
             + + K++
Sbjct  653  AIIYVKRR  660



>ref|XP_008806782.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Phoenix dactylifera]
Length=894

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 133/214 (62%), Gaps = 10/214 (5%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
            G NY  +S SQ  NTLD EL++TAR+SPSSLRYYG+GL+ G Y V+L F+E    +   +
Sbjct  331  GANYIINSLSQFQNTLDSELFQTARLSPSSLRYYGIGLQNGNYTVKLQFSETAYPN-PPT  389

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGT  422
            WK +GRR FD+ IQG    +DF++++EAGGS   A+VK+F   VT N L++HFFWAGKGT
Sbjct  390  WKSVGRRVFDIYIQGALQEKDFDIRKEAGGSSFVAVVKEFTVPVTKNFLELHFFWAGKGT  449

Query  421  CCIPVQSTFGPIVSAIHV-----VQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICS  257
            CC+P+Q  +G  VSAI V        V     +  S KK  G I+GI + + AG+ ++ +
Sbjct  450  CCVPMQGYYGASVSAISVSPYDFTPTVPNKLPTQSSTKKHTGLIVGI-VAAFAGLGLLLA  508

Query  256  IF--YVWWTKKKSPTYKGF*LDSTTKLPSSSKYC  161
            IF  ++W  KKK  + +   L   T  P +  Y 
Sbjct  509  IFGTFIWRQKKKRLSMEDEELLGMTTRPDTFSYA  542



>gb|KJB34924.1| hypothetical protein B456_006G091400 [Gossypium raimondii]
Length=893

 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 121/190 (64%), Gaps = 11/190 (6%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-S  599
            Q Y  ++ +Q+  T   ELY+T+R+SP SLRYYG+GL+ G+Y V L FAE    D    S
Sbjct  333  QLYVQNTLAQVTRTSTPELYQTSRLSPGSLRYYGLGLENGLYTVNLFFAETAFSDRSTRS  392

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W+ LGRR FDV IQG R LRDF + +EAGG +RA+VK F ANVT+N L+IH FWAGKGTC
Sbjct  393  WRSLGRRIFDVYIQGTRQLRDFEISKEAGGVERAVVKNFTANVTDNHLEIHLFWAGKGTC  452

Query  418  CIPVQSTFGPIVSAIHVVQEVNLDDSSDG------SDKKRVGKIIGITLGSAAGVLIICS  257
            C P Q  +GP +SAI+VV   N   +  G        K + G I+GIT+      LI+  
Sbjct  453  CTPEQGYYGPSISAINVVP--NFVPTVSGIPPGTHKGKNQTGLIVGITVPIVFVALIL--  508

Query  256  IFYVWWTKKK  227
            +F + + K++
Sbjct  509  VFVIIYIKRR  518



>ref|XP_008779611.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130, partial [Phoenix dactylifera]
Length=253

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 114/168 (68%), Gaps = 7/168 (4%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S SQ  NT + ELY+TAR+SPSSLRYYG+GL+ G Y ++L+FAE+Q+ D   +WK
Sbjct  34   DYILNSVSQFSNTREPELYQTARLSPSSLRYYGLGLENGNYTIKLNFAEMQILD-PPTWK  92

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             +GRR FD+ IQG    +DF++++EAG  S RA++K+F A VTNN L+IHFFW+GKGTCC
Sbjct  93   SVGRRVFDIYIQGNLKEKDFDIRKEAGERSFRAVMKEFTAPVTNNFLEIHFFWSGKGTCC  152

Query  415  IPVQSTFGPIVSAIHV-----VQEVNLDDSSDGSDKKRVGKIIGITLG  287
            +P    +G  +SAI V        V+    S  S  KR G ++GI  G
Sbjct  153  VPTDGYYGSSISAISVYPFDFTPTVSNKPPSTDSTNKRTGLVVGIAAG  200



>ref|XP_010655872.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Vitis vinifera]
Length=872

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQM-DDIKDSWKGLGRRY  575
            +++  T   EL+KT+RISP SLRYYG+GL+ G Y V L FAE+++ D    +W+ +GRR 
Sbjct  308  TEVSGTNHPELFKTSRISPGSLRYYGLGLQNGHYTVSLQFAEMELKDQSAQTWESIGRRV  367

Query  574  FDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            FD+ IQG   L+DF++ +EAGG +RA+ +KF A V+ N L+IH FWAGKGTCCIP +  +
Sbjct  368  FDIYIQGTLQLKDFDITKEAGGVERAIERKFNAVVSQNYLEIHLFWAGKGTCCIPFEGYY  427

Query  394  GPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGI--TLGSAAGVLIICSIFYVWW  239
            GP +SA+ VV ++    ++    K   G I GI   +G  + +LIIC++FYV W
Sbjct  428  GPSISALSVVSDLKRVPTTTPPKKGYTGLIAGIVAAIGILSFILIICAVFYVKW  481



>gb|AFW59458.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=331

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 121/186 (65%), Gaps = 6/186 (3%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S  Q  NTLD EL++TAR+SPSSLRYYG+GL+ G Y V L FAE   +D   +WK
Sbjct  7    SYIIYSLHQFQNTLDSELFQTARMSPSSLRYYGIGLENGNYTVTLQFAEFDFED-SQTWK  65

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             +GRR FD+ +QGER  ++F++++ +GG S  A+ K++   VT N L+IH FWAGKGTCC
Sbjct  66   SVGRRVFDIYLQGERKEKNFDIRKASGGKSYTAVEKQYIVPVTRNFLEIHLFWAGKGTCC  125

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYV  245
            IP Q  +GP +SA+         + +S+   +  + G I+G+ +G+A  GVL +  I  +
Sbjct  126  IPAQGYYGPAISALSATPNFTPTVRNSAQKKNSSKTGVIVGVVIGAAVLGVLALAGIC-M  184

Query  244  WWTKKK  227
            W  K++
Sbjct  185  WRQKRR  190



>emb|CAN74435.1| hypothetical protein VITISV_041450 [Vitis vinifera]
Length=957

 Score =   173 bits (438),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQM-DDIKDSWKGLGRRY  575
            +++  T   EL+KT+RISP SLRYYG+GL+ G Y V L FAE+++ D    +W+ +GRR 
Sbjct  429  TEVSGTNHPELFKTSRISPGSLRYYGLGLQNGHYTVSLQFAEMELKDQSAQTWESIGRRV  488

Query  574  FDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            FD+ IQG   L+DF++ +EAGG +RA+ +KF A V+ N L+IH FWAGKGTCCIP +  +
Sbjct  489  FDIYIQGTLQLKDFDITKEAGGVERAIERKFNAVVSQNYLEIHLFWAGKGTCCIPFEGYY  548

Query  394  GPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGI--TLGSAAGVLIICSIFYVWW  239
            GP +SA+ VV ++    ++    K   G I GI  ++G  + +LIIC++FYV W
Sbjct  549  GPSISALSVVSDLKRVPTTTPPKKGYTGLIAGIVASIGILSFILIICAVFYVKW  602



>ref|XP_002272816.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Vitis vinifera]
Length=1039

 Score =   173 bits (438),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQM-DDIKDSWKGLGRRY  575
            +++  T   EL+KT+RISP SLRYYG+GL+ G Y V L FAE+++ D    +W+ +GRR 
Sbjct  475  TEVSGTNHPELFKTSRISPGSLRYYGLGLQNGHYTVSLQFAEMELKDQSAQTWESIGRRV  534

Query  574  FDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            FD+ IQG   L+DF++ +EAGG +RA+ +KF A V+ N L+IH FWAGKGTCCIP +  +
Sbjct  535  FDIYIQGTLQLKDFDITKEAGGVERAIERKFNAVVSQNYLEIHLFWAGKGTCCIPFEGYY  594

Query  394  GPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGI--TLGSAAGVLIICSIFYVWW  239
            GP +SA+ VV ++    ++    K   G I GI   +G  + +LIIC++FYV W
Sbjct  595  GPSISALSVVSDLKRVPTTTPPKKGYTGLIAGIVAAIGILSFILIICAVFYVKW  648



>ref|XP_010557120.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Tarenaya hassleriana]
Length=1019

 Score =   172 bits (437),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 123/175 (70%), Gaps = 4/175 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NTLD EL++TAR+SPSSLRYYG+GL+ G Y + L FAEIQM    ++W+G
Sbjct  459  YVASSQAQFVNTLDSELFQTARLSPSSLRYYGLGLENGGYTITLQFAEIQMQS-PNTWRG  517

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  V +DF++++ A GS  RA+ + +K+NV+ N L+IH FWAGKGTCCI
Sbjct  518  LGRRLFDIYVQGRLVEKDFDIRRTANGSIIRAVQRSYKSNVSENYLEIHLFWAGKGTCCI  577

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSI  254
            P+Q T+GP+VSAI    +    +++     DK R G I+G+ +G    ++++ ++
Sbjct  578  PLQGTYGPLVSAISASPDFIPTVNNRPLSEDKNRTGTIVGVVVGLGVAIILVIAL  632



>ref|XP_010557111.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Tarenaya hassleriana]
Length=1043

 Score =   173 bits (438),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 123/175 (70%), Gaps = 4/175 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NTLD EL++TAR+SPSSLRYYG+GL+ G Y + L FAEIQM    ++W+G
Sbjct  483  YVASSQAQFVNTLDSELFQTARLSPSSLRYYGLGLENGGYTITLQFAEIQMQS-PNTWRG  541

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  V +DF++++ A GS  RA+ + +K+NV+ N L+IH FWAGKGTCCI
Sbjct  542  LGRRLFDIYVQGRLVEKDFDIRRTANGSIIRAVQRSYKSNVSENYLEIHLFWAGKGTCCI  601

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSI  254
            P+Q T+GP+VSAI    +    +++     DK R G I+G+ +G    ++++ ++
Sbjct  602  PLQGTYGPLVSAISASPDFIPTVNNRPLSEDKNRTGTIVGVVVGLGVAIILVIAL  656



>ref|XP_010557103.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Tarenaya hassleriana]
Length=1092

 Score =   172 bits (437),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 123/175 (70%), Gaps = 4/175 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NTLD EL++TAR+SPSSLRYYG+GL+ G Y + L FAEIQM    ++W+G
Sbjct  532  YVASSQAQFVNTLDSELFQTARLSPSSLRYYGLGLENGGYTITLQFAEIQMQS-PNTWRG  590

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  V +DF++++ A GS  RA+ + +K+NV+ N L+IH FWAGKGTCCI
Sbjct  591  LGRRLFDIYVQGRLVEKDFDIRRTANGSIIRAVQRSYKSNVSENYLEIHLFWAGKGTCCI  650

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSI  254
            P+Q T+GP+VSAI    +    +++     DK R G I+G+ +G    ++++ ++
Sbjct  651  PLQGTYGPLVSAISASPDFIPTVNNRPLSEDKNRTGTIVGVVVGLGVAIILVIAL  705



>ref|XP_006853421.1| hypothetical protein AMTR_s00032p00162420 [Amborella trichopoda]
 gb|ERN14888.1| hypothetical protein AMTR_s00032p00162420 [Amborella trichopoda]
Length=755

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 118/186 (63%), Gaps = 6/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y   S SQ   TLD EL++TAR+SP SLRYYG+GL+ G+Y + L FAE++     D W+ 
Sbjct  237  YIETSQSQFTATLDTELFQTARLSPGSLRYYGLGLQNGVYTIRLEFAELEFPTPPD-WRS  295

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             GRR FD+ IQG+  L+DF++++ AG S  RA+   +KANVT N L+IH FWAGKGTCCI
Sbjct  296  TGRRVFDIYIQGKLELKDFDIRKAAGDSSFRAVPNTYKANVTENFLEIHLFWAGKGTCCI  355

Query  412  PVQSTFGPIVSAIHV----VQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYV  245
            P Q  +GP++SA+      V  V+    S  S + R G I+GI +G     LI+ S  ++
Sbjct  356  PNQGYYGPLISAVKATPDFVPNVSNLPPSTSSKQNRTGLIVGIVVGFGVLFLILVSAIFI  415

Query  244  WWTKKK  227
               +KK
Sbjct  416  VRKRKK  421



>gb|KFK35534.1| hypothetical protein AALP_AA4G003100 [Arabis alpina]
Length=1031

 Score =   172 bits (436),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 125/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y + S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +  I ++WK
Sbjct  476  YISTSTSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSISNTWK  535

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ K +KANV+ N L+IH FWAGKGTCC
Sbjct  536  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQKVYKANVSENYLEIHLFWAGKGTCC  595

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP Q  +GP++SA+    +    + +      K   G I+G+ +G   G+LII ++  ++
Sbjct  596  IPNQGAYGPLISAVSATPDFTPTVGNKPPSKGKNMTGTIVGVVVG--IGLLIIFAVVVIF  653

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  654  IIRKRRKRY  662



>ref|XP_002513383.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF48786.1| ATP binding protein, putative [Ricinus communis]
Length=1016

 Score =   172 bits (436),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 125/188 (66%), Gaps = 4/188 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEI ++D  ++W+ 
Sbjct  465  YIAFSSSQFTNTLDSELFQTARVSASSLRYYGLGLENGNYTVNLQFAEIVIED-GNTWRS  523

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  VL+DF++K+EAGG SK  + + F A V+ N L+IH FWAGKGTCCI
Sbjct  524  LGRRVFDIYVQGNLVLKDFDIKKEAGGVSKLPVERSFTAQVSENYLEIHLFWAGKGTCCI  583

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP +SAI    +    + +    S K R G ++GI +G     L++  IF+V  
Sbjct  584  PFQGTYGPSISAISATPDFIPTVSNILPTSKKDRTGLVVGIVVGVGISFLLVFVIFFVVQ  643

Query  238  TKKKSPTY  215
             +K+  TY
Sbjct  644  RRKRKNTY  651



>gb|KCW71353.1| hypothetical protein EUGRSUZ_F04434 [Eucalyptus grandis]
Length=1010

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 106/138 (77%), Gaps = 3/138 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y+A S SQ  NTLD EL++TARIS SSLRYYG+GL+ G Y V L FAEIQ+ D +  WK 
Sbjct  471  YSASSPSQFTNTLDTELFQTARISASSLRYYGLGLENGNYNVTLQFAEIQIQDTQ--WKR  528

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  V +DF++++EAGG+   A++K + A+VT N L+IHFFWAGKGTCC+
Sbjct  529  LGRRLFDIYIQGNLVAKDFDIQKEAGGASFTAVLKLYHAHVTANYLEIHFFWAGKGTCCV  588

Query  412  PVQSTFGPIVSAIHVVQE  359
            P Q+T+GP++SAI  V +
Sbjct  589  PKQATYGPLISAISAVPD  606



>gb|KCW71354.1| hypothetical protein EUGRSUZ_F04434 [Eucalyptus grandis]
Length=1027

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 106/138 (77%), Gaps = 3/138 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y+A S SQ  NTLD EL++TARIS SSLRYYG+GL+ G Y V L FAEIQ+ D +  WK 
Sbjct  471  YSASSPSQFTNTLDTELFQTARISASSLRYYGLGLENGNYNVTLQFAEIQIQDTQ--WKR  528

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  V +DF++++EAGG+   A++K + A+VT N L+IHFFWAGKGTCC+
Sbjct  529  LGRRLFDIYIQGNLVAKDFDIQKEAGGASFTAVLKLYHAHVTANYLEIHFFWAGKGTCCV  588

Query  412  PVQSTFGPIVSAIHVVQE  359
            P Q+T+GP++SAI  V +
Sbjct  589  PKQATYGPLISAISAVPD  606



>emb|CBI39030.3| unnamed protein product [Vitis vinifera]
Length=2282

 Score =   173 bits (438),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 118/174 (68%), Gaps = 3/174 (2%)
 Frame = -2

Query  751   SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQM-DDIKDSWKGLGRRY  575
             +++  T   EL+KT+RISP SLRYYG+GL+ G Y V L FAE+++ D    +W+ +GRR 
Sbjct  1758  TEVSGTNHPELFKTSRISPGSLRYYGLGLQNGHYTVSLQFAEMELKDQSAQTWESIGRRV  1817

Query  574   FDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
             FD+ IQG   L+DF++ +EAGG +RA+ +KF A V+ N L+IH FWAGKGTCCIP +  +
Sbjct  1818  FDIYIQGTLQLKDFDITKEAGGVERAIERKFNAVVSQNYLEIHLFWAGKGTCCIPFEGYY  1877

Query  394   GPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGI--TLGSAAGVLIICSIFYVWW  239
             GP +SA+ VV ++    ++    K   G I GI   +G  + +LIIC++FYV W
Sbjct  1878  GPSISALSVVSDLKRVPTTTPPKKGYTGLIAGIVAAIGILSFILIICAVFYVKW  1931


 Score =   159 bits (403),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 117/181 (65%), Gaps = 6/181 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWK  593
            Y  ++  Q+ +T   EL++T+R+SP SLRYYG+GL+ G Y V L FAE +      ++W+
Sbjct  486  YLENNLKQVADTSTPELFQTSRVSPGSLRYYGLGLENGNYTVSLEFAETKFASRSTETWE  545

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LGRR FD+ IQG   L+DF++ +EAGG  +AL KKF A V+ N L+IH FWAGKGTCCI
Sbjct  546  SLGRRVFDIYIQGSLQLKDFDISKEAGGVDKALEKKFNATVSENYLEIHLFWAGKGTCCI  605

Query  412  PVQSTFGPIVSAIHVVQE----VNLDDSSDGSDKKRVGKIIGITLGSAAGVLI-ICSIFY  248
            PVQ  +GP +SA+ VV +    V+   S   S K   G I+G+ +   +   I IC++FY
Sbjct  606  PVQGYYGPSISALSVVSDFTPSVSGIPSIPPSKKNNTGLIVGVVVAVGSVSFILICAVFY  665

Query  247  V  245
            +
Sbjct  666  M  666



>ref|XP_006853422.1| hypothetical protein AMTR_s00032p00163130 [Amborella trichopoda]
 gb|ERN14889.1| hypothetical protein AMTR_s00032p00163130 [Amborella trichopoda]
Length=602

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 119/187 (64%), Gaps = 7/187 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y   S SQ  N  D EL++TAR+SP SLRYYG+GL+ G Y + L FAE+      D W+ 
Sbjct  45   YIETSQSQFTNISDSELFQTARLSPGSLRYYGLGLENGEYTIRLEFAELAFATPPD-WRS  103

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FDV +QG+  L+DF++++EA  S  RA+ K +KANVT N L+IH FWAGKGTCCI
Sbjct  104  VGRRVFDVYLQGKLQLKDFDIRKEASDSSFRAVSKTYKANVTENFLEIHLFWAGKGTCCI  163

Query  412  PVQSTFGPIVSAIHV----VQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLI-ICSIFY  248
            P Q  +GP++SA+      V  V+    S  S + R G I+GI +GS    LI I +IF 
Sbjct  164  PNQGYYGPLISAVKATPDFVPTVSNLPPSTSSKQNRTGLIVGIVVGSGVLFLIAISAIFI  223

Query  247  VWWTKKK  227
            V   KKK
Sbjct  224  VRQRKKK  230



>ref|XP_010942352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Elaeis guineensis]
Length=1043

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 113/158 (72%), Gaps = 8/158 (5%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S SQ PNTL+ ELY+T R+SPSSLRYYG+GL+ G Y ++LHFAE Q+ D   +WK
Sbjct  479  DYILNSASQFPNTLETELYQTQRLSPSSLRYYGLGLENGNYTIKLHFAETQILD-PPTWK  537

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAG-GSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             +GRR FD+ IQG+R  +DF++K+EAG  S RA+VK++ A VTNN LDIHFFW+GKGTCC
Sbjct  538  SVGRRVFDIYIQGDRKEKDFDIKKEAGEKSFRAVVKEYTAPVTNNFLDIHFFWSGKGTCC  597

Query  415  IPVQSTFGPIVSAIHVVQ------EVNLDDSSDGSDKK  320
            +P Q  +G  +SAI V          N   S+D ++KK
Sbjct  598  VPTQGYYGSSISAISVYPFDFTPTVSNKPPSTDSTNKK  635



>emb|CAN66709.1| hypothetical protein VITISV_006396 [Vitis vinifera]
Length=1133

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 126/188 (67%), Gaps = 8/188 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  NTLD EL++TARIS  SLRYYG+GL+ G Y + L FAE  + +  +SWK 
Sbjct  400  YTSRSSSQFTNTLDSELFQTARISAGSLRYYGLGLENGNYNLTLQFAETAIVN-SNSWKS  458

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG+ VL+DF++++EAGG S +A+ K+F A V  N ++IH FWAGKGTCC+
Sbjct  459  LGRRVFDIYIQGDLVLKDFDIRKEAGGVSFQAVKKEFTAQVLENYIEIHLFWAGKGTCCV  518

Query  412  PVQSTFGPIVSAIHVVQ--EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP +SAI      E  + +++    K   G I+GI +  A G++   ++F V++
Sbjct  519  PAQGTYGPSISAISATPNFEPTVPNTAPNGKKNWTGLIVGIAV--ALGLVCFLAVFSVYY  576

Query  238  --TKKKSP  221
               ++K P
Sbjct  577  FVLRRKKP  584



>gb|EYU27557.1| hypothetical protein MIMGU_mgv1a018669mg [Erythranthe guttata]
Length=1046

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 124/187 (66%), Gaps = 9/187 (5%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT +  + IPNT D EL++TAR+S  SLRYYG+ L+ G Y V L F E +++D   SWK 
Sbjct  488  YTNNFLTYIPNTRDPELFQTARVSAGSLRYYGLALENGGYNVTLQFVENKIED-PTSWKS  546

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
             GRR FD+ IQG    +DF++++EAG S RA+VK F A VT N L+IH FWAGKGTCC+P
Sbjct  547  HGRRVFDIYIQGNLAEKDFDIRKEAGASLRAVVKDFTARVTENHLEIHLFWAGKGTCCVP  606

Query  409  VQSTFGPIVSAIHV-----VQEVNLDDSSDGSDKK-RVGKIIGITLGSAAGVLIICSIFY  248
             Q T+GP +SAI V     V  V+ +  ++ + KK R G I+G+ +  + G +I  S+F 
Sbjct  607  AQGTYGPSISAISVTPGDFVPTVSNNPPNEPAGKKNRTGMIVGVVV--SIGAVIFLSLFA  664

Query  247  VWWTKKK  227
            V+++ +K
Sbjct  665  VYYSIQK  671



>ref|XP_009412046.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Musa acuminata subsp. malaccensis]
Length=1033

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 122/188 (65%), Gaps = 9/188 (5%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  +S SQ  NTLD EL++  R+SPSSLRYYG+GL+ G Y V+L FA+    +   +WK 
Sbjct  473  YIVNSLSQFQNTLDSELFQAERLSPSSLRYYGIGLQNGNYTVKLQFADAVFPN-PPTWKS  531

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ IQG    +DF+++++AGGS  +A+VK+F A VTNN L+IHFFWAGKGTCC+
Sbjct  532  VGRRIFDIYIQGVLKEKDFDIRKDAGGSSTKAVVKEFIAPVTNNFLEIHFFWAGKGTCCV  591

Query  412  PVQSTFGPIVSAIHV-----VQEVNLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIF  251
            P Q  +G  +SAI V        V+    S  S+K R G I+GI+   A  G+L IC I 
Sbjct  592  PTQGFYGASISAISVSPSDFTPTVSNKPPSTDSNKTRTGLIVGISAAVAVLGLLTICGIL  651

Query  250  YVWWTKKK  227
              W  +K+
Sbjct  652  -TWRNRKR  658



>ref|XP_010480180.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X4 [Camelina sativa]
Length=1004

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 117/164 (71%), Gaps = 4/164 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ++   ++WKG
Sbjct  454  YIATSQSQFINTLDPELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQIEG-SNTWKG  512

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG  V +DF++++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCCI
Sbjct  513  IGRRRFDIYVQGRLVEKDFDIRRTAGDSTVRAVQREYKANVSENYLEIHLFWAGKGTCCI  572

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG  287
            P+Q  +GP++SA++   +    + + +    K R G I+GI +G
Sbjct  573  PIQGAYGPLISAVNATPDFRPTVANRTPSKGKNRTGTIVGIIVG  616



>ref|XP_010480178.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X2 [Camelina sativa]
Length=1028

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 117/164 (71%), Gaps = 4/164 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ++   ++WKG
Sbjct  478  YIATSQSQFINTLDPELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQIEG-SNTWKG  536

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG  V +DF++++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCCI
Sbjct  537  IGRRRFDIYVQGRLVEKDFDIRRTAGDSTVRAVQREYKANVSENYLEIHLFWAGKGTCCI  596

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG  287
            P+Q  +GP++SA++   +    + + +    K R G I+GI +G
Sbjct  597  PIQGAYGPLISAVNATPDFRPTVANRTPSKGKNRTGTIVGIIVG  640



>ref|XP_010480179.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X3 [Camelina sativa]
Length=1013

 Score =   170 bits (431),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 117/164 (71%), Gaps = 4/164 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ++   ++WKG
Sbjct  463  YIATSQSQFINTLDPELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQIEG-SNTWKG  521

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG  V +DF++++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCCI
Sbjct  522  IGRRRFDIYVQGRLVEKDFDIRRTAGDSTVRAVQREYKANVSENYLEIHLFWAGKGTCCI  581

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG  287
            P+Q  +GP++SA++   +    + + +    K R G I+GI +G
Sbjct  582  PIQGAYGPLISAVNATPDFRPTVANRTPSKGKNRTGTIVGIIVG  625



>ref|XP_010093040.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB53368.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=1105

 Score =   170 bits (431),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 132/215 (61%), Gaps = 37/215 (17%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT  S SQ  NTL+ EL++T R+S SSLRYYG+GL+ G Y V+L F EI +++ + SWK 
Sbjct  516  YTRSSLSQFTNTLNSELFQTLRLSASSLRYYGLGLENGNYTVQLEFTEIDIENTR-SWKS  574

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ IQG RVL+DF++++EAG  S RA+ K++KA V+NN L++H FWAGKGTCCI
Sbjct  575  VGRRVFDIYIQGNRVLKDFDIRKEAGEISFRAVQKEYKALVSNNYLEVHLFWAGKGTCCI  634

Query  412  PVQSTFGPIVSAIHV---------------------------VQEVNLDDSSDGSDK---  323
            P Q  +GP ++AI                             V +++ D +   S+K   
Sbjct  635  PAQGIYGPSIAAISATPAPASESESLTCTREPIGLLRTVINGVFDIDTDFTPTVSNKPPS  694

Query  322  ---KRVGKIIGITLGSAAGVLIICSIFYVWWTKKK  227
                R G I+GI +G  AGVL++ S+F ++   ++
Sbjct  695  NEENRTGLIVGIVVG--AGVLVLLSVFVIFIIHRR  727



>ref|XP_009389704.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Musa acuminata subsp. malaccensis]
Length=606

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 119/186 (64%), Gaps = 7/186 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT +S SQ   T + ELY+TARISPSSLRYYG+GL+ G Y V LHFAE Q+ D   +W+ 
Sbjct  314  YTLYSSSQFQKTQEPELYQTARISPSSLRYYGLGLENGNYTVMLHFAETQIFD-PPTWRS  372

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
             GRR FD+ IQG RVL+DF+++ E   S  A+ +KF   VT+N L+IHFFWAGKGTCC+P
Sbjct  373  TGRRIFDIYIQGNRVLKDFDIRAEE-NSFTAVTRKFIVPVTDNFLEIHFFWAGKGTCCVP  431

Query  409  VQSTFGPIVSAIHV-----VQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYV  245
             Q  +GP VSAI V     +  V+ +  S  S       I+GI  G  A VL+I     +
Sbjct  432  DQGYYGPSVSAISVNPYDFIPTVSNEPPSSASKNSNKSTIVGIFSGIGALVLLIVFGILI  491

Query  244  WWTKKK  227
            +W +++
Sbjct  492  YWQRQR  497



>ref|XP_010064054.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Eucalyptus grandis]
Length=1028

 Score =   170 bits (430),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 105/138 (76%), Gaps = 3/138 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y+A S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+ + +  WK 
Sbjct  472  YSASSLSQFTNTLDSELFQTARVSASSLRYYGLGLENGNYNVTLQFAEIQIQNTE--WKR  529

Query  589  LGRRYFDVSIQGERVLRDFNVKQEA-GGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  V++DF++++EA G S  A+ K ++A VT N L+IHFFWAGKGTCC+
Sbjct  530  LGRRLFDIYIQGNLVVKDFDIRKEADGASFTAVPKMYQARVTANYLEIHFFWAGKGTCCV  589

Query  412  PVQSTFGPIVSAIHVVQE  359
            P Q+T+GP++SAI  V +
Sbjct  590  PNQATYGPLISAISAVPD  607



>gb|KCW71360.1| hypothetical protein EUGRSUZ_F04441, partial [Eucalyptus grandis]
Length=636

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A + SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+  +   W+ 
Sbjct  78   YKASTLSQFTNTLDSELFQTARLSASSLRYYGLGLENGNYNVSLRFAEIQI--LNTGWQK  135

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FDV IQG  V++DF++++EAGG+    V+K ++A VT N L+IHFFWAGKGTCC+
Sbjct  136  LGRRLFDVYIQGNLVVKDFDIRKEAGGASLTAVQKVYQAQVTANYLEIHFFWAGKGTCCV  195

Query  412  PVQSTFGPIVSAIHVV  365
            P Q+T+GP+VSAI  V
Sbjct  196  PNQATYGPLVSAISAV  211



>emb|CDY10508.1| BnaC03g71060D [Brassica napus]
Length=1033

 Score =   170 bits (430),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            YTA S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++W+
Sbjct  478  YTATSQSQFINTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSSSNTWR  537

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V  DF+V++ AG S  RA+ + +KANVT N L+IH FWAGKGTCC
Sbjct  538  GLGRRRFDIYVQGRLVETDFDVRRTAGDSTVRAVQRVYKANVTENHLEIHLFWAGKGTCC  597

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GP++SA+    +    + +      K R G I+G+ +G   G+L I +   ++
Sbjct  598  IPIQGAYGPLISAVSAKSDFTPTVGNRPPSKGKNRTGTIVGVIVG--VGLLSILAGVAIF  655

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  656  IIRKRRKRY  664



>ref|XP_010480176.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X1 [Camelina sativa]
Length=1065

 Score =   170 bits (430),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 117/164 (71%), Gaps = 4/164 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ++   ++WKG
Sbjct  515  YIATSQSQFINTLDPELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQIEG-SNTWKG  573

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG  V +DF++++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCCI
Sbjct  574  IGRRRFDIYVQGRLVEKDFDIRRTAGDSTVRAVQREYKANVSENYLEIHLFWAGKGTCCI  633

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG  287
            P+Q  +GP++SA++   +    + + +    K R G I+GI +G
Sbjct  634  PIQGAYGPLISAVNATPDFRPTVANRTPSKGKNRTGTIVGIIVG  677



>ref|XP_010064057.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X3 [Eucalyptus grandis]
Length=917

 Score =   169 bits (428),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 111/158 (70%), Gaps = 5/158 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A + SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+  +   W+ 
Sbjct  372  YKASTLSQFTNTLDSELFQTARLSASSLRYYGLGLENGNYNVSLRFAEIQI--LNTGWQK  429

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FDV IQG  V++DF++++EAGG+    V+K ++A VT N L+IHFFWAGKGTCC+
Sbjct  430  LGRRLFDVYIQGNLVVKDFDIRKEAGGASLTAVQKVYQAQVTANYLEIHFFWAGKGTCCV  489

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKI  305
            P Q+T+GP+VSAI  V +    + ++   S K   G I
Sbjct  490  PNQATYGPLVSAISAVPDFIPTVSNNPPTSKKDHTGLI  527



>ref|XP_002303698.2| hypothetical protein POPTR_0003s14780g [Populus trichocarpa]
 gb|EEE78677.2| hypothetical protein POPTR_0003s14780g [Populus trichocarpa]
Length=927

 Score =   169 bits (428),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 120/183 (66%), Gaps = 14/183 (8%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSW  596
            +Y  ++ +Q+ +T   ELY+T+RISP SLRY+G+GL+ G Y V L FAE    D    +W
Sbjct  377  DYVENTLTQVLSTNIPELYQTSRISPGSLRYFGLGLENGPYTVHLLFAETAFADRSSQTW  436

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            + LGRR FD+ IQG R L+DF++ +EAGG +R++ + F   V+ N L+IH FWAGKGTCC
Sbjct  437  ESLGRRVFDIYIQGSRQLKDFDISKEAGGVERSITRIFNVTVSENHLEIHLFWAGKGTCC  496

Query  415  IPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWT  236
             PVQ  +GPI+SA++VV E           K R G ++GI++  +AGV+ +  IF V + 
Sbjct  497  TPVQGYYGPIISALNVVPE-----------KSRTGMVVGISV--SAGVVCLTLIFAVVYI  543

Query  235  KKK  227
             +K
Sbjct  544  MRK  546



>gb|KFK41450.1| hypothetical protein AALP_AA2G132100 [Arabis alpina]
Length=979

 Score =   169 bits (429),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 127/188 (68%), Gaps = 6/188 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A+S +Q  NT D EL+++AR+S SSLRY+G+GL+ G Y V L FAEIQ+ D  +SWK 
Sbjct  433  YIANSQAQFINTSDSELFQSARLSASSLRYHGLGLENGGYTVTLQFAEIQLRD-SNSWKA  491

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG+ V +DF+V++ AG S  RA+ +++KANVT N L+IH FWAGKGTCCI
Sbjct  492  VGRRRFDIYVQGKLVEKDFDVRRTAGDSPVRAVKREYKANVTENYLEIHLFWAGKGTCCI  551

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P+Q  +GP++SA+    +    + +      K + G I+G+ +G   G+L I + F ++ 
Sbjct  552  PIQGAYGPLISAVSATPDFTPTVANRLPSKGKNKTGTIVGVIVG--VGLLSIFAGFVIFI  609

Query  238  TKKKSPTY  215
             +K+   Y
Sbjct  610  IRKRRKRY  617



>ref|XP_010910216.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130, partial [Elaeis guineensis]
Length=423

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 121/190 (64%), Gaps = 7/190 (4%)
 Frame = -2

Query  778  GQNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS  599
              +Y   S SQ  NT + ELY+TAR+SPSSLRYYG+GL+ G Y ++LHFAE +  D  + 
Sbjct  188  ADDYILRSTSQFSNTREPELYQTARMSPSSLRYYGLGLENGNYTIKLHFAETKFLDPPN-  246

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAG-GSKRALVKKFKANVTNNVLDIHFFWAGKGT  422
            W  +GRR FD+ IQG    +DF++++EAG  S RA+VK+F A VTNN L+IHFFW+GKGT
Sbjct  247  WTSVGRRVFDIYIQGNLKEKDFDIRKEAGEKSFRAIVKEFTAPVTNNFLEIHFFWSGKGT  306

Query  421  CCIPVQSTFGPIVSAIHV-----VQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICS  257
              +P  + +GP +SAI V     +  V+    S  S  KR G ++GI  G+ A VL    
Sbjct  307  GYMPPPAYYGPSISAISVYPFDFIPTVSNKPPSTDSTNKRTGLVVGIAAGAVALVLFTLL  366

Query  256  IFYVWWTKKK  227
            + ++   +++
Sbjct  367  VMFIRRQRRR  376



>ref|XP_010657566.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Vitis vinifera]
Length=881

 Score =   169 bits (427),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  NTLD EL++TARIS  SLRYYG+GL+ G Y + L FAE  + +  +SWK 
Sbjct  334  YTSRSSSQFTNTLDSELFQTARISAGSLRYYGLGLENGNYNLTLQFAETAIVN-SNSWKS  392

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG+ VL+DF++++EAGG S +A+ K+F A V  N ++IH FWAGK TCC+
Sbjct  393  LGRRVFDIYIQGDLVLKDFDIRKEAGGVSFQAVKKEFTAQVLENYIEIHLFWAGKRTCCV  452

Query  412  PVQSTFGPIVSAIHVVQ--EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP +SAI      E  + +++    K   G I+GI +  A G++   ++F V++
Sbjct  453  PAQGTYGPSISAISATPNFEPTVPNTAPNGKKNWTGLIVGIAV--ALGLVCFLAVFSVYY  510

Query  238  --TKKKSP  221
               ++K P
Sbjct  511  FVLRRKKP  518



>ref|XP_010064056.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X2 [Eucalyptus grandis]
Length=994

 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 111/158 (70%), Gaps = 5/158 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A + SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+  +   W+ 
Sbjct  449  YKASTLSQFTNTLDSELFQTARLSASSLRYYGLGLENGNYNVSLRFAEIQI--LNTGWQK  506

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FDV IQG  V++DF++++EAGG+    V+K ++A VT N L+IHFFWAGKGTCC+
Sbjct  507  LGRRLFDVYIQGNLVVKDFDIRKEAGGASLTAVQKVYQAQVTANYLEIHFFWAGKGTCCV  566

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKI  305
            P Q+T+GP+VSAI  V +    + ++   S K   G I
Sbjct  567  PNQATYGPLVSAISAVPDFIPTVSNNPPTSKKDHTGLI  604



>ref|XP_010501248.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Camelina sativa]
Length=1030

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A+S +Q  NT+D EL+++AR+S SSLRYYG+GL+ G Y + L FAEIQ+    +SWKG
Sbjct  481  YIANSMAQFTNTVDSELFQSARLSASSLRYYGLGLENGGYTIRLQFAEIQIVG-SNSWKG  539

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             GRR FD+ +QG  V +DF+V++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCCI
Sbjct  540  TGRRRFDIYVQGRLVEKDFDVRRTAGDSTLRAVQREYKANVSENHLEIHLFWAGKGTCCI  599

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            PVQ  +GP++SA+    +    + +      K R G I+G+ +G   G+L I +   ++ 
Sbjct  600  PVQGAYGPLISAVSATPDFTPTVGNRPPSKGKSRTGTIVGVIVG--VGLLSIFAGVVIFI  657

Query  238  TKKKSPTY  215
             +K+   Y
Sbjct  658  IRKRRKPY  665



>ref|XP_010064055.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X1 [Eucalyptus grandis]
Length=1018

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 111/158 (70%), Gaps = 5/158 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A + SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+  +   W+ 
Sbjct  473  YKASTLSQFTNTLDSELFQTARLSASSLRYYGLGLENGNYNVSLRFAEIQI--LNTGWQK  530

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FDV IQG  V++DF++++EAGG+    V+K ++A VT N L+IHFFWAGKGTCC+
Sbjct  531  LGRRLFDVYIQGNLVVKDFDIRKEAGGASLTAVQKVYQAQVTANYLEIHFFWAGKGTCCV  590

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKI  305
            P Q+T+GP+VSAI  V +    + ++   S K   G I
Sbjct  591  PNQATYGPLVSAISAVPDFIPTVSNNPPTSKKDHTGLI  628



>emb|CDP20736.1| unnamed protein product [Coffea canephora]
Length=1045

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 127/194 (65%), Gaps = 9/194 (5%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y + S SQ  NTLD EL++TAR+S  SLRYYG+GL+ G Y V+L FAE ++ D K SW  
Sbjct  494  YRSSSSSQFTNTLDSELFQTARMSAGSLRYYGLGLENGNYTVKLQFAESEILDTK-SWMS  552

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR+FD+ +QG RV +DF++K+EAGG S  A+ ++F A V+ N L++H FWAGKGTCC+
Sbjct  553  LGRRHFDIYVQGNRVWKDFDIKKEAGGRSFTAVQREFTAYVSENYLEVHLFWAGKGTCCV  612

Query  412  PVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKR-----VGKIIGITLGSAAGVLIICSIFY  248
            P Q ++GP +SAI    + N   S++   +K+      G I+GI +    G+    S+F 
Sbjct  613  PTQGSYGPFISAISATPDFNPSVSNNPPTRKKKSTGSTGLIVGIVV--PIGIASFLSVFA  670

Query  247  VWWTKKKSPTYKGF  206
            V++  ++   ++ F
Sbjct  671  VYFFVQRRRRHQAF  684



>gb|KDO61621.1| hypothetical protein CISIN_1g001658mg [Citrus sinensis]
Length=1036

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 103/138 (75%), Gaps = 2/138 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y + S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAE+ + D  + W+ 
Sbjct  482  YKSSSLSQFTNTLDSELFQTARLSASSLRYYGLGLENGNYTVLLQFAEMAILDT-NRWES  540

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FDV IQG RVL+DF++K+EAGG SKRA+ ++ K  V+ N L+IH FWAGKGTCC+
Sbjct  541  LGRRVFDVYIQGNRVLKDFDIKREAGGVSKRAIQREIKTRVSENYLEIHLFWAGKGTCCV  600

Query  412  PVQSTFGPIVSAIHVVQE  359
            P Q T+GP +SAI V  +
Sbjct  601  PAQGTYGPSISAIRVTPD  618



>gb|KJB14002.1| hypothetical protein B456_002G105800 [Gossypium raimondii]
Length=1031

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 103/138 (75%), Gaps = 2/138 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y   S SQ  NTLD EL++TARIS SSLRYYG+GL+ G Y V L FAE Q+ +  + W+G
Sbjct  482  YIITSGSQFTNTLDSELFQTARISASSLRYYGLGLENGNYTVRLEFAETQIVE-TNRWEG  540

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG RVL DF++++EAGG S+RA+ ++F A V+ N L++H FWAGKGTCC+
Sbjct  541  LGRRVFDIYIQGSRVLEDFDIRREAGGVSRRAVTRQFTAVVSENYLEVHLFWAGKGTCCV  600

Query  412  PVQSTFGPIVSAIHVVQE  359
            PVQ T+GP +SAI    +
Sbjct  601  PVQGTYGPSISAISATPD  618



>ref|XP_002267129.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Vitis vinifera]
 emb|CBI20015.3| unnamed protein product [Vitis vinifera]
Length=1031

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  NTLD EL++TARIS  SLRYYG+GL+ G Y + L FAE  + +  +SWK 
Sbjct  484  YTSRSSSQFTNTLDSELFQTARISAGSLRYYGLGLENGNYNLTLQFAETAIVN-SNSWKS  542

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG+ VL+DF++++EAGG S +A+ K+F A V  N ++IH FWAGK TCC+
Sbjct  543  LGRRVFDIYIQGDLVLKDFDIRKEAGGVSFQAVKKEFTAQVLENYIEIHLFWAGKRTCCV  602

Query  412  PVQSTFGPIVSAIHVVQ--EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP +SAI      E  + +++    K   G I+GI +  A G++   ++F V++
Sbjct  603  PAQGTYGPSISAISATPNFEPTVPNTAPNGKKNWTGLIVGIAV--ALGLVCFLAVFSVYY  660

Query  238  --TKKKSP  221
               ++K P
Sbjct  661  FVLRRKKP  668



>ref|XP_010657565.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Vitis vinifera]
Length=993

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  NTLD EL++TARIS  SLRYYG+GL+ G Y + L FAE  + +  +SWK 
Sbjct  446  YTSRSSSQFTNTLDSELFQTARISAGSLRYYGLGLENGNYNLTLQFAETAIVN-SNSWKS  504

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG+ VL+DF++++EAGG S +A+ K+F A V  N ++IH FWAGK TCC+
Sbjct  505  LGRRVFDIYIQGDLVLKDFDIRKEAGGVSFQAVKKEFTAQVLENYIEIHLFWAGKRTCCV  564

Query  412  PVQSTFGPIVSAIHVVQ--EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP +SAI      E  + +++    K   G I+GI +  A G++   ++F V++
Sbjct  565  PAQGTYGPSISAISATPNFEPTVPNTAPNGKKNWTGLIVGIAV--ALGLVCFLAVFSVYY  622

Query  238  --TKKKSP  221
               ++K P
Sbjct  623  FVLRRKKP  630



>ref|XP_007133315.1| hypothetical protein PHAVU_011G169300g [Phaseolus vulgaris]
 gb|ESW05309.1| hypothetical protein PHAVU_011G169300g [Phaseolus vulgaris]
Length=1030

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            +T    +Q  NT++ EL++TAR+SPSSLRYYG+GL+ G Y + L FAE  ++D    W+ 
Sbjct  477  FTKSVTNQFTNTMNSELFQTARLSPSSLRYYGLGLENGFYNITLQFAETAIEDSTTKWES  536

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG   L+DF++++EAGG S R++ K+F+  V+ N LDIH FWAGKGTCCI
Sbjct  537  LGRRVFDIYIQGNLFLKDFDIQKEAGGISFRSVQKQFRFEVSENYLDIHLFWAGKGTCCI  596

Query  412  PVQSTFGPIVSAIHVVQE  359
            P Q TFGP++ AIH + +
Sbjct  597  PNQGTFGPLIQAIHAIPD  614



>ref|XP_010064059.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=1029

 Score =   168 bits (425),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 78/138 (57%), Positives = 103/138 (75%), Gaps = 3/138 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+ + +  WK 
Sbjct  473  YNASSLSQFTNTLDSELFQTARVSASSLRYYGLGLQNGNYNVTLQFAEIQIQNTE--WKR  530

Query  589  LGRRYFDVSIQGERVLRDFNVKQEA-GGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  V++DF++++EA G S  A+   ++A VT N L+IHFFWAGKGTCC+
Sbjct  531  LGRRLFDIYIQGNLVVKDFDIRKEADGASFTAVPTMYQARVTANYLEIHFFWAGKGTCCV  590

Query  412  PVQSTFGPIVSAIHVVQE  359
            P Q+T+GP++SAI  V +
Sbjct  591  PNQATYGPLISAISAVPD  608



>gb|AAF02836.1|AC009894_7 Very similar to receptor-like serine/threonine kinase [Arabidopsis 
thaliana]
Length=858

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NT+D EL+++AR+S SSLRYYG+GL+ G Y V L FAE+Q++   +SWKG
Sbjct  309  YIATSLAQFINTMDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEVQIEG-SNSWKG  367

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR F++ +QG  V +DF++++ AGGS  RA+ +++K NV+ N L++H FWAGKGTCCI
Sbjct  368  IGRRRFNIYVQGRLVEKDFDIRRTAGGSSVRAVQREYKTNVSENHLEVHLFWAGKGTCCI  427

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P+Q  +GP+++A+    +    + +      K R G I+G+ +G   G+L I +   +  
Sbjct  428  PIQGAYGPLIAAVSATPDFTPTVANRPPSKGKSRTGTIVGVIVG--VGLLSIFAGVVILV  485

Query  238  TKKKSPTY  215
             +K+   Y
Sbjct  486  IRKRRKPY  493



>gb|AFW59459.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=550

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 121/186 (65%), Gaps = 6/186 (3%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S  Q  NTLD EL++TAR+SPSSLRYYG+GL+ G Y V L FAE   +D   +WK
Sbjct  7    SYIIYSLHQFQNTLDSELFQTARMSPSSLRYYGIGLENGNYTVTLQFAEFDFED-SQTWK  65

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             +GRR FD+ +QGER  ++F++++ +GG S  A+ K++   VT N L+IH FWAGKGTCC
Sbjct  66   SVGRRVFDIYLQGERKEKNFDIRKASGGKSYTAVEKQYIVPVTRNFLEIHLFWAGKGTCC  125

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYV  245
            IP Q  +GP +SA+         + +S+   +  + G I+G+ +G+A  GVL +  I  +
Sbjct  126  IPAQGYYGPAISALSATPNFTPTVRNSAQKKNSSKTGVIVGVVIGAAVLGVLALAGIC-M  184

Query  244  WWTKKK  227
            W  K++
Sbjct  185  WRQKRR  190



>gb|KFK44732.1| hypothetical protein AALP_AA1G295500 [Arabis alpina]
Length=1012

 Score =   167 bits (424),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 122/187 (65%), Gaps = 4/187 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  +S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAE+Q+    ++W+G
Sbjct  471  YIVNSQSQFSNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEVQILG-SNTWRG  529

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  V +DF++++ A  S  RA+ +++K NV+ N L+IH FW GKGTCCI
Sbjct  530  LGRRLFDIYVQGRLVEKDFDIRRAANDSSLRAVQREYKVNVSKNYLEIHLFWTGKGTCCI  589

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P+Q  +GP++SA+    +    + +    + K R G I+G+ LG     +  C++ ++  
Sbjct  590  PIQGVYGPLISAVSAKSDFKPTVSNRPPSNGKNRTGTIVGVILGVGLLSIFACAVIFIIR  649

Query  238  TKKKSPT  218
             ++K  T
Sbjct  650  KRRKPYT  656



>ref|XP_010064058.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Eucalyptus grandis]
Length=1029

 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 103/138 (75%), Gaps = 3/138 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+ + +  WK 
Sbjct  473  YNASSLSQFTNTLDSELFQTARVSASSLRYYGLGLENGNYNVTLQFAEIQIQNTE--WKR  530

Query  589  LGRRYFDVSIQGERVLRDFNVKQEA-GGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  V +DF++++EA G S  A+ K ++A VT N L+IHFFWAGKGTCC+
Sbjct  531  LGRRLFDIYIQGNLVAKDFDIRKEADGASFTAVPKLYQARVTANYLEIHFFWAGKGTCCV  590

Query  412  PVQSTFGPIVSAIHVVQE  359
            P Q+T+GP++SAI  V +
Sbjct  591  PKQATYGPLISAISAVPD  608



>gb|KJB69988.1| hypothetical protein B456_011G052400 [Gossypium raimondii]
Length=858

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 118/188 (63%), Gaps = 11/188 (6%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWK  593
            +  ++ +Q+ +T   ELY+T+R+SP SLRYYG+GL+ G Y V L FAE         SWK
Sbjct  444  FVQNTLAQVKSTNTPELYQTSRLSPGSLRYYGLGLQNGPYTVRLFFAETGFPGRTTQSWK  503

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             L RR FDV IQG R LRDF++ + AGG +RA+++ F ANVT N L+IH FWAGKGTCC 
Sbjct  504  SLARRVFDVYIQGTRRLRDFDISKAAGGVERAIIRNFTANVTENHLEIHLFWAGKGTCCT  563

Query  412  PVQSTFGPIVSAIHVVQEVNLDDSSDG------SDKKRVGKIIGITLGSAAGVLIICSIF  251
            P+Q  +GP +SAI VV   N   +  G       +K  VG I+G+T+   A   I+  +F
Sbjct  564  PIQGYYGPSISAISVVP--NFKPNVSGIPLGIPEEKNHVGLIVGVTVPIVALAFIL--VF  619

Query  250  YVWWTKKK  227
             + + K++
Sbjct  620  VIIYLKRQ  627



>gb|KJB69989.1| hypothetical protein B456_011G052400 [Gossypium raimondii]
Length=861

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 118/188 (63%), Gaps = 11/188 (6%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWK  593
            +  ++ +Q+ +T   ELY+T+R+SP SLRYYG+GL+ G Y V L FAE         SWK
Sbjct  444  FVQNTLAQVKSTNTPELYQTSRLSPGSLRYYGLGLQNGPYTVRLFFAETGFPGRTTQSWK  503

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             L RR FDV IQG R LRDF++ + AGG +RA+++ F ANVT N L+IH FWAGKGTCC 
Sbjct  504  SLARRVFDVYIQGTRRLRDFDISKAAGGVERAIIRNFTANVTENHLEIHLFWAGKGTCCT  563

Query  412  PVQSTFGPIVSAIHVVQEVNLDDSSDG------SDKKRVGKIIGITLGSAAGVLIICSIF  251
            P+Q  +GP +SAI VV   N   +  G       +K  VG I+G+T+   A   I+  +F
Sbjct  564  PIQGYYGPSISAISVVP--NFKPNVSGIPLGIPEEKNHVGLIVGVTVPIVALAFIL--VF  619

Query  250  YVWWTKKK  227
             + + K++
Sbjct  620  VIIYLKRQ  627



>ref|XP_002964542.1| hypothetical protein SELMODRAFT_438852, partial [Selaginella 
moellendorffii]
 gb|EFJ34875.1| hypothetical protein SELMODRAFT_438852, partial [Selaginella 
moellendorffii]
Length=689

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = -2

Query  772  NYTAHSFSQIPN-------TLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMD  614
            ++  ++F+ +P        T D  LY+TAR SP+SL+Y+G+G+  G Y+V+LHFAEI + 
Sbjct  434  DFNGNTFNSVPTAATRVTGTRDSSLYQTARASPTSLKYFGLGMVNGPYQVDLHFAEIVIQ  493

Query  613  DIKDSWKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWA  434
            D    W GLGRR+FDV IQG RVL+DF+++ EA GS  A+V+ F A V+NNVL+IH  W 
Sbjct  494  DDSSGWTGLGRRFFDVYIQGSRVLQDFDIRAEANGSYIAIVRPFPAQVSNNVLEIHLLWR  553

Query  433  GKGTCCIPVQSTFGPIVSAIHVVQEVN  353
            GKGTCC P   +FGP++SAI V  E +
Sbjct  554  GKGTCCSPAPLSFGPLISAIRVRPEFD  580



>ref|XP_008361649.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130, partial [Malus domestica]
Length=620

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 112/167 (67%), Gaps = 8/167 (5%)
 Frame = -2

Query  724  ELYKTARISPSSLRYYGVGLKKGIYRVELHFAE-IQMDDIKDSWKGLGRRYFDVSIQGER  548
            EL++T+R+SP SLRYYG+GL+ G Y V LHFAE +  +     W+ LGRR FD+ IQG R
Sbjct  366  ELFQTSRMSPGSLRYYGLGLENGPYTVTLHFAETVYENHTSQKWESLGRRVFDIYIQGTR  425

Query  547  VLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHV  368
              +DF++ +EAGG  RA+V++F  +V+ N L+IH FWAGKGTCCIP Q  +GP+++A+HV
Sbjct  426  RTKDFDISKEAGGVSRAVVRRFNVSVSENYLEIHLFWAGKGTCCIPKQGDYGPLIAAVHV  485

Query  367  VQEVN-----LDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFYV  245
              +       L  ++ G  K R G I+GI +    A +L+I +I Y+
Sbjct  486  ASDFTPTVSELPPTTPG-KKSRTGLIVGIAIPVGVASLLLIFAIJYM  531



>ref|XP_010462494.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Camelina sativa]
 ref|XP_010462495.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Camelina sativa]
Length=1017

 Score =   167 bits (423),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  HS ++ PNT D EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  479  YIDHSATRFPNTSDSELFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  537

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  V +DF++ + A GS  R   + +KANV+ N L+IH FWAGKGTCCI
Sbjct  538  LGRRVFDIYVQGRLVEKDFDIHRTANGSSIRVNQRVYKANVSENYLEIHLFWAGKGTCCI  597

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYVW  242
            P Q T+GP+VSAI    +    + +      KK++G I+G  +G+    +L+I  I ++ 
Sbjct  598  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKKIGIIVGAIVGAGMLSILVIAIILFIR  657

Query  241  WTKKKS  224
              +K++
Sbjct  658  RKRKRA  663



>ref|XP_010462496.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Camelina sativa]
Length=993

 Score =   167 bits (423),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  HS ++ PNT D EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  455  YIDHSATRFPNTSDSELFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  513

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG  V +DF++ + A GS  R   + +KANV+ N L+IH FWAGKGTCCI
Sbjct  514  LGRRVFDIYVQGRLVEKDFDIHRTANGSSIRVNQRVYKANVSENYLEIHLFWAGKGTCCI  573

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYVW  242
            P Q T+GP+VSAI    +    + +      KK++G I+G  +G+    +L+I  I ++ 
Sbjct  574  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKKIGIIVGAIVGAGMLSILVIAIILFIR  633

Query  241  WTKKKS  224
              +K++
Sbjct  634  RKRKRA  639



>ref|NP_176008.4| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AEE33346.1| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1047

 Score =   167 bits (423),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 121/177 (68%), Gaps = 9/177 (5%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NT+D EL+++AR+S SSLRYYG+GL+ G Y V L FAE+Q++   +SWKG
Sbjct  498  YIATSLAQFINTMDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEVQIEG-SNSWKG  556

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR F++ +QG  V +DF++++ AGGS  RA+ +++K NV+ N L++H FWAGKGTCCI
Sbjct  557  IGRRRFNIYVQGRLVEKDFDIRRTAGGSSVRAVQREYKTNVSENHLEVHLFWAGKGTCCI  616

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSA-----AGVLII  263
            P+Q  +GP+++A+    +    + +      K R G I+G+ +G       AGV+I+
Sbjct  617  PIQGAYGPLIAAVSATPDFTPTVANRPPSKGKSRTGTIVGVIVGVGLLSIFAGVVIL  673



>ref|NP_564709.2| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 sp|C0LGH3.2|Y5614_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g56140; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33348.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1033

 Score =   167 bits (423),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y + S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++W+
Sbjct  479  YISTSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWR  538

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCC
Sbjct  539  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQREYKANVSQNHLEIHLFWAGKGTCC  598

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GP++SA+    +    + +      K   G I+G+ +G   G+L I S   ++
Sbjct  599  IPIQGAYGPLISAVGATPDFTPTVGNRPPSKGKSMTGTIVGVIVG--VGLLSIISGVVIF  656

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  657  IIRKRRKRY  665



>gb|AAF02840.1|AC009894_11 Similar to serine/threonine kinases [Arabidopsis thaliana]
Length=1086

 Score =   167 bits (423),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y + S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++W+
Sbjct  532  YISTSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWR  591

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCC
Sbjct  592  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQREYKANVSQNHLEIHLFWAGKGTCC  651

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GP++SA+    +    + +      K   G I+G+ +G   G+L I S   ++
Sbjct  652  IPIQGAYGPLISAVGATPDFTPTVGNRPPSKGKSMTGTIVGVIVG--VGLLSIISGVVIF  709

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  710  IIRKRRKRY  718



>ref|XP_010908219.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Elaeis guineensis]
Length=900

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 120/188 (64%), Gaps = 7/188 (4%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y   S SQ  NT + ELY+TARISPSSLRYYG+GL+ G Y ++LHFAE ++ D+ + W 
Sbjct  372  DYILKSTSQFSNTQESELYQTARISPSSLRYYGLGLENGNYTIKLHFAETEILDLPN-WT  430

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAG-GSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             +GRR FD+ IQG    ++F+++++AG  S RA+VK+F A VTNN L+IHFFW+GKGTCC
Sbjct  431  SVGRRVFDIYIQGNLKEKNFDIRKKAGEKSFRAIVKEFTAPVTNNFLEIHFFWSGKGTCC  490

Query  415  IPVQSTFGPIVSAIHV-----VQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIF  251
             P    +GP +SAI V        V+    S  S  KR   I+GI  G+ A VL    + 
Sbjct  491  XPTPDYYGPSISAISVYSFDFTPTVSNKPPSTDSTNKRTDLIVGIAAGAVALVLFTLLVM  550

Query  250  YVWWTKKK  227
             +   +++
Sbjct  551  LICRQRRR  558



>ref|NP_176009.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
 sp|C0LGH2.2|Y1561_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g56130; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33347.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis 
thaliana]
Length=1032

 Score =   166 bits (421),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 123/189 (65%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S SQ  NTLD EL+++AR+S SS+RYYG+GL+ G Y V L FAEIQ +     +WK
Sbjct  480  YIATSQSQFVNTLDSELFQSARLSASSVRYYGLGLENGGYTVTLQFAEIQILGSTSTTWK  539

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ + +KANV+ N L++H FWAGKGTCC
Sbjct  540  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQRVYKANVSENHLEVHLFWAGKGTCC  599

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GP++SA+    +    + +      K R G I+G+ +G   G+L I +   ++
Sbjct  600  IPIQGAYGPLISAVSATPDFTPTVANKPPSKGKNRTGTIVGVIVG--VGLLSILAGVVMF  657

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  658  TIRKRRKRY  666



>ref|XP_010480195.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Camelina sativa]
Length=1017

 Score =   166 bits (421),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  HS ++ PNT D EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  479  YIDHSATRFPNTSDSELFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  537

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++ + A GS  R   + +KANV+ N L+IH FWAGKGTCCI
Sbjct  538  LGRRLFDIYVQGKLVEKDFDIHKTANGSSIRVNQRVYKANVSENYLEIHLFWAGKGTCCI  597

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYVW  242
            P Q T+GP+VSAI    +    + +      KK +G I+G  +G+    +L+I  I ++ 
Sbjct  598  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKTIGIIVGAIVGAGMLSILVIAIILFIR  657

Query  241  WTKKKS  224
              +K++
Sbjct  658  RKRKRA  663



>gb|AAF02838.1|AC009894_9 Similar to serine/threonine kinases [Arabidopsis thaliana]
Length=1029

 Score =   166 bits (421),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 123/189 (65%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S SQ  NTLD EL+++AR+S SS+RYYG+GL+ G Y V L FAEIQ +     +WK
Sbjct  477  YIATSQSQFVNTLDSELFQSARLSASSVRYYGLGLENGGYTVTLQFAEIQILGSTSTTWK  536

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ + +KANV+ N L++H FWAGKGTCC
Sbjct  537  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQRVYKANVSENHLEVHLFWAGKGTCC  596

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GP++SA+    +    + +      K R G I+G+ +G   G+L I +   ++
Sbjct  597  IPIQGAYGPLISAVSATPDFTPTVANKPPSKGKNRTGTIVGVIVG--VGLLSILAGVVMF  654

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  655  TIRKRRKRY  663



>ref|XP_002894561.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70820.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=900

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 124/186 (67%), Gaps = 9/186 (5%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y   S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ+    +SWKG
Sbjct  461  YRETSQSQFINTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQIQG-SNSWKG  519

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG  V +DF++++ AGGS  RA+ +++K NV+ N L++H FWAGKGTCCI
Sbjct  520  IGRRRFDIYVQGRLVEKDFDIRRTAGGSSVRAVQREYKTNVSENHLEVHLFWAGKGTCCI  579

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICS---IFY  248
            P+Q  +GP++SA+    +    + +     +K   G I+G+ +  A G+L I +   IF 
Sbjct  580  PIQGAYGPLISAVSATPDFTPTVANRPPSKEKNMTGTIVGVIV--AVGLLSILAGVVIFI  637

Query  247  VWWTKK  230
            +  ++K
Sbjct  638  ILKSRK  643



>ref|XP_009361862.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Pyrus x bretschneideri]
Length=640

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 118/183 (64%), Gaps = 5/183 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  NTL+ EL++TAR+S SSLRYYG+GL+ G Y V L FAE  + D   +WK 
Sbjct  233  YTSFSSSQFKNTLNSELFQTARLSASSLRYYGLGLETGNYTVSLEFAETAILD-STTWKS  291

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
            LGRR FD+ IQG    +D ++++EAG   +A+ K+FK  V+ N L+IH F AGKGTCCIP
Sbjct  292  LGRRVFDIYIQGNLFSKDLDIRKEAGAYFQAIQKEFKVQVSENYLEIHLFRAGKGTCCIP  351

Query  409  VQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWT  236
             Q T+GP +SAI    +    + +++  S K R G I+G  +G   G+L    +FY++  
Sbjct  352  GQGTYGPAISAIRATPDFIPTVSNNAAASKKNRTGLIVGFVVG--GGILSGVVVFYIFQR  409

Query  235  KKK  227
            + +
Sbjct  410  RNR  412



>gb|KEH19476.1| LRR receptor-like kinase, putative [Medicago truncatula]
Length=781

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 116/173 (67%), Gaps = 5/173 (3%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYF  572
            +Q   T++ EL++ AR+S SSLRYYG+GL+ G Y + L FAE  + D   +WK LGRR F
Sbjct  484  NQFTGTVNSELFQFARLSASSLRYYGLGLENGFYNITLQFAETAILD-STTWKSLGRRVF  542

Query  571  DVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            D+ IQG RVL+DF++++EAGG S RA+ K+F+  V  N +++H FWAGKGTCCIP Q T+
Sbjct  543  DIYIQGTRVLKDFDIQREAGGVSYRAVQKQFRFEVKENYVEVHLFWAGKGTCCIPGQGTY  602

Query  394  GPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFYV  245
            GP++ AI    +   ++ +    S K R G IIGI +G  A   L + +IFY+
Sbjct  603  GPLIQAISATPDFIPSVSNKPPSSKKNRAGLIIGIVVGVGAVCFLAVFAIFYI  655



>ref|XP_009106802.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Brassica rapa]
Length=964

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 122/189 (65%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S SQ   TLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++W+
Sbjct  409  YIATSQSQFIGTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWR  468

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V  DF+V++ AG S  RA+ + +KANVT N L+IH FWAGKGTCC
Sbjct  469  GLGRRRFDIYVQGRLVETDFDVRRTAGDSTVRAVQRVYKANVTENYLEIHLFWAGKGTCC  528

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GP++SA+    +    + +      K R G I+G+ +G   G+L I +   ++
Sbjct  529  IPIQGAYGPLISAVSAKSDFTPTVGNRPPSKGKNRTGTIVGVIVG--LGLLSILAGVAIF  586

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  587  IIRKRRKRY  595



>ref|XP_010064741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Eucalyptus grandis]
Length=1028

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NT D EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+++    WK 
Sbjct  474  YYASSLSQFANTSDSELFQTARVSASSLRYYGLGLENGNYNVTLQFAEIQVENT--GWKH  531

Query  589  LGRRYFDVSIQGERVLRDFNVKQEA-GGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  V +DF++++EA G S  A++K ++A VT N L+IHFFWAGKGTCC+
Sbjct  532  LGRRLFDIYIQGNLVAKDFDIQKEADGASFTAVLKLYQARVTANYLEIHFFWAGKGTCCV  591

Query  412  PVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKR  317
            P Q+T+GP++SAI+ V +     S+    +K+
Sbjct  592  PNQATYGPLISAINAVPDFKPTVSNKPPTRKK  623



>ref|XP_009105697.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Brassica rapa]
Length=639

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 113/164 (69%), Gaps = 10/164 (6%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQM    ++W+G
Sbjct  480  YIATSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTIQFAEIQMIG-SNTWRG  538

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            + RR FD+ +QG+ V +DF+V+  AGGS  RA+ +++KANV+ N L++H FWAGKGTCCI
Sbjct  539  VARRRFDIYVQGKLVEKDFDVRGTAGGSNLRAVQREYKANVSENYLEVHLFWAGKGTCCI  598

Query  412  PVQSTFGPIVSAIHVVQE-----VNLDDSSDGSDKKRVGKIIGI  296
            P+Q  +GP+VSA+    +     VN+  S     K R G I+ +
Sbjct  599  PIQGAYGPLVSAVSATPDFTPTVVNIPPS---KGKNRTGTIVSV  639



>gb|KCW68790.1| hypothetical protein EUGRSUZ_F023912, partial [Eucalyptus grandis]
Length=992

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NT D EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+++    WK 
Sbjct  438  YYASSLSQFANTSDSELFQTARVSASSLRYYGLGLENGNYNVTLQFAEIQVENT--GWKH  495

Query  589  LGRRYFDVSIQGERVLRDFNVKQEA-GGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  V +DF++++EA G S  A++K ++A VT N L+IHFFWAGKGTCC+
Sbjct  496  LGRRLFDIYIQGNLVAKDFDIQKEADGASFTAVLKLYQARVTANYLEIHFFWAGKGTCCV  555

Query  412  PVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKR  317
            P Q+T+GP++SAI+ V +     S+    +K+
Sbjct  556  PNQATYGPLISAINAVPDFKPTVSNKPPTRKK  587



>ref|XP_010501252.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Camelina sativa]
Length=910

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  HS ++ PNT D E++++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  372  YIDHSATRFPNTSDSEIFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  430

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++ + A GS  R   + +KANV+ N L+IH FWAGKGTCCI
Sbjct  431  LGRRLFDIYVQGKLVEKDFDIHRAANGSSIRVNQRVYKANVSENYLEIHLFWAGKGTCCI  490

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYVW  242
            P Q T+GP+VSAI    +    + +      KK +G I+G  +G+    +L+I  I ++ 
Sbjct  491  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKTIGIIVGAIVGAGMLSILVIAIILFIR  550

Query  241  WTKKKS  224
              +K++
Sbjct  551  RKRKRA  556



>ref|XP_002993125.1| hypothetical protein SELMODRAFT_431263 [Selaginella moellendorffii]
 gb|EFJ05765.1| hypothetical protein SELMODRAFT_431263 [Selaginella moellendorffii]
Length=724

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 100/142 (70%), Gaps = 7/142 (5%)
 Frame = -2

Query  772  NYTAHSFSQIPN-------TLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMD  614
            ++  ++F+ +P        T D  LY+TAR SP+SL+Y+G+G+  G Y+V+LHFAEI + 
Sbjct  434  DFNGNTFNSVPTAATRVTGTRDSSLYQTARASPTSLKYFGLGMVNGPYQVDLHFAEIVIQ  493

Query  613  DIKDSWKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWA  434
            D    W GLGRR+FDV IQG RVL+DF+++ EA GS  A+V+ F A V+NNVL+IH  W 
Sbjct  494  DDSSGWTGLGRRFFDVYIQGSRVLQDFDIRAEANGSYIAIVRPFPAQVSNNVLEIHLLWR  553

Query  433  GKGTCCIPVQSTFGPIVSAIHV  368
            G+GTCC P   +FGP++SAI V
Sbjct  554  GRGTCCSPAPLSFGPLISAIRV  575



>ref|XP_009106801.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Brassica rapa]
Length=1033

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 122/189 (65%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S SQ   TLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++W+
Sbjct  478  YIATSQSQFIGTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWR  537

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V  DF+V++ AG S  RA+ + +KANVT N L+IH FWAGKGTCC
Sbjct  538  GLGRRRFDIYVQGRLVETDFDVRRTAGDSTVRAVQRVYKANVTENYLEIHLFWAGKGTCC  597

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GP++SA+    +    + +      K R G I+G+ +G   G+L I +   ++
Sbjct  598  IPIQGAYGPLISAVSAKSDFTPTVGNRPPSKGKNRTGTIVGVIVG--LGLLSILAGVAIF  655

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  656  IIRKRRKRY  664



>emb|CDY42407.1| BnaA08g00070D [Brassica napus]
Length=1033

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 122/189 (65%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S SQ   TLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++W+
Sbjct  478  YIATSQSQFIGTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWR  537

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V  DF+V++ AG S  RA+ + +KANVT N L+IH FWAGKGTCC
Sbjct  538  GLGRRRFDIYVQGRLVETDFDVRRTAGDSTVRAVQRVYKANVTENYLEIHLFWAGKGTCC  597

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GP++SA+    +    + +      K R G I+G+ +G   G+L I +   ++
Sbjct  598  IPIQGAYGPLISAVSAKSDFTPTVGNRPPSKGKNRTGTIVGVIVG--LGLLSILAGVAIF  655

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  656  IIRKRRKRY  664



>gb|AAG50909.1|AC069159_10 receptor protein kinase, putative [Arabidopsis thaliana]
Length=2062

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769   YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
             Y + S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++W+
Sbjct  1508  YISTSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWR  1567

Query  592   GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             GLGRR FD+ +QG  V +DF+V++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCC
Sbjct  1568  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQREYKANVSQNHLEIHLFWAGKGTCC  1627

Query  415   IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
             IP+Q  +GP++SA+    +    + +      K   G I+G+ +G   G+L I S   ++
Sbjct  1628  IPIQGAYGPLISAVGATPDFTPTVGNRPPSKGKSMTGTIVGVIVG--VGLLSIISGVVIF  1685

Query  241   WTKKKSPTY  215
               +K+   Y
Sbjct  1686  IIRKRRKRY  1694


 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 121/184 (66%), Gaps = 6/184 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NT D EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  449  YIALSATQFANTSDSELFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  507

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++++ A GS  R + + +KANV+ N L++H FWAGKGTCCI
Sbjct  508  LGRRIFDIYVQGKLVEKDFDMQKAANGSSIRVIQRVYKANVSENYLEVHLFWAGKGTCCI  567

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP+VSAI    +    + +      KK +  I+G  +G  AG+L I  I  + +
Sbjct  568  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKNIVIIVGAIVG--AGMLCILVIAILLF  625

Query  238  TKKK  227
             ++K
Sbjct  626  IRRK  629



>ref|XP_007214107.1| hypothetical protein PRUPE_ppa017049mg [Prunus persica]
 gb|EMJ15306.1| hypothetical protein PRUPE_ppa017049mg [Prunus persica]
Length=1053

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 128/186 (69%), Gaps = 4/186 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  NTLD E+++TAR+S SSLRYYG+GL+ G Y V L FAE  + D   +WK 
Sbjct  498  YTSFSLSQFKNTLDSEIFQTARLSASSLRYYGLGLENGNYTVTLQFAETAILD-STTWKS  556

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
            LG+R FD+ IQG   L+DF++++EAG S +A+ K++ A V+ N L+IH FWAGKGTCCIP
Sbjct  557  LGKRVFDIYIQGNLFLKDFDIRKEAGASFQAVQKEYAAQVSENYLEIHLFWAGKGTCCIP  616

Query  409  VQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWT  236
             Q T+GP++SAI    +    + ++   S K R G I+GI +G    +L++ +IFY++  
Sbjct  617  GQGTYGPVISAISATPDFIPTVSNNPTTSKKNRTGLIVGIIVGGGVLILMV-AIFYIFQR  675

Query  235  KKKSPT  218
            +K++ T
Sbjct  676  RKRTNT  681



>ref|XP_002894562.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70821.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1031

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 122/189 (65%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y   S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +     +WK
Sbjct  479  YIMTSQSQFINTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSSTWK  538

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ + +KANV+ N L++H FWAGKGTCC
Sbjct  539  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTFRAVQRVYKANVSENHLEVHLFWAGKGTCC  598

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GP++SA+    +    + +      K R G I+G+ +G   G+L I +   ++
Sbjct  599  IPIQGAYGPLISAVSATPDFTPTVVNRPPSKGKNRTGTIVGVIVG--VGLLTILAGVVMF  656

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  657  IIRKRRNRY  665



>ref|XP_006390899.1| hypothetical protein EUTSA_v10018064mg [Eutrema salsugineum]
 gb|ESQ28185.1| hypothetical protein EUTSA_v10018064mg [Eutrema salsugineum]
Length=1023

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSW  596
             NY   S SQ  NT D EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ++   +SW
Sbjct  478  NNYIVTSLSQFTNTSDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQIEG-SNSW  536

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTC  419
            KG+GRR FD+ +QG  V +DF++++ AGGS  RA+ +++KANV+ N L+IH FWAGKGTC
Sbjct  537  KGVGRRRFDIYVQGRLVEKDFDIRRTAGGSSIRAVQREYKANVSENYLEIHLFWAGKGTC  596

Query  418  CIPVQSTFGPIVSAIHVVQE  359
            CIP+Q  +GP++SA+    +
Sbjct  597  CIPIQGAYGPLISAVSATPD  616



>gb|KDP29558.1| hypothetical protein JCGZ_19271 [Jatropha curcas]
Length=326

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 100/139 (72%), Gaps = 2/139 (1%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            N+T    S+   TLD EL++T R+S SSLRYYG+GL+ G Y ++L FAE   +D + +W+
Sbjct  64   NFTGSYSSEFTYTLDSELFQTGRLSASSLRYYGLGLQNGNYNIKLEFAETAFEDGR-TWR  122

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             LGRR FD+ IQG RV++DF++++ AGG SKRA+ + F A V+ N L+IH FWAGKGTCC
Sbjct  123  SLGRRVFDIYIQGNRVVKDFDIRKAAGGISKRAVGQNFTAQVSENYLEIHLFWAGKGTCC  182

Query  415  IPVQSTFGPIVSAIHVVQE  359
            IP Q T+GP +SAI    +
Sbjct  183  IPYQGTYGPSISAISATSD  201



>emb|CDY11604.1| BnaC06g31350D [Brassica napus]
Length=639

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 112/164 (68%), Gaps = 10/164 (6%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G+Y V + FAEIQM    ++W+G
Sbjct  480  YIAISQSQFVNTLDSELFQSARLSASSLRYYGLGLENGVYTVTIQFAEIQMIG-SNTWRG  538

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            + RR FD+ +QG  V +DF+V+  AGG   RA+ +++KANV+ N L++H FWAGKGTCCI
Sbjct  539  VARRRFDIYVQGRLVEKDFDVRGTAGGPNLRAVQREYKANVSENYLEVHLFWAGKGTCCI  598

Query  412  PVQSTFGPIVSAIHVVQE-----VNLDDSSDGSDKKRVGKIIGI  296
            P+Q  +GP+VSA+    +     VN+  S     K R G ++ +
Sbjct  599  PIQGAYGPLVSAVSATPDFTPTVVNIPPS---KGKNRTGTVVSV  639



>emb|CAN83900.1| hypothetical protein VITISV_034202 [Vitis vinifera]
Length=946

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 121/188 (64%), Gaps = 8/188 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  N LD EL++TARIS  SLRYYG+GL+ G Y + L FAE  + +  +SWK 
Sbjct  443  YTSTSSSQFTNILDSELFQTARISAGSLRYYGLGLENGNYNLTLQFAETAIVN-SNSWKS  501

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAG-GSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LG R FDV IQG  VL+DF +++EAG  S RA+ KKFKA V  N ++IH FWAGKGTCC+
Sbjct  502  LGMRVFDVYIQGNLVLKDFYIRKEAGEASFRAVKKKFKAQVLENYIEIHLFWAGKGTCCV  561

Query  412  PVQSTFGPIVSAIHVVQ--EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P + T+GP +S I      E  + +++    K R G ++ + +G   G + I S+F V++
Sbjct  562  PARGTYGPSISQISATLDFEPTVPNTAPNGKKNRTGLMVVLAVG--VGFVCILSVFAVYY  619

Query  238  --TKKKSP  221
               ++K P
Sbjct  620  FVLRRKKP  627



>ref|XP_010501250.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Camelina sativa]
Length=1017

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  HS ++ PNT D E++++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  479  YIDHSATRFPNTSDSEIFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  537

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++ + A GS  R   + +KANV+ N L+IH FWAGKGTCCI
Sbjct  538  LGRRLFDIYVQGKLVEKDFDIHRAANGSSIRVNQRVYKANVSENYLEIHLFWAGKGTCCI  597

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYVW  242
            P Q T+GP+VSAI    +    + +      KK +G I+G  +G+    +L+I  I ++ 
Sbjct  598  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKTIGIIVGAIVGAGMLSILVIAIILFIR  657

Query  241  WTKKKS  224
              +K++
Sbjct  658  RKRKRA  663



>ref|XP_010501251.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Camelina sativa]
Length=993

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  HS ++ PNT D E++++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  455  YIDHSATRFPNTSDSEIFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  513

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++ + A GS  R   + +KANV+ N L+IH FWAGKGTCCI
Sbjct  514  LGRRLFDIYVQGKLVEKDFDIHRAANGSSIRVNQRVYKANVSENYLEIHLFWAGKGTCCI  573

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYVW  242
            P Q T+GP+VSAI    +    + +      KK +G I+G  +G+    +L+I  I ++ 
Sbjct  574  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKTIGIIVGAIVGAGMLSILVIAIILFIR  633

Query  241  WTKKKS  224
              +K++
Sbjct  634  RKRKRA  639



>ref|XP_008663599.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Zea mays]
Length=1028

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 121/186 (65%), Gaps = 6/186 (3%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S  Q  NTLD EL++TAR+SPSSLRYYG+GL+ G Y V L FAE   +D   +WK
Sbjct  485  SYIIYSLHQFQNTLDSELFQTARMSPSSLRYYGIGLENGNYTVTLQFAEFDFED-SQTWK  543

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             +GRR FD+ +QGER  ++F++++ +GG S  A+ K++   VT N L+IH FWAGKGTCC
Sbjct  544  SVGRRVFDIYLQGERKEKNFDIRKASGGKSYTAVEKQYIVPVTRNFLEIHLFWAGKGTCC  603

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYV  245
            IP Q  +GP +SA+         + +S+   +  + G I+G+ +G+A  GVL +  I  +
Sbjct  604  IPAQGYYGPAISALSATPNFTPTVRNSAQKKNSSKTGVIVGVVIGAAVLGVLALAGIC-M  662

Query  244  WWTKKK  227
            W  K++
Sbjct  663  WRQKRR  668



>gb|KHM98859.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1034

 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y +   +Q   T++ EL++TAR+S SSLRYYG+GL+ G Y + L FAE  + D   SW+ 
Sbjct  480  YKSFVSNQFTGTVNSELFQTARLSASSLRYYGLGLENGFYNITLQFAETAILDSTRSWES  539

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG RVL+DF++++EAGG S RA+ ++F+  VT N L+IH FWAGKGTCCI
Sbjct  540  LGRRVFDIYIQGTRVLKDFDIQKEAGGISYRAIQRQFRFEVTENYLEIHLFWAGKGTCCI  599

Query  412  PVQSTFGPIVSAIHVVQE  359
            P Q T+GP++ AIH + +
Sbjct  600  PTQGTYGPLIQAIHAIPD  617



>gb|KDO77515.1| hypothetical protein CISIN_1g0025621mg, partial [Citrus sinensis]
Length=568

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 115/186 (62%), Gaps = 7/186 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y  ++  Q+  T   ELY+T+RISP SLRYYG+GL+ G Y V L FAE   +D   + W+
Sbjct  329  YVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWE  388

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             L RR FD+ IQG    +DF++ +EAGG  RA++K F A V+ N L+IH FWAGKGTCC+
Sbjct  389  SLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCV  448

Query  412  PVQSTFGPIVSAIHVVQ----EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYV  245
            P Q  +GP +SA+ VV      V+    S   +K   G I+GI +    G+L + +I  V
Sbjct  449  PKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAV--PLGILGLIAISIV  506

Query  244  WWTKKK  227
            ++ ++K
Sbjct  507  FYMRRK  512



>ref|XP_002894563.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70822.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=2002

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769   YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
             Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++W+
Sbjct  1419  YIATSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWR  1478

Query  592   GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             GLGRR FD+ +QG  V +DF+V++ AG S  RA+ +++KANV+ N L++H FWAGKGTCC
Sbjct  1479  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQREYKANVSENHLEVHLFWAGKGTCC  1538

Query  415   IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
             IP+Q  +GP++SA+    +    + +      K   G I+G+ +G   G+L I +   ++
Sbjct  1539  IPIQGAYGPLISAVGATPDFTPTVGNRPPSKGKSMTGTIVGVIVG--VGLLSIFAGVVIF  1596

Query  241   WTKKKSPTY  215
               +K+   Y
Sbjct  1597  IIRKRRKRY  1605


 Score =   160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y   S ++  NT D EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  475  YIFVSPTRFANTSDSELFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  533

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++ + A GS  R + + +KANV+ N L+IH FWAGKGTCCI
Sbjct  534  LGRRVFDIYVQGKLVEKDFDMHRTANGSSIRVIQRVYKANVSENYLEIHLFWAGKGTCCI  593

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAA-GVLIICSIFYVW  242
            P Q T+GP+VSAI    +    + +      KK++G I+G  +G+    +L+I  I ++ 
Sbjct  594  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKKIGIIVGAIVGAGMLSILVIAIILFIR  653

Query  241  WTKKKS  224
              +K++
Sbjct  654  RKRKRA  659



>gb|KFK35535.1| hypothetical protein AALP_AA4G003200 [Arabis alpina]
Length=1019

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 124/189 (66%), Gaps = 6/189 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y   S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++W+
Sbjct  468  YKFASTSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQFLGPSINTWR  527

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLG+R FD+ +QG  V +DF+V++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCC
Sbjct  528  GLGKRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVPREYKANVSENYLEIHLFWAGKGTCC  587

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP+Q  +GPI+SA+    +    + +      K R G I+G+ +G   G+L I +   ++
Sbjct  588  IPIQGAYGPIISAVSAKPDFTPTVSNRPPSKGKNRTGAIVGVIVG--IGLLSIFAGVVIF  645

Query  241  WTKKKSPTY  215
              +K+   Y
Sbjct  646  IIRKRRKQY  654



>ref|XP_011069383.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Sesamum indicum]
Length=1042

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 120/184 (65%), Gaps = 4/184 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  NTLD  L++ ARIS  SLRYYG+GL+ G Y V L FAE  +   + +W+ 
Sbjct  481  YTSTSLSQFTNTLDSSLFQIARISAGSLRYYGLGLENGNYTVRLLFAETIILGTR-TWRS  539

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGS-KRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG  V++DF++ +EA G+  RA+V++FK  V+ N +DIHFFWAGKGTCCI
Sbjct  540  IGRRVFDIYVQGNLVMKDFDILREANGTFLRAVVREFKVQVSENYIDIHFFWAGKGTCCI  599

Query  412  PVQSTFGPIVSAIHVVQEVNLDDSSD--GSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P   T+GP++SAI    +     S +  G +K R G I+GIT+  AA   +  +  Y  +
Sbjct  600  PFSGTYGPLISAISATPDFRPSVSGNLPGGNKNRTGLIVGITVAVAAASFLSLAAIYYAF  659

Query  238  TKKK  227
             ++K
Sbjct  660  RRRK  663



>ref|XP_010463512.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Camelina sativa]
Length=721

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 102/139 (73%), Gaps = 2/139 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++WK
Sbjct  478  YKATSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWK  537

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ K +KANV+ N L+IH FWAGKGTCC
Sbjct  538  GLGRRRFDIYVQGRLVEKDFDVRKTAGDSTVRAIQKVYKANVSENHLEIHLFWAGKGTCC  597

Query  415  IPVQSTFGPIVSAIHVVQE  359
            IP+Q  +GP++SA+    +
Sbjct  598  IPIQGAYGPLISAVSATPD  616



>gb|KEH19475.1| LRR receptor-like kinase, putative [Medicago truncatula]
Length=1031

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 116/173 (67%), Gaps = 5/173 (3%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYF  572
            +Q   T++ EL++ AR+S SSLRYYG+GL+ G Y + L FAE  + D   +WK LGRR F
Sbjct  484  NQFTGTVNSELFQFARLSASSLRYYGLGLENGFYNITLQFAETAILD-STTWKSLGRRVF  542

Query  571  DVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            D+ IQG RVL+DF++++EAGG S RA+ K+F+  V  N +++H FWAGKGTCCIP Q T+
Sbjct  543  DIYIQGTRVLKDFDIQREAGGVSYRAVQKQFRFEVKENYVEVHLFWAGKGTCCIPGQGTY  602

Query  394  GPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFYV  245
            GP++ AI    +   ++ +    S K R G IIGI +G  A   L + +IFY+
Sbjct  603  GPLIQAISATPDFIPSVSNKPPSSKKNRAGLIIGIVVGVGAVCFLAVFAIFYI  655



>ref|XP_008371856.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Malus domestica]
Length=591

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 119/189 (63%), Gaps = 10/189 (5%)
 Frame = -2

Query  772  NYTAHSFSQIPNT-LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDS  599
            ++  ++ +Q+  T +  EL++T+R+SP SLRYYG+GL+ G Y V LHFAE   +      
Sbjct  17   SFLENTLAQVTGTDVTPELFQTSRVSPGSLRYYGLGLQNGPYTVTLHFAETVYESRTSXK  76

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W+ LGRR FD+ IQG R+ +D ++   AGG  RA+V+KF  NV+ N L+IH FWAGKGTC
Sbjct  77   WESLGRRVFDIYIQGTRMTKDLDISSXAGGVNRAIVRKFNVNVSENYLEIHLFWAGKGTC  136

Query  418  CIPVQSTFGPIVSAIHVVQE-----VNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSI  254
            CIP Q  +GP+++A+H   +       L  ++ G  K + G I+GI +    GV+ +  I
Sbjct  137  CIPEQGDYGPLIAAVHAASDFTPTVAGLPPTTPGK-KSKTGLIVGIAV--PIGVVSLLLI  193

Query  253  FYVWWTKKK  227
            F + + ++K
Sbjct  194  FAILYMRRK  202



>gb|KJB84220.1| hypothetical protein B456_N011200 [Gossypium raimondii]
Length=1004

 Score =   164 bits (416),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 113/180 (63%), Gaps = 7/180 (4%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWKGLGRRY  575
            +Q+ +T   ELY+T+R+SP SLRYYG+GL+ G Y V L FAE    D    SWK L RR 
Sbjct  450  AQVKSTNTPELYQTSRLSPGSLRYYGLGLQNGPYTVRLFFAETGFPDRTTQSWKSLARRV  509

Query  574  FDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            FDV IQG R LRDF++ + AGG +RA++  F ANVT N L+IH FWAGKGTCC+P Q  +
Sbjct  510  FDVYIQGTRRLRDFDISKAAGGVERAIITNFTANVTENHLEIHLFWAGKGTCCVPTQGYY  569

Query  394  GPIVSAIHVVQEV--NLDDSSDG--SDKKRVGKIIGITLGSAAGVLIICSIFYVWWTKKK  227
            GP +SAI VV     N+     G   +K  V  I+G+T+   A   I+  +F + + K +
Sbjct  570  GPSISAITVVPNFKPNVSGIPPGIPEEKNHVALIVGVTVPIVALAFIL--VFVIIYAKSQ  627



>ref|XP_008226109.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Prunus mume]
Length=1052

 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 128/186 (69%), Gaps = 4/186 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT+ S SQ  NTLD E+++TAR+S SSLRYYG+GL+ G Y V L FAE  + D   +WK 
Sbjct  497  YTSFSSSQFKNTLDSEIFQTARLSASSLRYYGLGLENGNYTVTLEFAETAILD-STTWKS  555

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
            LGRR FD+ IQG   L+DF++++EAG S +A+ K++ A+V+ N L+IH FWAGKGTCCIP
Sbjct  556  LGRRVFDIYIQGNLFLKDFDIRKEAGASFQAVQKEYTAHVSENYLEIHLFWAGKGTCCIP  615

Query  409  VQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWT  236
             Q T+GP++SAI    +    + ++   S K R G I+GI +G    +L++ + FY++  
Sbjct  616  GQGTYGPVISAISATPDFIPTVSNNPPTSKKNRTGLIVGIVVGGGVLILMMAT-FYIFQR  674

Query  235  KKKSPT  218
            +K++ T
Sbjct  675  RKRTNT  680



>emb|CBI20535.3| unnamed protein product [Vitis vinifera]
Length=994

 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 117/177 (66%), Gaps = 13/177 (7%)
 Frame = -2

Query  763  AHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-SWKGL  587
            A++ SQ+  T   EL+KT+RISP SLRYYG+GL+ G Y V L FAE+   D    +W+  
Sbjct  466  ANTTSQVNGTNTPELFKTSRISPGSLRYYGLGLQNGPYIVSLQFAEMLFKDPSTRTWEST  525

Query  586  GRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPV  407
            GRR FD+ IQG R+ RDF++ +EAGG +RA+V+KF A V+ N L+IH  WAGKGTCCIP 
Sbjct  526  GRRVFDIYIQGIRLERDFDISKEAGGVQRAVVRKFHATVSKNYLEIHLLWAGKGTCCIPF  585

Query  406  QSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGV---LIICSIFYV  245
            +  +GP +SA+ VV  + L       ++   G I GI +   AG+   +++C++FY+
Sbjct  586  EGYYGPSISALSVVSGITL-------ERYNTGFIAGIAV--VAGIVCFILVCAVFYI  633



>ref|XP_006346232.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Solanum tuberosum]
Length=1983

 Score =   165 bits (418),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 129/193 (67%), Gaps = 6/193 (3%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSW  596
            Q++T+ + SQ  NTLD ELY+TARIS  SLRYYG+GL+ G Y V LHFAE ++ +   +W
Sbjct  495  QSFTSFTSSQFTNTLDSELYQTARISAGSLRYYGLGLENGNYTVTLHFAESEILN-PPTW  553

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTC  419
            + +GRR FD+ +QG R L+DF++K+EAGG   A V++ F A V++N L+IH FWAGKGTC
Sbjct  554  RSVGRRVFDIYVQGIRQLKDFDIKREAGGRSLAAVQRQFTAQVSDNHLEIHLFWAGKGTC  613

Query  418  CIPVQSTFGPIVSAIHVVQ--EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYV  245
            C+P+QST+GP +SAI      E ++ +    + + R G I+GI +G     LI  S+F V
Sbjct  614  CVPIQSTYGPSISAISATPDFEPSVSNQPPTTKENRTGLIVGIVVGVGVISLI--SLFAV  671

Query  244  WWTKKKSPTYKGF  206
            ++  +K    K  
Sbjct  672  YYLIQKRKQQKAL  684


 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 102/140 (73%), Gaps = 1/140 (1%)
 Frame = -2

Query  775   QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSW  596
             Q++T+   SQ  NTLD +L++TARIS  SLRYYG+GL  GIY V L FAE ++ +   +W
Sbjct  1432  QSFTSFKSSQFSNTLDSQLFQTARISSGSLRYYGLGLVNGIYTVNLQFAESEILNTP-TW  1490

Query  595   KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
               LGRR FDV +QG R L+DF++++EAGGS  A+ ++F A V+ N L+IH FWAGKGTCC
Sbjct  1491  HSLGRRVFDVYVQGIRRLKDFDIRKEAGGSLAAVQRQFIALVSENYLEIHLFWAGKGTCC  1550

Query  415   IPVQSTFGPIVSAIHVVQEV  356
             +P+Q T+GP +SAI    ++
Sbjct  1551  VPIQGTYGPSISAISATSDL  1570



>gb|KDO77514.1| hypothetical protein CISIN_1g0025621mg, partial [Citrus sinensis]
Length=720

 Score =   162 bits (410),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 115/186 (62%), Gaps = 7/186 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y  ++  Q+  T   ELY+T+RISP SLRYYG+GL+ G Y V L FAE   +D   + W+
Sbjct  481  YVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWE  540

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             L RR FD+ IQG    +DF++ +EAGG  RA++K F A V+ N L+IH FWAGKGTCC+
Sbjct  541  SLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCV  600

Query  412  PVQSTFGPIVSAIHVVQ----EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYV  245
            P Q  +GP +SA+ VV      V+    S   +K   G I+GI +    G+L + +I  V
Sbjct  601  PKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAV--PLGILGLIAISIV  658

Query  244  WWTKKK  227
            ++ ++K
Sbjct  659  FYMRRK  664



>ref|XP_010645959.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X4 [Vitis vinifera]
Length=863

 Score =   163 bits (413),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 116/177 (66%), Gaps = 7/177 (4%)
 Frame = -2

Query  763  AHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-SWKGL  587
            A++ SQ+  T   EL+KT+RISP SLRYYG+GL+ G Y V L FAE+   D    +W+  
Sbjct  329  ANTTSQVNGTNTPELFKTSRISPGSLRYYGLGLQNGPYIVSLQFAEMLFKDPSTRTWEST  388

Query  586  GRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPV  407
            GRR FD+ IQG R+ RDF++ +EAGG +RA+V+KF A V+ N L+IH  WAGKGTCCIP 
Sbjct  389  GRRVFDIYIQGIRLERDFDISKEAGGVQRAVVRKFHATVSKNYLEIHLLWAGKGTCCIPF  448

Query  406  QSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGV---LIICSIFYV  245
            +  +GP +SA+ VV  +        S+    G I GI +   AG+   +++C++FY+
Sbjct  449  EGYYGPSISALSVVSALE-RMPPPPSETSNTGFIAGIAV--VAGIVCFILVCAVFYI  502



>gb|KHN30298.1| Putative LRR receptor-like serine/threonine-protein kinase, partial 
[Glycine soja]
Length=766

 Score =   162 bits (410),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 113/179 (63%), Gaps = 5/179 (3%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYF  572
            +Q   T+D EL++TAR+S SSLRYYG+GL+ G Y + L FAE  + D    WK LGRR F
Sbjct  219  NQFTQTVDPELFQTARLSASSLRYYGLGLENGFYNITLQFAETVILD-NSEWKSLGRRIF  277

Query  571  DVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            D+ IQG  VL+DFN+K+EAGG S   ++KKF+  V  N L+IH FWAGKGTCCIPVQ T+
Sbjct  278  DIYIQGTLVLKDFNIKKEAGGISFSVVLKKFRVEVLENYLEIHLFWAGKGTCCIPVQGTY  337

Query  394  GPIVSAIHVVQEVNLDDSSDGSDKKR---VGKIIGITLGSAAGVLIICSIFYVWWTKKK  227
            GP++SAI  + +     S+     KR      +  +    A   L++ + FYV   +K+
Sbjct  338  GPLISAISAIPDFKPTVSNKPPSNKRNRAGLIVGIVVGVGAVSFLVVLAFFYVIRKRKR  396



>ref|XP_011462047.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Fragaria vesca 
subsp. vesca]
Length=1005

 Score =   164 bits (414),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT  S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAE  + D   +WK 
Sbjct  451  YTIFSSSQFXNTLDSELFQTARLSASSLRYYGLGLENGNYTVNLQFAEQAILD-STTWKS  509

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
            LGRR F++ IQG  VL+DF++++EAGGS  A+ K++   V+ N L+IH FWAGKGTCC+P
Sbjct  510  LGRRVFNIYIQGNLVLKDFDIRKEAGGSFLAVQKEYTVPVSENFLEIHLFWAGKGTCCVP  569

Query  409  VQSTFGPIVSAIHVVQE  359
             Q T+GPIVSAI    +
Sbjct  570  AQGTYGPIVSAISATPD  586



>ref|XP_006303851.1| hypothetical protein CARUB_v10012587mg, partial [Capsella rubella]
 gb|EOA36749.1| hypothetical protein CARUB_v10012587mg, partial [Capsella rubella]
Length=989

 Score =   163 bits (413),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 103/139 (74%), Gaps = 2/139 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++WK
Sbjct  438  YKATSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVNLQFAEIQILGSTSNTWK  497

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ K++KANV+ N L+IH FWAGKGTCC
Sbjct  498  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQKQYKANVSENHLEIHLFWAGKGTCC  557

Query  415  IPVQSTFGPIVSAIHVVQE  359
            IP+Q  +GP++SA+    +
Sbjct  558  IPIQGAYGPLISAVSATPD  576



>ref|XP_002271607.3| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Vitis vinifera]
Length=1000

 Score =   164 bits (414),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 116/177 (66%), Gaps = 7/177 (4%)
 Frame = -2

Query  763  AHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-SWKGL  587
            A++ SQ+  T   EL+KT+RISP SLRYYG+GL+ G Y V L FAE+   D    +W+  
Sbjct  466  ANTTSQVNGTNTPELFKTSRISPGSLRYYGLGLQNGPYIVSLQFAEMLFKDPSTRTWEST  525

Query  586  GRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPV  407
            GRR FD+ IQG R+ RDF++ +EAGG +RA+V+KF A V+ N L+IH  WAGKGTCCIP 
Sbjct  526  GRRVFDIYIQGIRLERDFDISKEAGGVQRAVVRKFHATVSKNYLEIHLLWAGKGTCCIPF  585

Query  406  QSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGV---LIICSIFYV  245
            +  +GP +SA+ VV  +        S+    G I GI +   AG+   +++C++FY+
Sbjct  586  EGYYGPSISALSVVSALE-RMPPPPSETSNTGFIAGIAV--VAGIVCFILVCAVFYI  639



>ref|XP_010645957.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Vitis vinifera]
Length=1001

 Score =   164 bits (414),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 116/177 (66%), Gaps = 7/177 (4%)
 Frame = -2

Query  763  AHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-SWKGL  587
            A++ SQ+  T   EL+KT+RISP SLRYYG+GL+ G Y V L FAE+   D    +W+  
Sbjct  467  ANTTSQVNGTNTPELFKTSRISPGSLRYYGLGLQNGPYIVSLQFAEMLFKDPSTRTWEST  526

Query  586  GRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPV  407
            GRR FD+ IQG R+ RDF++ +EAGG +RA+V+KF A V+ N L+IH  WAGKGTCCIP 
Sbjct  527  GRRVFDIYIQGIRLERDFDISKEAGGVQRAVVRKFHATVSKNYLEIHLLWAGKGTCCIPF  586

Query  406  QSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGV---LIICSIFYV  245
            +  +GP +SA+ VV  +        S+    G I GI +   AG+   +++C++FY+
Sbjct  587  EGYYGPSISALSVVSALE-RMPPPPSETSNTGFIAGIAV--VAGIVCFILVCAVFYI  640



>ref|XP_002310677.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE91127.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=1036

 Score =   164 bits (414),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 120/188 (64%), Gaps = 7/188 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT  S SQ  NTLD EL++T+R+S SSLRYYG+GL+ G Y + + F E  +     +WK 
Sbjct  480  YTTSSSSQFTNTLDSELFQTSRLSASSLRYYGLGLENGNYTITIQFTESVIFQ-GSTWKS  538

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FDV IQG RVL+DF++++ AGG   +A+ ++FK  VT N LDIHFFWAGKGTCCI
Sbjct  539  LGRRVFDVYIQGSRVLKDFDIQKAAGGIMNQAVQREFKVQVTENYLDIHFFWAGKGTCCI  598

Query  412  PVQSTFGPIVSAIHVVQEVNLDDS----SDGSDKKRVGKI-IGITLGSAAGVLIICSIFY  248
            P Q T+GP VSAI+ + +     S    S+   K R G I   +      G L++ ++F+
Sbjct  599  PAQGTYGPSVSAINAIPDFTPTVSNKLPSEKKKKNRTGLIAGIVVGVGIVGFLLVFAVFF  658

Query  247  VWWTKKKS  224
            V   K +S
Sbjct  659  VRRRKGQS  666



>ref|XP_002894560.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70819.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1058

 Score =   164 bits (414),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 118/177 (67%), Gaps = 9/177 (5%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y   S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ+    +SWKG
Sbjct  509  YRETSQSQFINTLDSELFQSARLSASSLRYYGLGLENGGYTVILQFAEIQIQG-SNSWKG  567

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG  V +DF+V++ AGGS  RA+ +++K NV  N L++H FWAGKGTCCI
Sbjct  568  IGRRRFDIYVQGRLVEKDFDVRRTAGGSSVRAVQREYKTNVAENHLEVHLFWAGKGTCCI  627

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSA-----AGVLII  263
            P+Q  +GP++SA+    +    + +      K R G I+G+ +G       AGV+I+
Sbjct  628  PIQGAYGPLISAVSARPDFTPTVANRPPLKGKSRTGTIVGVIVGIGLLSIFAGVVIL  684



>ref|XP_002970734.1| hypothetical protein SELMODRAFT_411551 [Selaginella moellendorffii]
 gb|EFJ28060.1| hypothetical protein SELMODRAFT_411551 [Selaginella moellendorffii]
Length=694

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 4/166 (2%)
 Frame = -2

Query  721  LYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYFDVSIQGERVL  542
            LY+TAR +P+SLRY GVG++ G Y V LHFAEI +   +D   G+GRRYFDV IQG+R L
Sbjct  472  LYQTARTAPTSLRYLGVGMRSGSYTVHLHFAEIIIGTGQDG-PGVGRRYFDVFIQGDRKL  530

Query  541  RDFNVKQEAGGSKRALVKKFKA-NVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHVV  365
            +DFN+++EA GS RAL + F A NV+N VLDIH  W GKGTCC P +S FGP++SAI V+
Sbjct  531  KDFNIREEANGSLRALTRSFTAVNVSNGVLDIHLLWMGKGTCCAPFRS-FGPLISAIQVL  589

Query  364  QEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWTKKK  227
             E     +S   +  R G  IG+ +     VL + S + +W  + +
Sbjct  590  PEFETGGASQSENSSR-GVKIGVGISVPLLVLFVVSGYLLWRKRHR  634



>emb|CDY38804.1| BnaA07g28760D [Brassica napus]
Length=639

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 103/138 (75%), Gaps = 2/138 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQM    ++W+G
Sbjct  480  YIATSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTIQFAEIQMIG-SNTWRG  538

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            + RR FD+ +QG+ V +DF+V+  AGGS  RA+ +++KANV+ N L++H FWAGKGTCCI
Sbjct  539  VARRRFDIYVQGKLVEKDFDVRGTAGGSTLRAVQREYKANVSENYLEVHLFWAGKGTCCI  598

Query  412  PVQSTFGPIVSAIHVVQE  359
            P+Q  +GP+VSA+    +
Sbjct  599  PIQGAYGPLVSAVSATPD  616



>ref|XP_003531816.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Glycine max]
Length=1034

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y +   +Q   T++ EL++TAR+S SSLRYYG+GL+ G Y + L FAE  + D   SW+ 
Sbjct  480  YKSFVSNQFTGTVNSELFQTARLSASSLRYYGLGLENGFYNITLQFAETAILDSTRSWES  539

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG RVL+DF++++EAGG S +A+ ++F+  VT N L+IH FWAGKGTCCI
Sbjct  540  LGRRVFDIYIQGTRVLKDFDIQKEAGGISYKAIQRQFRFEVTENYLEIHLFWAGKGTCCI  599

Query  412  PVQSTFGPIVSAIHVVQE  359
            P Q T+GP++ AIH + +
Sbjct  600  PTQGTYGPLIQAIHAIPD  617



>ref|XP_004243974.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Solanum lycopersicum]
Length=1027

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 111/158 (70%), Gaps = 4/158 (3%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSW  596
            Q++T+ + SQ  NTLD ELY+TARIS  SLRYYG+GL+ G Y V LHFAE ++ +   +W
Sbjct  475  QSFTSFTSSQFTNTLDSELYQTARISAGSLRYYGLGLENGNYTVTLHFAESEILN-PPTW  533

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTC  419
            + +GRR FD+ +QG R L+DF++K+EAGG   A V++ F A V++N L+IH  WAGKGTC
Sbjct  534  RSVGRRVFDIYVQGVRQLKDFDIKREAGGRSLAAVQRQFTAQVSDNHLEIHLHWAGKGTC  593

Query  418  CIPVQSTFGPIVSAIHVVQ--EVNLDDSSDGSDKKRVG  311
            C+P+QST+GP +SAI      E ++ +    + K R G
Sbjct  594  CVPIQSTYGPSISAISATPDFEPSVSNQPPTTKKNRTG  631



>ref|XP_007022387.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY13912.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1036

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 126/183 (69%), Gaps = 4/183 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT    SQ  +TLD EL++TAR+S SS+RYYG+GL+ G Y V+L FAEI++ D  + W+ 
Sbjct  486  YTISLSSQFTSTLDPELFQTARVSASSIRYYGLGLENGNYTVKLQFAEIEIMD-TNIWES  544

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQG  VL DF++++EAGG SKRA+ K+FKA V+ N L+IH FWAGKGTCC+
Sbjct  545  LGRRVFDIYIQGNLVLEDFDIRKEAGGVSKRAVPKEFKAQVSENYLEIHLFWAGKGTCCV  604

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q  +GP +SAI    +    +++++  S K R G I+GI +G  A  L+  + F ++ 
Sbjct  605  PAQGKYGPSISAISATPDFIPTVNNNAPTSKKSRTGLIVGIVVGVGAVSLLSVAAFCIFR  664

Query  238  TKK  230
             ++
Sbjct  665  KRR  667



>ref|XP_007211341.1| hypothetical protein PRUPE_ppa001211mg [Prunus persica]
 gb|EMJ12540.1| hypothetical protein PRUPE_ppa001211mg [Prunus persica]
Length=880

 Score =   162 bits (411),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 81/190 (43%), Positives = 120/190 (63%), Gaps = 11/190 (6%)
 Frame = -2

Query  772  NYTAHSFSQIPNT-LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDS  599
            ++  ++ +Q+  T +  EL++ +R+SP SLRYYG+GL+ G Y V L FAE   D   K +
Sbjct  317  SFVQNTLTQVTGTDVTPELFQNSRLSPGSLRYYGLGLENGPYTVTLQFAETVFDSRAKQT  376

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W+ LGRR FD+ IQG  + +DF++ +EAGG  RA+ + FK NVT N LDIH FWAGKGTC
Sbjct  377  WESLGRRVFDIYIQGNLIRKDFDISKEAGGVNRAVKRPFKVNVTENYLDIHLFWAGKGTC  436

Query  418  CIPVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLGSAAGVLIICSI  254
            CIP Q  +GP++S +H   +       L  ++ G  K R G I+GI +     +L++ ++
Sbjct  437  CIPQQGDYGPLISTVHAASDFTPTVSGLPPTTPGK-KSRNGLIVGIAV-PVGSLLLLFAV  494

Query  253  FYVWWTKKKS  224
             Y+   +KKS
Sbjct  495  LYM--RRKKS  502



>ref|XP_010324206.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Solanum lycopersicum]
Length=985

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 111/158 (70%), Gaps = 4/158 (3%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSW  596
            Q++T+ + SQ  NTLD ELY+TARIS  SLRYYG+GL+ G Y V LHFAE ++ +   +W
Sbjct  433  QSFTSFTSSQFTNTLDSELYQTARISAGSLRYYGLGLENGNYTVTLHFAESEILN-PPTW  491

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTC  419
            + +GRR FD+ +QG R L+DF++K+EAGG   A V++ F A V++N L+IH  WAGKGTC
Sbjct  492  RSVGRRVFDIYVQGVRQLKDFDIKREAGGRSLAAVQRQFTAQVSDNHLEIHLHWAGKGTC  551

Query  418  CIPVQSTFGPIVSAIHVVQ--EVNLDDSSDGSDKKRVG  311
            C+P+QST+GP +SAI      E ++ +    + K R G
Sbjct  552  CVPIQSTYGPSISAISATPDFEPSVSNQPPTTKKNRTG  589



>ref|XP_006587157.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Glycine max]
Length=1007

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 113/179 (63%), Gaps = 5/179 (3%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYF  572
            +Q   T+D EL++TAR+S SSLRYYG+GL+ G Y + L FAE  + D    WK LGRR F
Sbjct  460  NQFTQTVDPELFQTARLSASSLRYYGLGLENGFYNITLQFAETVILD-NSEWKSLGRRIF  518

Query  571  DVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            D+ IQG  VL+DFN+K+EAGG S   ++KKF+  V  N L+IH FWAGKGTCCIPVQ T+
Sbjct  519  DIYIQGTLVLKDFNIKKEAGGISFSVVLKKFRVEVLENYLEIHLFWAGKGTCCIPVQGTY  578

Query  394  GPIVSAIHVVQEVNLDDSSDGSDKKR---VGKIIGITLGSAAGVLIICSIFYVWWTKKK  227
            GP++SAI  + +     S+     KR      +  +    A   L++ + FYV   +K+
Sbjct  579  GPLISAISAIPDFKPTVSNKPPSNKRNRAGLIVGIVVGVGAVSFLVVLAFFYVIRKRKR  637



>ref|XP_008225769.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103325393 
[Prunus mume]
Length=2198

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 119/189 (63%), Gaps = 10/189 (5%)
 Frame = -2

Query  772   NYTAHSFSQIPNT-LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDS  599
             ++  ++ +Q+  T +  EL++ +R+SP SLRYYG+GL+ G Y V L FAE   D   K +
Sbjct  1632  SFVQNTLTQVTGTDVTPELFQNSRLSPGSLRYYGLGLQNGPYTVTLQFAETVFDSRAKQT  1691

Query  598   WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
             W+ LGRR FD+ IQG  + +DF++ +EAGG  RA+ + FK NVT N LDIH FWAGKGTC
Sbjct  1692  WESLGRRVFDIYIQGNLIRKDFDISKEAGGVNRAVKRPFKVNVTENYLDIHLFWAGKGTC  1751

Query  418   CIPVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLGSAAGVLIICSI  254
             CIP Q  +GP++S +H   +       L  ++ G  K R G I+GI +   A  L++  +
Sbjct  1752  CIPEQGDYGPLISTVHAASDFTPTVSGLPPTTPGK-KSRTGLIVGIAVPVGAVSLLL--L  1808

Query  253   FYVWWTKKK  227
             F V + ++K
Sbjct  1809  FAVLYMRRK  1817


 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 118/189 (62%), Gaps = 10/189 (5%)
 Frame = -2

Query  772  NYTAHSFSQIPNT-LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAE-IQMDDIKDS  599
            ++   + +Q+  T +  EL++T+R+SP SLRYYG+GL+ G Y V L FAE +      ++
Sbjct  478  SFVETTLTQVTGTDVTPELFQTSRLSPGSLRYYGLGLENGPYTVTLQFAETVYTSRATET  537

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W+ LGRR FD+ IQG    +DF++ +EAGG  RA+ + FK NV+ N LDIH FWAGKGTC
Sbjct  538  WQSLGRRVFDIYIQGNLRWKDFDISKEAGGVNRAVGRPFKVNVSENYLDIHLFWAGKGTC  597

Query  418  CIPVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLGSAAGVLIICSI  254
            CIP Q  +GP++S +H   +       L  ++ G  K R G I+GI +   A  L++  +
Sbjct  598  CIPEQGDYGPLISTVHAASDFTPTVSGLPPTTPGK-KSRTGLIVGIAVPVGAVSLLL--L  654

Query  253  FYVWWTKKK  227
            F V + ++K
Sbjct  655  FAVLYMRRK  663



>ref|XP_007024836.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27458.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1179

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 118/181 (65%), Gaps = 6/181 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWK  593
            Y  ++F+Q+ +T    +Y+T+RISP SLRYYG+GL+ G Y V L FAE    +    SWK
Sbjct  433  YVQNTFAQVKSTNTPAIYQTSRISPVSLRYYGLGLENGPYTVNLFFAETAYPERSTQSWK  492

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LGRR FD+ IQG   ++DF++ +EAGG++RA+ + F ANVT N L+IH FWAGKGTCC+
Sbjct  493  SLGRRVFDIYIQGSLKVKDFDISKEAGGAERAITRNFTANVTENHLEIHLFWAGKGTCCV  552

Query  412  PVQSTFGPIVSAIHVVQE----VNLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFY  248
            P    +GP +SAI VV +    V+    S  + KK+   I+GI +    A +++IC I +
Sbjct  553  PEFGYYGPSISAISVVPDFKPTVSGLPPSSSNRKKQTALIVGIIVPVGVAALILICVIIF  612

Query  247  V  245
            +
Sbjct  613  I  613



>gb|KCW44835.1| hypothetical protein EUGRSUZ_L01594 [Eucalyptus grandis]
Length=928

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = -2

Query  763  AHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLG  584
            A + SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ ++    WK LG
Sbjct  374  ASALSQFANTLDSELFQTARVSASSLRYYGLGLENGNYSVTLQFAEIQNENT--GWKRLG  431

Query  583  RRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPV  407
            RR FD+ IQG RV +DF++++EA G S  A+ K ++A VT N L+IHFFWAGKGTCC+P 
Sbjct  432  RRLFDIYIQGNRVAKDFDIRKEADGVSFTAVQKLYQARVTANYLEIHFFWAGKGTCCVPN  491

Query  406  QSTFGPIVSAIHVVQE  359
              T+GP++SAI  V++
Sbjct  492  PGTYGPLISAISAVRD  507



>emb|CDY10509.1| BnaC03g71050D [Brassica napus]
Length=1027

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 116/178 (65%), Gaps = 9/178 (5%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQM-DDIKDSWK  593
            Y     SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ+     ++W+
Sbjct  474  YIVTLLSQFINTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQIIGSSSNTWR  533

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V RDF++++ A  S  RA+VK++K NV+ N ++IH FWAGKGTCC
Sbjct  534  GLGRRRFDIYVQGRLVERDFDIRRTANDSTVRAVVKEYKVNVSENYIEIHLFWAGKGTCC  593

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSA-----AGVLII  263
            IP+Q  +GP++SA+    +    + +        R G I+G+ +G       AGV+I+
Sbjct  594  IPIQGAYGPLISAVSAKPDFIPTVANKPPSKGNNRTGTIVGVIVGLGLLSIIAGVVIL  651



>ref|XP_009608510.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Nicotiana tomentosiformis]
Length=1037

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 109/158 (69%), Gaps = 4/158 (3%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSW  596
            Q++T+ S SQ  NTLD EL++TARIS  SLRYYG+GL+ G Y V L FAE Q+ +   +W
Sbjct  485  QDFTSFSSSQFINTLDSELFQTARISAGSLRYYGLGLENGNYTVNLQFAESQILN-PPTW  543

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            + LGRR FDV +QG R L+DF++++EAGG S RA+ K+FK  V+ N L+IH FWAGKGTC
Sbjct  544  RSLGRRVFDVYVQGIRELKDFDIRKEAGGISLRAVQKQFKVQVSENHLEIHLFWAGKGTC  603

Query  418  CIPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVG  311
            C+P Q T+GP +SAI    +    + +    + K R G
Sbjct  604  CVPRQGTYGPSISAISATPDFIPTVSNQPPTTKKNRTG  641



>ref|XP_006392562.1| hypothetical protein EUTSA_v10011215mg [Eutrema salsugineum]
 gb|ESQ29848.1| hypothetical protein EUTSA_v10011215mg [Eutrema salsugineum]
Length=929

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S +Q  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +  I ++W+
Sbjct  372  YIATSQAQFINTLDSELFQSARLSASSLRYYGLGLENGAYTVTLQFAEIQILGSISNTWR  431

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ +++K NV+ N L+IH FWAGKGTCC
Sbjct  432  GLGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQREYKTNVSENYLEIHLFWAGKGTCC  491

Query  415  IPVQSTFGPIVSAI  374
            IP+Q  +GP++SA+
Sbjct  492  IPIQGAYGPLISAV  505



>ref|XP_010244460.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Nelumbo nucifera]
Length=1692

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 120/182 (66%), Gaps = 8/182 (4%)
 Frame = -2

Query  775   QNYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-  605
             Q+Y  ++ SQI     L  E ++T+R+SP SLRYYG+GL+ G+Y V L FAE  + D   
Sbjct  1134  QSYFQNTLSQISGAGILTTEFFQTSRLSPGSLRYYGLGLENGVYTVSLWFAETGISDAST  1193

Query  604   DSWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGK  428
             ++W+ LGRR FD+ IQG R L+DF++++E GG S  A+ K FKANV+ N L+IH FWAGK
Sbjct  1194  ETWQSLGRRVFDIYIQGNRELKDFBIRKETGGASNFAVQKBFKANVSENFLEIHLFWAGK  1253

Query  427   GTCCIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIF  251
             GTCCIP Q  +GP +SA+ V  +      +  + K++ G I+G+ +G S A  L +  +F
Sbjct  1254  GTCCIPEQGYYGPSISALAVTPDF---TPTTTTSKEKTGLIVGLVVGVSVASFLAVFIVF  1310

Query  250   YV  245
             Y+
Sbjct  1311  YL  1312


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y   + SQI     L  E ++T+R+SP SLRYYG+GL+ G+Y V L FAE  +DD   +
Sbjct  341  SYFQMTLSQISGAGILTSEFFQTSRLSPGSLRYYGLGLENGVYTVSLWFAETGIDDASTE  400

Query  601  SWKGLGRRYFDVSIQGER  548
            +WK LGRR FD+ IQ E 
Sbjct  401  TWKSLGRRVFDIYIQHEE  418



>ref|XP_011006995.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Populus euphratica]
Length=1036

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 120/188 (64%), Gaps = 7/188 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT  S SQ  NTLD EL++T+R+S SSLRYYG+GL+ G Y + + F E  +     +WK 
Sbjct  480  YTTSSSSQFTNTLDSELFQTSRLSASSLRYYGLGLENGHYTIIIQFTESVISQ-GSTWKS  538

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR F V IQG RVL+DF++++ AGG   +A+ ++FK  VT N LDIHFFWAGKGTCCI
Sbjct  539  LGRRVFHVYIQGSRVLKDFDIQKAAGGIMNQAVQREFKVQVTENYLDIHFFWAGKGTCCI  598

Query  412  PVQSTFGPIVSAIHVVQEVNLDDS----SDGSDKKRVGKI-IGITLGSAAGVLIICSIFY  248
            P Q T+GP VSAI+ + +     S    S+   K R G I   +      G L++ ++F+
Sbjct  599  PAQGTYGPSVSAINAIPDFTPTVSNKLPSEKKKKNRTGLIAGIVVGVGIVGFLLVFAVFF  658

Query  247  VWWTKKKS  224
            V   K++S
Sbjct  659  VRRRKRQS  666



>ref|XP_010480181.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Camelina sativa]
Length=1028

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 102/139 (73%), Gaps = 2/139 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++WK
Sbjct  479  YKATSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWK  538

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ K +KANV+ N L+IH FWAGKGTCC
Sbjct  539  GLGRRRFDIYVQGRLVEKDFDVRKTAGDSTVRAIQKVYKANVSENHLEIHLFWAGKGTCC  598

Query  415  IPVQSTFGPIVSAIHVVQE  359
            IP+Q  +GP++SA+    +
Sbjct  599  IPIQGAYGPLISAVSATPD  617



>ref|XP_007024834.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27456.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1029

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 119/186 (64%), Gaps = 6/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWK  593
            Y  ++F+Q+ +T    +Y+T+RISP SLRYYG+GL+ G Y V L FAE    +    SWK
Sbjct  485  YVQNTFAQVKSTNTPAIYQTSRISPVSLRYYGLGLENGPYTVNLFFAETAYPERSTQSWK  544

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LGRR FD+ IQG   ++DF++ +EAGG++RA+ + F ANVT N L+IH FWAGKGTCC+
Sbjct  545  SLGRRVFDIYIQGSLKVKDFDISKEAGGAERAITRNFTANVTENHLEIHLFWAGKGTCCV  604

Query  412  PVQSTFGPIVSAIHVVQE----VNLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFY  248
            P    +GP +SAI VV +    V+   +   + K +   I+GI +    A +++IC I +
Sbjct  605  PEFGYYGPSISAISVVPDFIPTVSGLPAGSSNRKNQTALIVGIIVPVGVAALILICVIIF  664

Query  247  VWWTKK  230
            +   KK
Sbjct  665  IKRRKK  670



>ref|XP_010501246.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Camelina sativa]
 ref|XP_010501247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Camelina sativa]
Length=1027

 Score =   162 bits (409),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 102/139 (73%), Gaps = 2/139 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y A S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ +    ++WK
Sbjct  478  YKATSQSQFVNTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWK  537

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            GLGRR FD+ +QG  V +DF+V++ AG S  RA+ K +KANV+ N L+IH FWAGKGTCC
Sbjct  538  GLGRRRFDIYVQGRLVEKDFDVRKTAGDSTVRAIQKVYKANVSENHLEIHLFWAGKGTCC  597

Query  415  IPVQSTFGPIVSAIHVVQE  359
            IP+Q  +GP++SA+    +
Sbjct  598  IPIQGAYGPLISAVSATPD  616



>dbj|BAF01001.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=835

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 121/184 (66%), Gaps = 6/184 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NT D EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  475  YIALSATQFANTSDSELFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  533

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++++ A GS  R + + +KANV+ N L++H FWAGKGTCCI
Sbjct  534  LGRRIFDIYVQGKLVEKDFDMQKAANGSSIRVIQRVYKANVSENYLEVHLFWAGKGTCCI  593

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP+VSAI    +    + +      KK +  I+G  +G  AG+L I  I  + +
Sbjct  594  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKNIVIIVGAIVG--AGMLCILVIAILLF  651

Query  238  TKKK  227
             ++K
Sbjct  652  IRRK  655



>ref|XP_011022401.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Populus euphratica]
Length=970

 Score =   161 bits (408),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 121/187 (65%), Gaps = 7/187 (4%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSW  596
            +Y  ++ +Q+ +T   ELY+T+RISP SLR +G+GL+ G Y V L FAE    D    +W
Sbjct  405  DYVENTLTQVLSTNTPELYQTSRISPGSLRCFGLGLENGPYTVHLLFAETAFADRSSQTW  464

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            + LGRR FD+ IQG R  +DF++ +EAGG +R++ + F   V+ + L+IH FWAGKGTCC
Sbjct  465  ESLGRRVFDIYIQGSRQSKDFDISKEAGGVERSITRTFNVTVSESHLEIHLFWAGKGTCC  524

Query  415  IPVQSTFGPIVSAIHVV----QEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFY  248
             PVQ  +GPI+SA++VV      V+    S   +K R G ++GI++  +AGV+ +  IF 
Sbjct  525  TPVQGYYGPIISALNVVPGFTPTVSGIPPSTRKEKSRTGMVVGISV--SAGVVCLTLIFA  582

Query  247  VWWTKKK  227
            V +  +K
Sbjct  583  VVYIMRK  589



>ref|XP_011022400.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Populus euphratica]
Length=1088

 Score =   162 bits (409),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 121/187 (65%), Gaps = 7/187 (4%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSW  596
            +Y  ++ +Q+ +T   ELY+T+RISP SLR +G+GL+ G Y V L FAE    D    +W
Sbjct  523  DYVENTLTQVLSTNTPELYQTSRISPGSLRCFGLGLENGPYTVHLLFAETAFADRSSQTW  582

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            + LGRR FD+ IQG R  +DF++ +EAGG +R++ + F   V+ + L+IH FWAGKGTCC
Sbjct  583  ESLGRRVFDIYIQGSRQSKDFDISKEAGGVERSITRTFNVTVSESHLEIHLFWAGKGTCC  642

Query  415  IPVQSTFGPIVSAIHVV----QEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFY  248
             PVQ  +GPI+SA++VV      V+    S   +K R G ++GI++  +AGV+ +  IF 
Sbjct  643  TPVQGYYGPIISALNVVPGFTPTVSGIPPSTRKEKSRTGMVVGISV--SAGVVCLTLIFA  700

Query  247  VWWTKKK  227
            V +  +K
Sbjct  701  VVYIMRK  707



>ref|XP_010040869.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Eucalyptus grandis]
Length=1072

 Score =   162 bits (409),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = -2

Query  763  AHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLG  584
            A + SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ ++    WK LG
Sbjct  441  ASALSQFANTLDSELFQTARVSASSLRYYGLGLENGNYSVTLQFAEIQNENT--GWKRLG  498

Query  583  RRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPV  407
            RR FD+ IQG RV +DF++++EA G S  A+ K ++A VT N L+IHFFWAGKGTCC+P 
Sbjct  499  RRLFDIYIQGNRVAKDFDIRKEADGVSFTAVQKLYQARVTANYLEIHFFWAGKGTCCVPN  558

Query  406  QSTFGPIVSAIHVVQE  359
              T+GP++SAI  V++
Sbjct  559  PGTYGPLISAISAVRD  574



>ref|XP_006468414.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Citrus sinensis]
Length=1045

 Score =   161 bits (408),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 115/186 (62%), Gaps = 7/186 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y  ++  Q+  T   ELY+T+RISP SLRYYG+GL+ G Y V L FAE   +D   + W+
Sbjct  481  YVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWE  540

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             L RR FD+ IQG    +DF++ +EAGG  RA++K F A V+ N L+IH FWAGKGTCC+
Sbjct  541  SLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCV  600

Query  412  PVQSTFGPIVSAIHVVQ----EVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYV  245
            P Q  +GP +SA+ VV      V+    S   +K   G I+GI +    G+L + +I  V
Sbjct  601  PKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAV--PLGILGLIAISIV  658

Query  244  WWTKKK  227
            ++ ++K
Sbjct  659  FYMRRK  664



>ref|XP_006306656.1| hypothetical protein CARUB_v10008172mg [Capsella rubella]
 gb|EOA39554.1| hypothetical protein CARUB_v10008172mg [Capsella rubella]
Length=1030

 Score =   161 bits (408),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 105/138 (76%), Gaps = 2/138 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  +S +Q  NT+D EL+++AR+S SSLRYYG+GL+ G Y V+L FAEIQ++  K +WKG
Sbjct  481  YIVNSQAQFTNTMDSELFQSARLSASSLRYYGLGLENGGYTVKLQFAEIQIEGSK-TWKG  539

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG  V +DF+V++ AGGS  RA+ +++K NV+ N L+IH FWAGKGTCCI
Sbjct  540  IGRRRFDIYVQGRLVEKDFDVRRTAGGSSVRAVQREYKTNVSGNHLEIHLFWAGKGTCCI  599

Query  412  PVQSTFGPIVSAIHVVQE  359
            P+Q  +GP++SA+    +
Sbjct  600  PIQGAYGPLISAVSATPD  617



>ref|XP_006448781.1| hypothetical protein CICLE_v10018029mg, partial [Citrus clementina]
 gb|ESR62021.1| hypothetical protein CICLE_v10018029mg, partial [Citrus clementina]
Length=1001

 Score =   161 bits (408),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y  ++  Q+  T   ELY+T+RISP SLRYYG+GL+ G Y V L FAE   +D   + W+
Sbjct  437  YVLNTLGQVTGTRTPELYQTSRISPGSLRYYGLGLENGPYNVSLLFAETNILDRSTERWE  496

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             L RR FD+ IQG    +DF++ +EAGG  RA++K F A V+ N L+IH FWAGKGTCC+
Sbjct  497  SLARRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNATVSENHLEIHLFWAGKGTCCV  556

Query  412  PVQSTFGPIVSAIHVVQ----EVNLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFY  248
            P Q  +GP +SA+ VV      V+    S   +K   G I+GI +     G+++I  +FY
Sbjct  557  PKQGDYGPAISALSVVSAFKPSVSGLPPSTAGNKNHTGLIVGIAVPLGILGLIVISIVFY  616

Query  247  V  245
            +
Sbjct  617  M  617



>gb|EEE68221.1| hypothetical protein OsJ_26393 [Oryza sativa Japonica Group]
Length=890

 Score =   160 bits (405),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 115/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  760  HSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGR  581
            HS  +I N +D EL++TAR+SPSSLRYYG+GL+ G Y V L FAE+   D   +W+ LGR
Sbjct  443  HSGEKIQNAVDSELFQTARMSPSSLRYYGLGLENGNYTVLLKFAELGFPDTP-TWQSLGR  501

Query  580  RYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQ  404
            R+FD+ IQGE   +DFN+++ AGG S  A+ K +   V+ N L+IH FWAGKGTCCIP+Q
Sbjct  502  RFFDIYIQGELKEKDFNIRKMAGGKSFTAVYKSYTTTVSKNFLEIHLFWAGKGTCCIPIQ  561

Query  403  STFGPIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITL-GSAAGVLIICSIFYV  245
              +GP++SA+ +    +     +G  KK  + G I+GI +  S  G  I+  IF V
Sbjct  562  GYYGPLISALSITPNFS-PTVRNGVPKKKSKAGAIVGIVIAASVLGSAILFGIFMV  616



>gb|AAF02839.1|AC009894_10 Similar to serine/threonine kinases [Arabidopsis thaliana]
Length=889

 Score =   160 bits (405),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 121/184 (66%), Gaps = 6/184 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NT D EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  352  YIALSATQFANTSDSELFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  410

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++++ A GS  R + + +KANV+ N L++H FWAGKGTCCI
Sbjct  411  LGRRIFDIYVQGKLVEKDFDMQKAANGSSIRVIQRVYKANVSENYLEVHLFWAGKGTCCI  470

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP+VSAI    +    + +      KK +  I+G  +G  AG+L I  I  + +
Sbjct  471  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKNIVIIVGAIVG--AGMLCILVIAILLF  528

Query  238  TKKK  227
             ++K
Sbjct  529  IRRK  532



>ref|NP_564710.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|ACN59259.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33349.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1012

 Score =   160 bits (406),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 121/184 (66%), Gaps = 6/184 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NT D EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  475  YIALSATQFANTSDSELFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  533

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++++ A GS  R + + +KANV+ N L++H FWAGKGTCCI
Sbjct  534  LGRRIFDIYVQGKLVEKDFDMQKAANGSSIRVIQRVYKANVSENYLEVHLFWAGKGTCCI  593

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP+VSAI    +    + +      KK +  I+G  +G  AG+L I  I  + +
Sbjct  594  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKNIVIIVGAIVG--AGMLCILVIAILLF  651

Query  238  TKKK  227
             ++K
Sbjct  652  IRRK  655



>gb|EYU33781.1| hypothetical protein MIMGU_mgv1a000612mg [Erythranthe guttata]
Length=1044

 Score =   160 bits (406),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 115/178 (65%), Gaps = 5/178 (3%)
 Frame = -2

Query  748  QIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYFD  569
            Q  NTLD EL++TARIS  SLRYYG+GL+ G Y V L FAE Q+    ++W+ LGRR FD
Sbjct  490  QFTNTLDSELFRTARISAGSLRYYGLGLENGNYTVRLQFAEAQIQG-TNTWRSLGRRVFD  548

Query  568  VSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFG  392
            + IQG   ++DF+ ++EA G S RA+  +F   V+ N ++IH FWAGKGTCC+P Q+ +G
Sbjct  549  IYIQGSLAVKDFDARREANGVSLRAVTMEFPVLVSENYMEIHLFWAGKGTCCVPAQAVYG  608

Query  391  PIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSA-AGVLIICSIFYVWWTKKK  227
            P +SAI    +    + ++  GS K   G I+GI +  A    L + +++YV+  +KK
Sbjct  609  PSISAISAKSDFPSTVSNNPPGSKKNHTGLIVGIVVAVAFVSFLSLGAVYYVYRRRKK  666



>ref|NP_001185247.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AEE33350.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1039

 Score =   160 bits (406),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 121/184 (66%), Gaps = 6/184 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S +Q  NT D EL+++AR+S SSLRYYG+GL+ G Y V + FAEIQ+    ++WK 
Sbjct  475  YIALSATQFANTSDSELFQSARLSASSLRYYGLGLENGGYSVTVQFAEIQIQG-SNTWKS  533

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ +QG+ V +DF++++ A GS  R + + +KANV+ N L++H FWAGKGTCCI
Sbjct  534  LGRRIFDIYVQGKLVEKDFDMQKAANGSSIRVIQRVYKANVSENYLEVHLFWAGKGTCCI  593

Query  412  PVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q T+GP+VSAI    +    + +      KK +  I+G  +G  AG+L I  I  + +
Sbjct  594  PAQGTYGPLVSAISATPDFIPTVKNKLPSKSKKNIVIIVGAIVG--AGMLCILVIAILLF  651

Query  238  TKKK  227
             ++K
Sbjct  652  IRRK  655



>ref|XP_004516051.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X3 [Cicer arietinum]
Length=885

 Score =   160 bits (405),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYF  572
            +Q   TL+ EL++TAR+S SSLRYYG+GL+ G Y + L FAE  + D   +WK LGRR F
Sbjct  339  NQFTGTLNPELFQTARLSASSLRYYGLGLENGFYNITLQFAETAILD-STTWKSLGRRVF  397

Query  571  DVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            D+ IQG  VL+DF++++EAGG S +A+ K F+  V  N L+IH FWAGKGTCCIP Q T+
Sbjct  398  DIYIQGTLVLKDFDIQREAGGISYKAVQKHFRFQVKENYLEIHLFWAGKGTCCIPGQGTY  457

Query  394  GPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFYV  245
            GP++ AI    +    + +    S   + G IIGI  G      L++ +IFY+
Sbjct  458  GPLIQAISASPDFVPTVSNKPPSSKNNKAGLIIGIVAGVGVVCFLVVFAIFYI  510



>ref|XP_009409824.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Musa acuminata subsp. malaccensis]
Length=768

 Score =   159 bits (402),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 100/136 (74%), Gaps = 2/136 (1%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S SQ  NTL+ ELY+TARISPSSLRYYG+GL+ G Y V+LHFAE Q+ D   +WK
Sbjct  484  DYILYSLSQFTNTLESELYQTARISPSSLRYYGLGLQNGNYTVKLHFAETQILD-PPTWK  542

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAG-GSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
              GRR FD+ IQG    +DF++++EAG  S  A++K++ A VT N L+IHFFWAGKGTCC
Sbjct  543  SNGRRIFDIYIQGNLREKDFDIRKEAGEKSLAAVIKEYVAPVTGNFLEIHFFWAGKGTCC  602

Query  415  IPVQSTFGPIVSAIHV  368
            +P Q  +G  +SAI V
Sbjct  603  VPTQGYYGGSISAISV  618



>ref|XP_002273016.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Vitis vinifera]
Length=1048

 Score =   160 bits (406),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 115/181 (64%), Gaps = 6/181 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWK  593
            Y  ++  Q+ +T   EL++T+R+SP SLRYYG+GL+ G Y V L FAE +      ++W+
Sbjct  486  YLENNLKQVADTSTPELFQTSRVSPGSLRYYGLGLENGNYTVSLEFAETKFASRSTETWE  545

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LGRR FD+ IQG   L+DF++ +EAGG  +AL KKF A V+ N L+IH FWAGKGTCCI
Sbjct  546  SLGRRVFDIYIQGSLQLKDFDISKEAGGVDKALEKKFNATVSENYLEIHLFWAGKGTCCI  605

Query  412  PVQSTFGPIVSAIHVVQEVNLD----DSSDGSDKKRVGKIIGITLGSAAGVLI-ICSIFY  248
            PVQ  +GP +SA+ VV +         S   S K   G I+G+ +   +   I IC++FY
Sbjct  606  PVQGYYGPSISALSVVSDFTPSVSGIPSIPPSKKNNTGLIVGVVVAVGSVSFILICAVFY  665

Query  247  V  245
            +
Sbjct  666  M  666



>ref|NP_001061223.1| Os08g0203400 [Oryza sativa Japonica Group]
 dbj|BAD02996.1| putative Receptor-like serine/threonine kinase(RFK1) [Oryza sativa 
Japonica Group]
 dbj|BAF23137.1| Os08g0203400 [Oryza sativa Japonica Group]
 dbj|BAG91108.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1024

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 115/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  760  HSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGR  581
            HS  +I N +D EL++TAR+SPSSLRYYG+GL+ G Y V L FAE+   D   +W+ LGR
Sbjct  482  HSGEKIQNAVDSELFQTARMSPSSLRYYGLGLENGNYTVLLKFAELGFPDTP-TWQSLGR  540

Query  580  RYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQ  404
            R+FD+ IQGE   +DFN+++ AGG S  A+ K +   V+ N L+IH FWAGKGTCCIP+Q
Sbjct  541  RFFDIYIQGELKEKDFNIRKMAGGKSFTAVYKSYTTTVSKNFLEIHLFWAGKGTCCIPIQ  600

Query  403  STFGPIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITL-GSAAGVLIICSIFYV  245
              +GP++SA+ +    +     +G  KK  + G I+GI +  S  G  I+  IF V
Sbjct  601  GYYGPLISALSITPNFS-PTVRNGVPKKKSKAGAIVGIVIAASVLGSAILFGIFMV  655



>ref|XP_004516049.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X1 [Cicer arietinum]
Length=1030

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYF  572
            +Q   TL+ EL++TAR+S SSLRYYG+GL+ G Y + L FAE  + D   +WK LGRR F
Sbjct  484  NQFTGTLNPELFQTARLSASSLRYYGLGLENGFYNITLQFAETAILD-STTWKSLGRRVF  542

Query  571  DVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            D+ IQG  VL+DF++++EAGG S +A+ K F+  V  N L+IH FWAGKGTCCIP Q T+
Sbjct  543  DIYIQGTLVLKDFDIQREAGGISYKAVQKHFRFQVKENYLEIHLFWAGKGTCCIPGQGTY  602

Query  394  GPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFYV  245
            GP++ AI    +    + +    S   + G IIGI  G      L++ +IFY+
Sbjct  603  GPLIQAISASPDFVPTVSNKPPSSKNNKAGLIIGIVAGVGVVCFLVVFAIFYI  655



>ref|XP_010941603.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Elaeis guineensis]
Length=1061

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 115/188 (61%), Gaps = 7/188 (4%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            NY     SQ  NTLD EL++TAR+SPSSLRYYG+GL+ G Y V+L FAE    +   SWK
Sbjct  501  NYIISILSQFENTLDPELFQTARLSPSSLRYYGIGLQNGNYTVKLQFAETAYLN-PPSWK  559

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             +GRR FD+ IQG    +DF++++EAGGS   A+VK+F   VT N L++HFFWAGKGTCC
Sbjct  560  SVGRRVFDIYIQGALKEKDFDIRKEAGGSSFVAVVKEFTVPVTKNFLELHFFWAGKGTCC  619

Query  415  IPVQSTFGPIVSAIHV-----VQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIF  251
            +P Q  +G  VSAI V        V     +  S KK  G I+GI    A   L+     
Sbjct  620  VPTQGYYGASVSAISVSPHDFTPTVPNKLPTKSSTKKHTGLIVGIVAALAGLGLLAIFGT  679

Query  250  YVWWTKKK  227
            ++W  KK+
Sbjct  680  FIWRQKKR  687



>ref|XP_009771802.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Nicotiana sylvestris]
Length=1038

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSW  596
            Q++T+ S SQ  NTLD EL++TARIS  SLRYYG+GL+ G Y V L FAE Q+ +   +W
Sbjct  485  QDFTSFSSSQFTNTLDSELFQTARISAGSLRYYGLGLENGNYTVNLQFAESQILN-PPTW  543

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            + LGRR FDV +QG R L+DF++++EA G S RA+ K+FK  V+ N L+IH FWAGKGTC
Sbjct  544  RSLGRRVFDVYVQGIRELKDFDIRKEADGRSLRAVQKQFKVQVSENHLEIHLFWAGKGTC  603

Query  418  CIPVQSTFGPIVSAIHVVQE  359
            C+P Q T+GP +SAI    +
Sbjct  604  CVPRQGTYGPSISAISATPD  623



>ref|XP_008353269.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Malus domestica]
Length=671

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 100/146 (68%), Gaps = 2/146 (1%)
 Frame = -2

Query  724  ELYKTARISPSSLRYYGVGLKKGIYRVELHFAE-IQMDDIKDSWKGLGRRYFDVSIQGER  548
            EL++T+R+S  SLRYYG+GL+ G+Y V LHFAE +       +W+ LGRR FD+ IQG R
Sbjct  514  ELFQTSRVSTGSLRYYGLGLENGLYTVTLHFAETVYKSRTSQTWQSLGRRVFDIYIQGTR  573

Query  547  VLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHV  368
             ++DF++ +EAGG  RA+V+KF  +V+ N L+IH FWAGKGTCCIP    +GP+++ +H 
Sbjct  574  KMKDFDISKEAGGVNRAVVRKFNVSVSENYLEIHLFWAGKGTCCIPNYGDYGPLIAVVHA  633

Query  367  VQEVNLDDSSDGSDKKRVGKIIGITL  290
                 L  ++ G  K R G I+GI +
Sbjct  634  ASVSGLPPTTPG-KKSRTGLIVGIAV  658


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 13/90 (14%)
 Frame = -2

Query  493  VKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRV  314
            +K+F  +V+ N L+IH FWAGKGTCCIP Q  +GP+++A+H   +               
Sbjct  1    MKRFNVSVSENYLEIHLFWAGKGTCCIPEQGDYGPLIAAVHAASDF-------------T  47

Query  313  GKIIGITLGSAAGVLIICSIFYVWWTKKKS  224
              + G+     + V  + SIF  W T+  S
Sbjct  48   PTVAGLPTTDPSEVRALNSIFEQWDTQAMS  77



>gb|KDP36457.1| hypothetical protein JCGZ_08587 [Jatropha curcas]
Length=1041

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 118/186 (63%), Gaps = 6/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS-WK  593
            Y   + SQ+ +T   + Y T+R+SP S+RYYG+GL+ G Y + L FAE  +       W+
Sbjct  478  YVEDTLSQVTSTNTPDFYLTSRVSPGSIRYYGLGLENGPYTISLLFAETSLKHRSSQIWE  537

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             +GRR FD+ IQG R L+DF++ +EAGG + A+ + F A V++N L+IH FWAGKGTCC 
Sbjct  538  SVGRRVFDIYIQGSRELKDFDISKEAGGVEIAITRDFNATVSDNHLEIHLFWAGKGTCCT  597

Query  412  PVQSTFGPIVSAIHVVQEVNLDDSSDG---SDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            P+   +GPI+SA++VV       S        K R G IIGI++  +AGV+I   IF ++
Sbjct  598  PIPGNYGPIISALNVVPGFTPTVSGRPLGTRQKSRQGLIIGISV--SAGVMIFILIFAIF  655

Query  241  WTKKKS  224
            + K+++
Sbjct  656  YIKRRA  661



>ref|XP_004516050.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X2 [Cicer arietinum]
Length=1021

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 112/173 (65%), Gaps = 5/173 (3%)
 Frame = -2

Query  751  SQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYF  572
            +Q   TL+ EL++TAR+S SSLRYYG+GL+ G Y + L FAE  + D   +WK LGRR F
Sbjct  475  NQFTGTLNPELFQTARLSASSLRYYGLGLENGFYNITLQFAETAILD-STTWKSLGRRVF  533

Query  571  DVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTF  395
            D+ IQG  VL+DF++++EAGG S +A+ K F+  V  N L+IH FWAGKGTCCIP Q T+
Sbjct  534  DIYIQGTLVLKDFDIQREAGGISYKAVQKHFRFQVKENYLEIHLFWAGKGTCCIPGQGTY  593

Query  394  GPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIFYV  245
            GP++ AI    +    + +    S   + G IIGI  G      L++ +IFY+
Sbjct  594  GPLIQAISASPDFVPTVSNKPPSSKNNKAGLIIGIVAGVGVVCFLVVFAIFYI  646



>gb|EEE61688.1| hypothetical protein OsJ_16161 [Oryza sativa Japonica Group]
Length=914

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            NY  +S  Q  NTLD EL++T+R+SPSSLRYYG+GL+ G Y V L FAE  ++D + SWK
Sbjct  368  NYIIYSSRQFQNTLDSELFQTSRMSPSSLRYYGIGLENGNYTVTLQFAEFGIEDTQ-SWK  426

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTCC  416
             LGRR FD+ +QGER  ++F++++ AG     +VKK +K  VT N L+IH FWAGKGTCC
Sbjct  427  SLGRRVFDIYVQGERKEKNFDIRKTAGDKSYTVVKKQYKVPVTKNFLEIHLFWAGKGTCC  486

Query  415  IPVQSTFGPIVSAIHVV  365
            IP Q  +GP +SA+ V+
Sbjct  487  IPTQGYYGPTISALSVI  503



>ref|XP_010244452.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X6 [Nelumbo nucifera]
Length=911

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y  ++ SQI  T  L  E ++T+R+SP SLRY G+GL+ GIY V L FAE ++ D   +
Sbjct  384  SYFQNTLSQIAGTGILTTEFFQTSRLSPGSLRYCGLGLENGIYTVSLWFAETKISDASSE  443

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKG  425
            SW+ LGRR FD+ IQ +  L+DF++++EAGG S +A+ K+FKANV+ N ++IH FWAGKG
Sbjct  444  SWRSLGRRVFDIYIQRDLQLKDFDIRKEAGGASNKAVQKEFKANVSENFIEIHLFWAGKG  503

Query  424  TCCIPVQSTFGPIVSAIHVVQEVN--------LDDSSDGSDKKRVGKIIGITLGSAAGVL  269
            TCCIP Q  +GP +SA+ V  +             +S+G  +  VG ++G+T+ S   V+
Sbjct  504  TCCIPEQGYYGPSISALAVTSDFTPTVSGLPPTTTTSEGKTELIVGLVVGVTVASLLAVI  563

Query  268  II  263
            + 
Sbjct  564  VF  565



>ref|XP_010244453.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X7 [Nelumbo nucifera]
Length=887

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y  ++ SQI  T  L  E ++T+R+SP SLRY G+GL+ GIY V L FAE ++ D   +
Sbjct  360  SYFQNTLSQIAGTGILTTEFFQTSRLSPGSLRYCGLGLENGIYTVSLWFAETKISDASSE  419

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKG  425
            SW+ LGRR FD+ IQ +  L+DF++++EAGG S +A+ K+FKANV+ N ++IH FWAGKG
Sbjct  420  SWRSLGRRVFDIYIQRDLQLKDFDIRKEAGGASNKAVQKEFKANVSENFIEIHLFWAGKG  479

Query  424  TCCIPVQSTFGPIVSAIHVVQEVN--------LDDSSDGSDKKRVGKIIGITLGSAAGVL  269
            TCCIP Q  +GP +SA+ V  +             +S+G  +  VG ++G+T+ S   V+
Sbjct  480  TCCIPEQGYYGPSISALAVTSDFTPTVSGLPPTTTTSEGKTELIVGLVVGVTVASLLAVI  539

Query  268  II  263
            + 
Sbjct  540  VF  541



>ref|XP_010244456.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X9 [Nelumbo nucifera]
Length=839

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y  ++ SQI  T  L  E ++T+R+SP SLRY G+GL+ GIY V L FAE ++ D   +
Sbjct  312  SYFQNTLSQIAGTGILTTEFFQTSRLSPGSLRYCGLGLENGIYTVSLWFAETKISDASSE  371

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKG  425
            SW+ LGRR FD+ IQ +  L+DF++++EAGG S +A+ K+FKANV+ N ++IH FWAGKG
Sbjct  372  SWRSLGRRVFDIYIQRDLQLKDFDIRKEAGGASNKAVQKEFKANVSENFIEIHLFWAGKG  431

Query  424  TCCIPVQSTFGPIVSAIHVVQEVN--------LDDSSDGSDKKRVGKIIGITLGSAAGVL  269
            TCCIP Q  +GP +SA+ V  +             +S+G  +  VG ++G+T+ S   V+
Sbjct  432  TCCIPEQGYYGPSISALAVTSDFTPTVSGLPPTTTTSEGKTELIVGLVVGVTVASLLAVI  491

Query  268  II  263
            + 
Sbjct  492  VF  493



>ref|XP_006448778.1| hypothetical protein CICLE_v10014641mg [Citrus clementina]
 gb|ESR62018.1| hypothetical protein CICLE_v10014641mg [Citrus clementina]
Length=608

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 112/182 (62%), Gaps = 8/182 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y  ++ +Q+  T   ELY+T+RISP SLRYYG+GL+ G Y+V L FAE   +D   + W+
Sbjct  44   YVLNTLAQMTGTRTPELYQTSRISPGSLRYYGLGLENGPYKVSLLFAEASILDRSTERWE  103

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LG R FD+ IQG    +DF++ +EAGG  RA++K F A V+ N L+IH  WAGKGTCC+
Sbjct  104  SLGTRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNAAVSENHLEIHLLWAGKGTCCV  163

Query  412  PVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIF  251
            P Q  +GP +SA+  V         L   + G +K   G I+GI +     G+++I  +F
Sbjct  164  PTQGDYGPAISALSAVSAFKPSVSGLPPGTPG-NKNHTGMIVGIAVPLGILGLIVISIVF  222

Query  250  YV  245
            Y+
Sbjct  223  YM  224



>ref|XP_010244449.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Nelumbo nucifera]
Length=935

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y  ++ SQI  T  L  E ++T+R+SP SLRY G+GL+ GIY V L FAE ++ D   +
Sbjct  408  SYFQNTLSQIAGTGILTTEFFQTSRLSPGSLRYCGLGLENGIYTVSLWFAETKISDASSE  467

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKG  425
            SW+ LGRR FD+ IQ +  L+DF++++EAGG S +A+ K+FKANV+ N ++IH FWAGKG
Sbjct  468  SWRSLGRRVFDIYIQRDLQLKDFDIRKEAGGASNKAVQKEFKANVSENFIEIHLFWAGKG  527

Query  424  TCCIPVQSTFGPIVSAIHVVQEVN--------LDDSSDGSDKKRVGKIIGITLGSAAGVL  269
            TCCIP Q  +GP +SA+ V  +             +S+G  +  VG ++G+T+ S   V+
Sbjct  528  TCCIPEQGYYGPSISALAVTSDFTPTVSGLPPTTTTSEGKTELIVGLVVGVTVASLLAVI  587

Query  268  II  263
            + 
Sbjct  588  VF  589



>emb|CBI39037.3| unnamed protein product [Vitis vinifera]
Length=1003

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 113/177 (64%), Gaps = 7/177 (4%)
 Frame = -2

Query  763  AHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-SWKGL  587
            A++ S +  T   EL+KT+RISP SLRYYG+GLK G Y V L FAE+ + D    +W+  
Sbjct  462  ANTSSLVNGTDTPELFKTSRISPGSLRYYGLGLKNGPYVVSLQFAEMLLKDPSTRTWEST  521

Query  586  GRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPV  407
            GRR FD+ IQG    +DF++ +EAGG +RA+VKKF   V+ N L+IH  WAGKGTCCIP 
Sbjct  522  GRRVFDIYIQGALKEKDFDISKEAGGVQRAIVKKFNTTVSKNYLEIHLLWAGKGTCCIPF  581

Query  406  QSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVL---IICSIFYV  245
            +  +GP +SA+ VV  +        S+    G I GI +   AG+L   ++C++FY+
Sbjct  582  EGYYGPSISALSVVSALE-RMPPPPSETSNTGLIAGIAV--TAGILCFILVCAVFYI  635



>ref|XP_010244454.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X8 [Nelumbo nucifera]
Length=887

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y  ++ SQI  T  L  E ++T+R+SP SLRY G+GL+ GIY V L FAE ++ D   +
Sbjct  360  SYFQNTLSQIAGTGILTTEFFQTSRLSPGSLRYCGLGLENGIYTVSLWFAETKISDASSE  419

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKG  425
            SW+ LGRR FD+ IQ +  L+DF++++EAGG S +A+ K+FKANV+ N ++IH FWAGKG
Sbjct  420  SWRSLGRRVFDIYIQRDLQLKDFDIRKEAGGASNKAVQKEFKANVSENFIEIHLFWAGKG  479

Query  424  TCCIPVQSTFGPIVSAIHVVQEVN--------LDDSSDGSDKKRVGKIIGITLGSAAGVL  269
            TCCIP Q  +GP +SA+ V  +             +S+G  +  VG ++G+T+ S   V+
Sbjct  480  TCCIPEQGYYGPSISALAVTSDFTPTVSGLPPTTTTSEGKTELIVGLVVGVTVASLLAVI  539

Query  268  II  263
            + 
Sbjct  540  VF  541



>ref|XP_003633055.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Vitis vinifera]
Length=1007

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 113/177 (64%), Gaps = 7/177 (4%)
 Frame = -2

Query  763  AHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-SWKGL  587
            A++ S +  T   EL+KT+RISP SLRYYG+GLK G Y V L FAE+ + D    +W+  
Sbjct  466  ANTSSLVNGTDTPELFKTSRISPGSLRYYGLGLKNGPYVVSLQFAEMLLKDPSTRTWEST  525

Query  586  GRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPV  407
            GRR FD+ IQG    +DF++ +EAGG +RA+VKKF   V+ N L+IH  WAGKGTCCIP 
Sbjct  526  GRRVFDIYIQGALKEKDFDISKEAGGVQRAIVKKFNTTVSKNYLEIHLLWAGKGTCCIPF  585

Query  406  QSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVL---IICSIFYV  245
            +  +GP +SA+ VV  +        S+    G I GI +   AG+L   ++C++FY+
Sbjct  586  EGYYGPSISALSVVSALE-RMPPPPSETSNTGLIAGIAV--TAGILCFILVCAVFYI  639



>ref|XP_010244451.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X5 [Nelumbo nucifera]
Length=911

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y  ++ SQI  T  L  E ++T+R+SP SLRY G+GL+ GIY V L FAE ++ D   +
Sbjct  384  SYFQNTLSQIAGTGILTTEFFQTSRLSPGSLRYCGLGLENGIYTVSLWFAETKISDASSE  443

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKG  425
            SW+ LGRR FD+ IQ +  L+DF++++EAGG S +A+ K+FKANV+ N ++IH FWAGKG
Sbjct  444  SWRSLGRRVFDIYIQRDLQLKDFDIRKEAGGASNKAVQKEFKANVSENFIEIHLFWAGKG  503

Query  424  TCCIPVQSTFGPIVSAIHVVQEVN--------LDDSSDGSDKKRVGKIIGITLGSAAGVL  269
            TCCIP Q  +GP +SA+ V  +             +S+G  +  VG ++G+T+ S   V+
Sbjct  504  TCCIPEQGYYGPSISALAVTSDFTPTVSGLPPTTTTSEGKTELIVGLVVGVTVASLLAVI  563

Query  268  II  263
            + 
Sbjct  564  VF  565



>ref|XP_010244448.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X2 [Nelumbo nucifera]
Length=935

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y  ++ SQI  T  L  E ++T+R+SP SLRY G+GL+ GIY V L FAE ++ D   +
Sbjct  408  SYFQNTLSQIAGTGILTTEFFQTSRLSPGSLRYCGLGLENGIYTVSLWFAETKISDASSE  467

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKG  425
            SW+ LGRR FD+ IQ +  L+DF++++EAGG S +A+ K+FKANV+ N ++IH FWAGKG
Sbjct  468  SWRSLGRRVFDIYIQRDLQLKDFDIRKEAGGASNKAVQKEFKANVSENFIEIHLFWAGKG  527

Query  424  TCCIPVQSTFGPIVSAIHVVQEVN--------LDDSSDGSDKKRVGKIIGITLGSAAGVL  269
            TCCIP Q  +GP +SA+ V  +             +S+G  +  VG ++G+T+ S   V+
Sbjct  528  TCCIPEQGYYGPSISALAVTSDFTPTVSGLPPTTTTSEGKTELIVGLVVGVTVASLLAVI  587

Query  268  II  263
            + 
Sbjct  588  VF  589



>ref|XP_006659918.1| PREDICTED: uncharacterized protein LOC102723075 [Oryza brachyantha]
Length=2000

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 108/153 (71%), Gaps = 5/153 (3%)
 Frame = -2

Query  766  TAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGL  587
            T+H F    NTLD +L++TAR+SPSSLRYYG+GLK G+Y+VEL FAEI   D   +WK +
Sbjct  464  TSHQFM---NTLDSKLFQTARMSPSSLRYYGIGLKNGVYKVELQFAEIFFPD-DQTWKSV  519

Query  586  GRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
            GRR FD+ IQG+ + ++F++K++  G S   +++++  NVT N +DIH FWAGKGTCCIP
Sbjct  520  GRRIFDIYIQGQLIEKNFDIKKQTNGKSYTVVLRQYIINVTENFMDIHLFWAGKGTCCIP  579

Query  409  VQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVG  311
             Q  +GP +SA+ V    + ++   GS+K  +G
Sbjct  580  TQGFYGPSISALSVTPYGSNNEVDRGSNKNSIG  612


 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 92/137 (67%), Gaps = 2/137 (1%)
 Frame = -2

Query  772   NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
             +Y   S  Q  N  D EL++TAR+SPSSLRYYG+GL+ G Y V L FAE    D K +W+
Sbjct  1484  SYLISSPQQFQNANDPELFQTARMSPSSLRYYGLGLENGNYTVLLQFAEFAYPDSK-TWQ  1542

Query  592   GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
               GRR FD+ +QG+   ++F+V++ AGG S  A+ K +   V+ N L+IH FWAGKGTCC
Sbjct  1543  SNGRRVFDIYVQGDLKEKNFDVRKTAGGKSFTAVNKIYNTTVSKNFLEIHLFWAGKGTCC  1602

Query  415   IPVQSTFGPIVSAIHVV  365
             IP Q  +GPI+SA+ V 
Sbjct  1603  IPTQGYYGPIISALSVT  1619



>ref|XP_010244450.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X4 [Nelumbo nucifera]
Length=935

 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y  ++ SQI  T  L  E ++T+R+SP SLRY G+GL+ GIY V L FAE ++ D   +
Sbjct  408  SYFQNTLSQIAGTGILTTEFFQTSRLSPGSLRYCGLGLENGIYTVSLWFAETKISDASSE  467

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKG  425
            SW+ LGRR FD+ IQ +  L+DF++++EAGG S +A+ K+FKANV+ N ++IH FWAGKG
Sbjct  468  SWRSLGRRVFDIYIQRDLQLKDFDIRKEAGGASNKAVQKEFKANVSENFIEIHLFWAGKG  527

Query  424  TCCIPVQSTFGPIVSAIHVVQEVN--------LDDSSDGSDKKRVGKIIGITLGSAAGVL  269
            TCCIP Q  +GP +SA+ V  +             +S+G  +  VG ++G+T+ S   V+
Sbjct  528  TCCIPEQGYYGPSISALAVTSDFTPTVSGLPPTTTTSEGKTELIVGLVVGVTVASLLAVI  587

Query  268  II  263
            + 
Sbjct  588  VF  589



>ref|XP_010244447.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X1 [Nelumbo nucifera]
Length=959

 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 119/182 (65%), Gaps = 12/182 (7%)
 Frame = -2

Query  772  NYTAHSFSQIPNT--LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-D  602
            +Y  ++ SQI  T  L  E ++T+R+SP SLRY G+GL+ GIY V L FAE ++ D   +
Sbjct  432  SYFQNTLSQIAGTGILTTEFFQTSRLSPGSLRYCGLGLENGIYTVSLWFAETKISDASSE  491

Query  601  SWKGLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKG  425
            SW+ LGRR FD+ IQ +  L+DF++++EAGG S +A+ K+FKANV+ N ++IH FWAGKG
Sbjct  492  SWRSLGRRVFDIYIQRDLQLKDFDIRKEAGGASNKAVQKEFKANVSENFIEIHLFWAGKG  551

Query  424  TCCIPVQSTFGPIVSAIHVVQEVN--------LDDSSDGSDKKRVGKIIGITLGSAAGVL  269
            TCCIP Q  +GP +SA+ V  +             +S+G  +  VG ++G+T+ S   V+
Sbjct  552  TCCIPEQGYYGPSISALAVTSDFTPTVSGLPPTTTTSEGKTELIVGLVVGVTVASLLAVI  611

Query  268  II  263
            + 
Sbjct  612  VF  613



>gb|EEC83075.1| hypothetical protein OsI_28198 [Oryza sativa Indica Group]
Length=891

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 114/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  760  HSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGR  581
            HS  +I N +D EL++TAR+SPSSLRYYG+GL+ G Y V L FAE+   D   +W+ LGR
Sbjct  369  HSGEKIQNAVDSELFQTARMSPSSLRYYGLGLENGNYTVLLKFAELGFPDTP-TWQSLGR  427

Query  580  RYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQ  404
            R FD+ IQGE   +DFN+++ AGG S  A+ K +   V+ N L+IH FWAGKGTCCIP+Q
Sbjct  428  RLFDIYIQGELKEKDFNIRKMAGGKSFTAVYKSYTTTVSKNFLEIHLFWAGKGTCCIPIQ  487

Query  403  STFGPIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITL-GSAAGVLIICSIFYV  245
              +GP++SA+ +    +     +G  KK  + G I+GI +  S  G  I+  IF V
Sbjct  488  GYYGPLISALSITPNFS-PTVRNGVPKKKSKAGAIVGIVIAASVLGSAILFGIFMV  542



>ref|XP_006659921.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Oryza brachyantha]
Length=1020

 Score =   159 bits (402),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 117/178 (66%), Gaps = 6/178 (3%)
 Frame = -2

Query  748  QIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGRRYFD  569
            +I N +D EL+ TAR+SPSSLRYYG+GL+ G Y V L FAE+   D   +WK LGRR FD
Sbjct  485  KIQNAVDSELFLTARMSPSSLRYYGLGLENGNYTVLLQFAELGYPD-SPTWKSLGRRVFD  543

Query  568  VSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFG  392
            + IQG+   +DFN+++ AGG S  A+ K + A V+ N L+IH FWAGKGTCCIP+Q  +G
Sbjct  544  IYIQGDLKEKDFNIRETAGGKSFTAVFKSYTATVSKNFLEIHLFWAGKGTCCIPIQGYYG  603

Query  391  PIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITLG-SAAGVLIICSIFYVWWTKKK  227
            P++SA+ +        + +G  K+  + G I+GI +G S  G+ ++  IF +   +K+
Sbjct  604  PLISALSITPNFT-PTARNGVPKRKSKAGAIVGIVIGASVLGLAVLFGIFAIIKKRKR  660



>ref|XP_007211340.1| hypothetical protein PRUPE_ppa001152mg [Prunus persica]
 gb|EMJ12539.1| hypothetical protein PRUPE_ppa001152mg [Prunus persica]
Length=895

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 118/189 (62%), Gaps = 10/189 (5%)
 Frame = -2

Query  772  NYTAHSFSQIPNT-LDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAE-IQMDDIKDS  599
            ++   + +Q+  T +  EL++T+R+SP SLRYYG+GL+ G Y V L FAE +       +
Sbjct  329  SFVETTLTQVTGTDVTPELFQTSRLSPGSLRYYGLGLQNGPYTVTLQFAETVYASRATQT  388

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W+ LGRR FD+ IQG    +DF++ +EAGG  RA+ K FK NV+ N LDIH FWAGKGTC
Sbjct  389  WQSLGRRVFDIYIQGNLRWKDFDISKEAGGVNRAVGKPFKVNVSENYLDIHLFWAGKGTC  448

Query  418  CIPVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLGSAAGVLIICSI  254
            CIP Q  +GP++S +H   +       L  ++ G  K R+G I+GI +   A  L++  +
Sbjct  449  CIPEQGDYGPLISTVHAASDFTPTVSGLPPTTPGK-KSRIGLIVGIAVPVGAVSLLL--L  505

Query  253  FYVWWTKKK  227
            F V + ++K
Sbjct  506  FGVLYMRRK  514



>ref|XP_008368361.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Malus domestica]
Length=888

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query  724  ELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWKGLGRRYFDVSIQGER  548
            EL++T+R+SP SLRYYG+GL+ G+Y V LHFAE   +     +W+ LGRR FD+ IQG  
Sbjct  331  ELFQTSRVSPGSLRYYGLGLENGLYTVTLHFAETVYESRTSQTWQSLGRRVFDIYIQGTC  390

Query  547  VLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHV  368
              +DF++ +EAGG  RA+V+KF  +V  N L+IH FW GKGTCCIP    +GP+++A+H 
Sbjct  391  RTKDFDISKEAGGVNRAVVRKFNVSVLENYLEIHMFWVGKGTCCIPDNGDYGPLIAAVHA  450

Query  367  VQE----VNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWTKKK  227
              +    V+   S+    K R G I+GI +    GV+ +  IF + + ++K
Sbjct  451  ASDFTPTVSRLPSTTPGKKSRTGLIVGIAV--PVGVVSLLLIFAILYIRRK  499



>gb|KCW71355.1| hypothetical protein EUGRSUZ_F04436 [Eucalyptus grandis]
Length=942

 Score =   158 bits (400),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 78/152 (51%), Positives = 103/152 (68%), Gaps = 17/152 (11%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+ + +  WK 
Sbjct  372  YNASSLSQFTNTLDSELFQTARVSASSLRYYGLGLQNGNYNVTLQFAEIQIQNTE--WKR  429

Query  589  LGRRYFDVSIQ--------------GERVLRDFNVKQEA-GGSKRALVKKFKANVTNNVL  455
            LGRR FD+ IQ              G  V++DF++++EA G S  A+   ++A VT N L
Sbjct  430  LGRRLFDIYIQVGPCFTRLLVLLRKGNLVVKDFDIRKEADGASFTAVPTMYQARVTANYL  489

Query  454  DIHFFWAGKGTCCIPVQSTFGPIVSAIHVVQE  359
            +IHFFWAGKGTCC+P Q+T+GP++SAI  V +
Sbjct  490  EIHFFWAGKGTCCVPNQATYGPLISAISAVPD  521



>gb|KDO77511.1| hypothetical protein CISIN_1g0025811mg, partial [Citrus sinensis]
Length=718

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 112/182 (62%), Gaps = 8/182 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y  ++ +Q+  T   ELY+T+RI+P SLRYYG+GL+ G Y+V L FAE   +D   + W+
Sbjct  431  YVLNTLAQMTGTRTPELYQTSRITPGSLRYYGLGLENGPYKVSLLFAETSILDRSTERWE  490

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LG R FD+ IQG    +DF++ +EAGG  RA++K F A V+ N L+IH  WAGKGTCC+
Sbjct  491  SLGTRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNAAVSENHLEIHLLWAGKGTCCV  550

Query  412  PVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIF  251
            P Q  +GP +SA+  V         L   + G +K   G I+GI +     G+++I  +F
Sbjct  551  PTQGDYGPAISALSAVSAFKPSVSGLPPGTPG-NKNHTGMIVGIAVPLGILGLIVISIVF  609

Query  250  YV  245
            Y+
Sbjct  610  YM  611



>gb|AFW56974.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=790

 Score =   157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 117/186 (63%), Gaps = 6/186 (3%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            YT  S  Q  N LD +L++TAR+SPSSLRYYG+GL+ G Y VEL FAE    +   +W+ 
Sbjct  483  YTIDSSEQFQNALDSQLFQTARMSPSSLRYYGIGLENGNYTVELQFAEFAYPE-SPTWQS  541

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             GRR FD+ IQG    ++F++++ AGG S  A+ KK+ A V+ N L+IH FWAGKGTCCI
Sbjct  542  TGRRVFDIYIQGGLKEKNFDIRKTAGGKSYVAVYKKYNATVSKNFLEIHLFWAGKGTCCI  601

Query  412  PVQSTFGPIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITLG-SAAGVLIICSIFYVW  242
            P Q  +GP++SA+ V          +G  KK  + G I+GI +G S  G+  +  IF + 
Sbjct  602  PTQGYYGPMISALSVTPNFT-PTVRNGVPKKKSKAGAIVGIVIGASVLGLAALAGIFMLV  660

Query  241  WTKKKS  224
              ++++
Sbjct  661  QKRRRA  666



>ref|XP_008374902.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Malus domestica]
Length=1005

 Score =   158 bits (400),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 108/168 (64%), Gaps = 11/168 (7%)
 Frame = -2

Query  724  ELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWKGLGRRYFDVSIQGER  548
            EL +T+R SP SLRYYG+GL+ G Y V LHFAE   +     +WK LGRR FD+ IQG R
Sbjct  462  ELIQTSRASPGSLRYYGLGLENGPYTVTLHFAETVYESRTSQTWKSLGRRVFDIYIQGTR  521

Query  547  VLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHV  368
             ++DF++ +EAGG  RA+V KF  NV+ N L+IH FWAGKGTCCIP    +GP+++A+H 
Sbjct  522  RMKDFDISKEAGGVNRAVVIKFNVNVSENYLEIHLFWAGKGTCCIPDSGDYGPLIAAVHA  581

Query  367  VQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWTKKKS  224
                    +SD + K   G IIGI      GV+ +  IF + + +KKS
Sbjct  582  --------ASDFTKKSNTGLIIGI--AVLVGVVSLLLIFAIIYMRKKS  619



>ref|XP_006653770.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Oryza brachyantha]
Length=1113

 Score =   159 bits (401),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S  Q  NTLD EL++T+R+SPSSLRYYG+GL+ G Y V L FAE  ++D + SWK
Sbjct  568  SYIIYSSRQFQNTLDSELFQTSRMSPSSLRYYGIGLENGNYTVTLQFAEFGIEDTQ-SWK  626

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTCC  416
             LGRR FDV +QGER  ++F++++ AG     +V+K +K  VT N LDIH FWAGKGTCC
Sbjct  627  SLGRRVFDVYVQGERKEKNFDIRKTAGDKSYTVVRKQYKVPVTKNFLDIHLFWAGKGTCC  686

Query  415  IPVQSTFGPIVSAIHVV  365
            IP Q  +GP +SA+ ++
Sbjct  687  IPTQGYYGPTISALSII  703



>gb|KDO77509.1| hypothetical protein CISIN_1g0380191mg, partial [Citrus sinensis]
Length=679

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 112/186 (60%), Gaps = 8/186 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-DSWK  593
            Y  ++  Q+  T   +LY+T+RIS  SLRYYG+GL  G Y V L FAE    D   + W+
Sbjct  444  YVLNTQDQVTGTRTPKLYQTSRISAGSLRYYGLGLVNGPYNVSLLFAETNFPDPSTERWE  503

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
              GRR FD+ +QG    +DF++ +EAGG  RA++K F A V+ N L+IH FWAGKGTCCI
Sbjct  504  SRGRRVFDIYVQGTLRWKDFDISKEAGGPNRAIIKNFSATVSENHLEIHLFWAGKGTCCI  563

Query  412  PVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIF  251
            P Q  +GP +SA+ VV         L  S+ G +K   G I+GI +     G+++I  +F
Sbjct  564  PKQGNYGPAISALSVVSAFKPSVSGLPPSTPG-NKNHTGLIVGIAVPLGILGLIVISIMF  622

Query  250  YVWWTK  233
            Y+W  K
Sbjct  623  YLWREK  628



>ref|XP_009389705.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Musa acuminata subsp. malaccensis]
Length=599

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +YT +S SQ   T + ELY+TARISPSSLRYYG+GL+ G Y V LHFAE ++ D   +WK
Sbjct  451  DYTQYSSSQFQKTQEPELYQTARISPSSLRYYGLGLENGNYTVMLHFAETRIPD-PPTWK  509

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
              GRR FD+ IQG  VL+DF+++ E   S  A+ +KF   VT+N L+IHFFWAGKGTCC+
Sbjct  510  STGRRIFDIYIQGNLVLKDFDIRAEE-NSLTAVTRKFIVPVTDNFLEIHFFWAGKGTCCV  568

Query  412  PVQSTFGPIVSAIHV  368
            P Q  +G  VSAI V
Sbjct  569  PDQGYYGSSVSAISV  583



>emb|CAJ86314.1| H0525G02.11 [Oryza sativa Indica Group]
Length=938

 Score =   158 bits (399),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S  Q  NTLD EL++T+R+SPSSLRYYG+GL+ G Y V L FAE  ++D + SWK
Sbjct  392  SYIIYSSRQFQNTLDSELFQTSRMSPSSLRYYGIGLENGNYTVTLQFAEFGIEDTQ-SWK  450

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTCC  416
             LGRR FD+ +QGER  ++F++++ AG     +VKK +K  VT N L+IH FWAGKGTCC
Sbjct  451  SLGRRVFDIYVQGERKEKNFDIRKTAGDKSYTVVKKQYKVPVTKNFLEIHLFWAGKGTCC  510

Query  415  IPVQSTFGPIVSAIHVV  365
            IP Q  +GP +SA+ V+
Sbjct  511  IPTQGYYGPTISALSVI  527



>ref|XP_006847777.1| hypothetical protein AMTR_s00162p00061440, partial [Amborella 
trichopoda]
 gb|ERN09358.1| hypothetical protein AMTR_s00162p00061440, partial [Amborella 
trichopoda]
Length=308

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 109/175 (62%), Gaps = 3/175 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y   S S +    + ELY TAR S  SL YYG+ L+ G Y V+LHFAEIQ  D   ++  
Sbjct  85   YVPRSMSNLLAQKNIELYSTARASAMSLSYYGLCLQNGSYTVDLHFAEIQFTD-DHTFSS  143

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIP  410
            LG+R FDV IQG++VL DFN++ EA G    + + F  +VT++ L+IHF+WAGKGT  IP
Sbjct  144  LGKRIFDVYIQGKKVLTDFNIRTEAKGPGIGINRTFTTDVTDHTLEIHFYWAGKGTTSIP  203

Query  409  VQSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYV  245
             +S +GP+VSAI V    N     DG DK   G I+GI + S+  V +I ++ Y+
Sbjct  204  WRSFYGPLVSAIRVTP--NFIPEIDGDDKFSTGAIVGIVVCSSFVVFLILALLYM  256



>gb|EMT28000.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=925

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 115/185 (62%), Gaps = 4/185 (2%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S  Q  NTLD EL++ AR+SPSSLRY+G+GL+ G Y V L FAE    D   SWK
Sbjct  381  SYIIYSSRQFLNTLDTELFRNARMSPSSLRYFGIGLENGNYTVTLQFAEFDFPD-GQSWK  439

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
              GRR FD+ +QG R  ++F++++ AGG S  A+ K++   VT N L+IH FWAGKGTCC
Sbjct  440  STGRRVFDIYVQGVRKEQNFDIRKTAGGKSYTAVRKQYIVPVTKNFLEIHLFWAGKGTCC  499

Query  415  IPVQSTFGPIVSAIHVVQEV--NLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVW  242
            IP Q  +GP +SA+         + +++   +  + G I+G+ +G A   L+  +  +VW
Sbjct  500  IPTQGYYGPAISALSATPNFTPTVRNAAAKKNGSKTGMIVGVIVGLAVLGLVAFAAIFVW  559

Query  241  WTKKK  227
              KK+
Sbjct  560  RQKKR  564



>ref|XP_010645976.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Vitis vinifera]
Length=1074

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 113/178 (63%), Gaps = 7/178 (4%)
 Frame = -2

Query  757  SFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-DSWKGLGR  581
            + SQ+  T + +L++T+RISP SLRYYG+GL  G Y V L FAE    D    +W+  GR
Sbjct  535  ALSQVKGTKNPKLFETSRISPGSLRYYGLGLVNGPYTVSLLFAETTFKDPSTQTWQSRGR  594

Query  580  RYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQS  401
            R FD+ IQG    +DF++ +EAGG ++AL KKFKA V+ N L+IH FWAGKGTCCIPVQ 
Sbjct  595  RVFDIYIQGMLEYKDFDISREAGGVEKALEKKFKATVSENYLEIHLFWAGKGTCCIPVQG  654

Query  400  TFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWTKKK  227
             +GP +SA+ VV ++    +     K + G IIG    +AAG++    +    + K+K
Sbjct  655  YYGPSISALTVVPDL----TRIPPKKHKTGLIIG--FAAAAGIVSFMLVLAACYMKRK  706



>ref|XP_006448777.1| hypothetical protein CICLE_v10018038mg, partial [Citrus clementina]
 gb|ESR62017.1| hypothetical protein CICLE_v10018038mg, partial [Citrus clementina]
Length=1001

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 110/182 (60%), Gaps = 8/182 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-DSWK  593
            Y  ++ +Q+  T   ELY+T+RIS  SLRYYG+GL  G Y V L FAE    D   + W+
Sbjct  437  YVLNTLAQVTGTRTPELYQTSRISAGSLRYYGLGLVNGPYNVSLLFAETNFPDPSTERWE  496

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LGRR FD+ +QG    +DF++ +EAGG  RA++K F A V+ N L+IH FWAGKGTCCI
Sbjct  497  SLGRRVFDIYVQGRLQWKDFDISKEAGGPNRAIIKNFSATVSENHLEIHLFWAGKGTCCI  556

Query  412  PVQSTFGPIVSAIHVVQEV-----NLDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIF  251
            P Q  +GP +SA+ VV         L  S+ G  K   G I+GI +     G ++I  +F
Sbjct  557  PEQGNYGPAISALSVVSAFPPTASGLPPSTPGK-KSHTGLIVGIAVPLGILGSVVISIVF  615

Query  250  YV  245
            Y+
Sbjct  616  YM  617



>ref|XP_009106800.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Brassica rapa]
Length=1025

 Score =   157 bits (397),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 118/180 (66%), Gaps = 13/180 (7%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQM-DDIKDSWK  593
            Y     SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ+     ++W+
Sbjct  474  YIVTLLSQFINTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQIIGSSSNTWR  533

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGS-KRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            G+GRR FD+ +QG  V RDF++++ A  S  RA+ +++K NV+ N ++IH FWAGKGTCC
Sbjct  534  GIGRRRFDIYVQGRLVERDFDIRRTANDSIVRAVEREYKVNVSENYIEIHLFWAGKGTCC  593

Query  415  IPVQSTFGPIVSAIHV----VQEVNLDDSSDGSDKKRVGKIIGITLGSA-----AGVLII  263
            IP+Q  +GP++SA+      +  V     S G++  R G I+G+ +G       AGV+I+
Sbjct  594  IPIQGAYGPLISAVSAKPDFIPTVANKPPSKGNN--RTGTILGVIVGLGLLSIIAGVVIL  651



>ref|XP_008662731.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Zea mays]
 ref|XP_008662732.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 [Zea mays]
Length=1029

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 118/187 (63%), Gaps = 6/187 (3%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +YT  S  Q  N LD +L++TAR+SPSSLRYYG+GL+ G Y VEL FAE    +   +W+
Sbjct  482  SYTIDSSEQFQNALDSQLFQTARMSPSSLRYYGIGLENGNYTVELQFAEFAYPE-SPTWQ  540

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
              GRR FD+ IQG    ++F++++ AGG S  A+ KK+ A V+ N L+IH FWAGKGTCC
Sbjct  541  STGRRVFDIYIQGGLKEKNFDIRKTAGGKSYVAVYKKYNATVSKNFLEIHLFWAGKGTCC  600

Query  415  IPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITLG-SAAGVLIICSIFYV  245
            IP Q  +GP++SA+ V          +G  KK  + G I+GI +G S  G+  +  IF +
Sbjct  601  IPTQGYYGPMISALSVTPNFT-PTVRNGVPKKKSKAGAIVGIVIGASVLGLAALAGIFML  659

Query  244  WWTKKKS  224
               ++++
Sbjct  660  VQKRRRA  666



>ref|XP_010098477.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB75137.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=932

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 110/171 (64%), Gaps = 9/171 (5%)
 Frame = -2

Query  736  TLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS-WKGLGRRYFDVSI  560
            T + EL+ TAR+ P SLRYYG+GL  G Y + LHFAEI   +     W GL RR FD+ I
Sbjct  410  TENPELFHTARMCPGSLRYYGLGLVNGNYTITLHFAEIGFPNRNSQKWAGLARRIFDIYI  469

Query  559  QGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVS  380
            QG    +DF + +EAGG +RA+VKKF   V+ N L+IH FWAGKGTCCIP Q  +GP+++
Sbjct  470  QGSLEQKDFEIAKEAGGVERAIVKKFHVTVSENYLEIHLFWAGKGTCCIPEQGYYGPLIA  529

Query  379  AIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLGSA-AGVLIICSIFYV  245
            AIHV  +       + +++ G +K   G I+GIT+      +L++ ++FY+
Sbjct  530  AIHVASDFTPTFSGIRETTQGDNK--TGLILGITVPVVFVCLLLLAAVFYM  578



>gb|EEC78008.1| hypothetical protein OsI_17411 [Oryza sativa Indica Group]
Length=1930

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  772   NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
             +Y  +S  Q  NTLD EL++T+R+SPSSLRYYG+GL+ G Y V L FAE  ++D + SWK
Sbjct  1384  SYIIYSSRQFQNTLDSELFQTSRMSPSSLRYYGIGLENGNYTVTLQFAEFGIEDTQ-SWK  1442

Query  592   GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTCC  416
              LGRR FD+ +QGER  ++F++++ AG     +VKK +K  VT N L+IH FWAGKGTCC
Sbjct  1443  SLGRRVFDIYVQGERKEKNFDIRKTAGDKSYTVVKKQYKVPVTKNFLEIHLFWAGKGTCC  1502

Query  415   IPVQSTFGPIVSAIHVV  365
             IP Q  +GP +SA+ V+
Sbjct  1503  IPTQGYYGPTISALSVI  1519


 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  +S  Q  +TLD EL++TAR+SPSSLRYYG+GL+ G Y V L FAEI+ +D K SWK 
Sbjct  393  YIFNSSRQFQSTLDPELFQTARLSPSSLRYYGIGLENGNYTVTLQFAEIEFEDTK-SWKS  451

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQGER  R+F++++  GG S  A+ K++   VT N ++IH FWAGKGTCCI
Sbjct  452  LGRRVFDIYIQGERKERNFDIRKATGGKSYTAVKKQYLIPVTKNFVEIHLFWAGKGTCCI  511

Query  412  PVQSTFGPIVSAIHV  368
            P Q  +GP +SA+ +
Sbjct  512  PAQGYYGPSISALSL  526



>ref|XP_011069399.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Sesamum indicum]
Length=654

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y + S SQ  NTLD  L++TARIS  SLRYYG+GL+   Y V L FAE  +   + +W+ 
Sbjct  78   YQSSSLSQFTNTLDSGLFQTARISAGSLRYYGLGLENSNYTVSLQFAETTILGTR-TWRS  136

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGS-KRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG   ++DF++ +EA G+  RA+V++F+  V  N ++IH FWAGKGTCC+
Sbjct  137  VGRRIFDIYVQGNLEMKDFDIVREANGTFLRAVVREFRVEVLENYIEIHLFWAGKGTCCV  196

Query  412  PVQSTFGPIVSAIHVVQEVN--LDDSSDGSDKKRVGKIIGITLGSAAGVLII  263
            P   T+GP++SAI    + N  + ++  G +K R   I+GI +  A   LI+
Sbjct  197  PAFGTYGPLISAISATPDFNPTVSNNPPGGNKNRARLIVGIIVAIAVTSLIL  248



>ref|XP_006468413.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Citrus sinensis]
Length=1054

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 112/182 (62%), Gaps = 8/182 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQ-MDDIKDSWK  593
            Y  ++ +Q+  T   ELY+T+RI+P SLRYYG+GL+ G Y+V L FAE   +D   + W+
Sbjct  490  YVLNTLAQMSGTRTPELYQTSRITPGSLRYYGLGLENGPYKVSLLFAETSILDRSTERWE  549

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
             LG R FD+ IQG    +DF++ +EAGG  RA++K F A V+ N L+IH  WAGKGTCC+
Sbjct  550  SLGTRVFDIYIQGTLRWKDFDISKEAGGPNRAIIKNFNAAVSENHLEIHLLWAGKGTCCV  609

Query  412  PVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIF  251
            P Q  +GP +SA+  V         L   + G +K   G I+GI +     G+++I  +F
Sbjct  610  PTQGDYGPAISALSAVSAFKPSVSGLPPGTPG-NKNHTGMIVGIAVPLGILGLIVISIVF  668

Query  250  YV  245
            Y+
Sbjct  669  YM  670



>ref|XP_006468410.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X2 [Citrus sinensis]
Length=893

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 113/187 (60%), Gaps = 8/187 (4%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-DSW  596
            +Y  ++  Q+  T   +LY+T+RIS  SLRYYG+GL  G Y V L FAE    D   + W
Sbjct  328  SYVLNTQDQVTGTRTPKLYQTSRISAGSLRYYGLGLVNGPYNVSLLFAETNFPDPSTERW  387

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            +  GRR FD+ +QG    +DF++ +EAGG  RA++K F A V+ N L+IH FWAGKGTCC
Sbjct  388  ESRGRRVFDIYVQGTLRWKDFDISKEAGGPNRAIIKNFSATVSENHLEIHLFWAGKGTCC  447

Query  415  IPVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSI  254
            IP Q  +GP +SA+ VV         L  S+ G +K   G I+GI +     G+++I  +
Sbjct  448  IPKQGNYGPAISALSVVSAFKPSVSGLPPSTPG-NKNHTGLIVGIAVPLGILGLIVISIM  506

Query  253  FYVWWTK  233
            FY+W  K
Sbjct  507  FYLWREK  513



>ref|XP_002529290.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33093.1| ATP binding protein, putative, partial [Ricinus communis]
Length=609

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 112/181 (62%), Gaps = 5/181 (3%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDS-W  596
            +Y   + SQ+ +T   ELY T+RISP S+RYYG+GL+ G Y + L FAE  +       W
Sbjct  43   SYVEDTQSQVTSTNTPELYLTSRISPGSIRYYGLGLENGPYTISLLFAETALKHRSSQIW  102

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            +  GRR FD+ IQG R L+DF++ +EAGG + A+ K+F   V+ N L+IH FWAGKGTCC
Sbjct  103  ESNGRRVFDIYIQGRRELKDFDISKEAGGVEIAITKRFNITVSENYLEIHLFWAGKGTCC  162

Query  415  IPVQSTFGPIVSAIHVVQEVNLDDS---SDGSDKKRVGKIIGITLG-SAAGVLIICSIFY  248
             P+Q  +GPI+SA+ VV       S    +   + + G I+GI +      +++I ++FY
Sbjct  163  TPIQGYYGPIISALSVVSAFRPTVSGIPPNTQKRSKTGLIVGIAVSVGVVSLMLIFAMFY  222

Query  247  V  245
            +
Sbjct  223  I  223



>gb|KCW71359.1| hypothetical protein EUGRSUZ_F044401, partial [Eucalyptus grandis]
Length=335

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 103/165 (62%), Gaps = 30/165 (18%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y A S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+ + +  WK 
Sbjct  77   YNASSLSQFTNTLDSELFQTARVSASSLRYYGLGLENGNYNVTLQFAEIQIQNTE--WKR  134

Query  589  LGRRYFDVSIQ---------------------------GERVLRDFNVKQEA-GGSKRAL  494
            LGRR FD+ IQ                           G  V +DF++++EA G S  A+
Sbjct  135  LGRRLFDIYIQVGPCFTRLLVLLRKVMVNCQCHLCLFQGNLVAKDFDIRKEADGASFTAV  194

Query  493  VKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHVVQE  359
             K ++A VT N L+IHFFWAGKGTCC+P Q+T+GP++SAI  V +
Sbjct  195  PKLYQARVTANYLEIHFFWAGKGTCCVPKQATYGPLISAISAVPD  239



>ref|XP_008371858.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Malus domestica]
Length=746

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 99/144 (69%), Gaps = 9/144 (6%)
 Frame = -2

Query  724  ELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDSWKGLGRRYFDVSIQGER  548
            EL++T+R+S  SLRYYG+GL+ G Y V LHFAE   +     +WK LGRR FD+ IQG R
Sbjct  298  ELFQTSRVSRGSLRYYGLGLENGPYTVTLHFAETVYESRTSQTWKSLGRRVFDIYIQGTR  357

Query  547  VLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHV  368
             ++DF++ +EAGG  RA+V+KF  +V+ N L+IH FWAGKGTCCIP  + +GP+++A+H 
Sbjct  358  RMKDFDISKEAGGVNRAVVRKFNVSVSENYLEIHLFWAGKGTCCIPSYNDYGPLIAAVHA  417

Query  367  VQEVNLDDSSDGSDKKRVGKIIGI  296
                    +SD + K   G I+GI
Sbjct  418  --------ASDFTKKSNTGLIVGI  433



>ref|XP_006659920.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Oryza brachyantha]
Length=1020

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 119/184 (65%), Gaps = 7/184 (4%)
 Frame = -2

Query  760  HSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKGLGR  581
            HS  +I N +D EL+ TAR+SPSSLRYYG+GL+ G Y V L FAE+   D   +W+ LGR
Sbjct  488  HSSEKIQNAVDSELFLTARMSPSSLRYYGLGLENGNYTVLLKFAELGYPDTP-TWQSLGR  546

Query  580  RYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQ  404
            R FD+ IQG+   +DF++++ AGG S  A+ K +   V+ N L+IH FWAGKGTCCIP+Q
Sbjct  547  RVFDIYIQGDLKEKDFDIRKTAGGKSFIAVYKNYTTTVSKNFLEIHLFWAGKGTCCIPIQ  606

Query  403  STFGPIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITLGSAAGVLIICSIFYVWWTKK  230
              +GP++SA+ +          +G  K+  + G I+GI +G  A VL++  +F ++  +K
Sbjct  607  GYYGPLISALSISPNFT-PTVRNGVPKRKSKAGAIVGIVVG--ASVLVLAVLFGIFMFRK  663

Query  229  KSPT  218
            K  T
Sbjct  664  KRRT  667



>gb|KCW71361.1| hypothetical protein EUGRSUZ_F04443 [Eucalyptus grandis]
Length=690

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 105/165 (64%), Gaps = 30/165 (18%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y+A S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAEIQ+ + +  WK 
Sbjct  107  YSASSLSQFTNTLDSELFQTARVSASSLRYYGLGLENGNYNVTLQFAEIQIQNTE--WKR  164

Query  589  LGRRYFDVSIQ---------------------------GERVLRDFNVKQEA-GGSKRAL  494
            LGRR FD+ IQ                           G  V++DF++++EA G S  A+
Sbjct  165  LGRRLFDIYIQVGPCFTRLLVLLRKVMVNCQCHLCLFQGNLVVKDFDIRKEADGASFTAV  224

Query  493  VKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHVVQE  359
             K ++A VT N L+IHFFWAGKGTCC+P Q+T+GP++SAI  V +
Sbjct  225  PKMYQARVTANYLEIHFFWAGKGTCCVPNQATYGPLISAISAVPD  269



>emb|CAD41884.2| OSJNBa0093O08.3 [Oryza sativa Japonica Group]
Length=1030

 Score =   156 bits (394),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            NY  +S  Q  +TLD EL+ T+R+SPSSLRYYG+GL+ G Y V L FAE  ++D + SWK
Sbjct  478  NYIIYSSRQFQHTLDSELFLTSRMSPSSLRYYGIGLENGNYTVTLQFAEFGIEDTQ-SWK  536

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKK-FKANVTNNVLDIHFFWAGKGTCC  416
             LGRR FD+ +QGER  ++F++++ AG     +VKK +K  VT N L+IH FWAGKGTCC
Sbjct  537  SLGRRVFDIYVQGERKEKNFDIRKTAGDKSYTVVKKQYKVPVTKNFLEIHLFWAGKGTCC  596

Query  415  IPVQSTFGPIVSAIHVV  365
            IP Q  +GP +SA+ V+
Sbjct  597  IPTQGYYGPTISALSVI  613



>ref|XP_006448775.1| hypothetical protein CICLE_v10014117mg [Citrus clementina]
 gb|ESR62015.1| hypothetical protein CICLE_v10014117mg [Citrus clementina]
Length=1046

 Score =   156 bits (394),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 112/186 (60%), Gaps = 8/186 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-DSWK  593
            Y  ++  Q+  T   +LY+T+RIS  SLRYYG+GL  G Y V L FAE    D   + W+
Sbjct  482  YVLNTQDQVTGTRTPKLYQTSRISAGSLRYYGLGLVNGPYNVSLLFAETNFPDPSTERWE  541

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
              GRR FD+ +QG    +DF++ +EAGG  RA++K F A V+ N L+IH FWAGKGTCCI
Sbjct  542  SRGRRVFDIYVQGTLRWKDFDISKEAGGPNRAIIKNFSATVSENHLEIHLFWAGKGTCCI  601

Query  412  PVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIF  251
            P Q  +GP +SA+ VV         L  S+ G +K   G I+GI +     G+++I  +F
Sbjct  602  PKQGNYGPAISALSVVSAFKPSVSGLPPSTPG-NKNHTGLIVGIAVPLGILGLIVISIMF  660

Query  250  YVWWTK  233
            Y+W  K
Sbjct  661  YLWREK  666



>ref|XP_006468409.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X1 [Citrus sinensis]
Length=1046

 Score =   156 bits (394),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 112/186 (60%), Gaps = 8/186 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIK-DSWK  593
            Y  ++  Q+  T   +LY+T+RIS  SLRYYG+GL  G Y V L FAE    D   + W+
Sbjct  482  YVLNTQDQVTGTRTPKLYQTSRISAGSLRYYGLGLVNGPYNVSLLFAETNFPDPSTERWE  541

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
              GRR FD+ +QG    +DF++ +EAGG  RA++K F A V+ N L+IH FWAGKGTCCI
Sbjct  542  SRGRRVFDIYVQGTLRWKDFDISKEAGGPNRAIIKNFSATVSENHLEIHLFWAGKGTCCI  601

Query  412  PVQSTFGPIVSAIHVVQEVN-----LDDSSDGSDKKRVGKIIGITLG-SAAGVLIICSIF  251
            P Q  +GP +SA+ VV         L  S+ G +K   G I+GI +     G+++I  +F
Sbjct  602  PKQGNYGPAISALSVVSAFKPSVSGLPPSTPG-NKNHTGLIVGIAVPLGILGLIVISIMF  660

Query  250  YVWWTK  233
            Y+W  K
Sbjct  661  YLWREK  666



>emb|CAN66040.1| hypothetical protein VITISV_035756 [Vitis vinifera]
Length=612

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 112/182 (62%), Gaps = 6/182 (3%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDI-KDSW  596
            +Y   +  Q+  T   EL++++RISP SLRYYG+GL+ G Y V L FAE    D    +W
Sbjct  58   SYVDSNLMQVTGTNTPELFQSSRISPGSLRYYGLGLENGPYIVSLEFAETVFKDRDTQTW  117

Query  595  KGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
            + LGRR FD+ IQG    +DF++ +EAGG +RAL KKF A V+ N L+IH FWAGKGTCC
Sbjct  118  ESLGRRVFDIYIQGALQFKDFDISKEAGGVERALEKKFNATVSENYLEIHLFWAGKGTCC  177

Query  415  IPVQSTFGPIVSAIHVVQE----VNLDDSSDGSDKKRVGKIIGITLGSAAGVLI-ICSIF  251
             P+Q  +GP +SA+ VV +    V  +     S K   G I+G+ +      +I ICS+ 
Sbjct  178  NPIQGYYGPSISALSVVSDFTPTVAGNPPIPPSKKNNTGLIVGVAVSVGVVSMILICSVL  237

Query  250  YV  245
            Y+
Sbjct  238  YI  239



>ref|NP_001061222.1| Os08g0203300 [Oryza sativa Japonica Group]
 dbj|BAF23136.1| Os08g0203300, partial [Oryza sativa Japonica Group]
Length=665

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 117/186 (63%), Gaps = 4/186 (2%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  +S  Q  N LD EL++TAR+SPSSLRYYG+GL+ G Y V L FAE    D K +W+
Sbjct  119  SYLMYSSQQFQNALDSELFQTARMSPSSLRYYGLGLENGNYTVLLQFAEFAYPDTK-TWQ  177

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
             +GRR FD+ +QG+   ++F+V++ AGG S  A+ K++ A V+ N L+IH FWAGKGTCC
Sbjct  178  SIGRRVFDIYVQGDLKEKNFDVRKTAGGKSFIAVNKRYNATVSKNFLEIHLFWAGKGTCC  237

Query  415  IPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKK-RVGKIIGITLG-SAAGVLIICSIFYVW  242
            IP Q  +GP++SA+ +         +    KK + G I GI +G S  G   +  IF + 
Sbjct  238  IPTQGYYGPMISALSITPNFTPTVRNGVPKKKSKAGVIAGIVIGASVIGSAALLGIFVLV  297

Query  241  WTKKKS  224
              ++K+
Sbjct  298  KKRRKA  303



>emb|CAD41885.2| OSJNBa0093O08.4 [Oryza sativa Japonica Group]
Length=948

 Score =   155 bits (392),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  +S  Q  +TLD EL++TAR+SPSSLRYYG+GL+ G Y V L FAEI+ +D K SWK 
Sbjct  441  YIFNSSRQFQSTLDPELFQTARLSPSSLRYYGIGLENGNYTVTLQFAEIEFEDTK-SWKS  499

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQGER  R+F++++  GG S  A+ K++   VT N ++IH FWAGKGTCCI
Sbjct  500  LGRRVFDIYIQGERKERNFDIRKATGGKSYTAVKKQYLIPVTKNFVEIHLFWAGKGTCCI  559

Query  412  PVQSTFGPIVSAIHV  368
            P Q  +GP +SA+ +
Sbjct  560  PAQGYYGPSISALSL  574



>ref|XP_010645958.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Vitis vinifera]
Length=976

 Score =   155 bits (392),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 104/159 (65%), Gaps = 2/159 (1%)
 Frame = -2

Query  763  AHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-SWKGL  587
            A++ SQ+  T   EL+KT+RISP SLRYYG+GL+ G Y V L FAE+   D    +W+  
Sbjct  467  ANTTSQVNGTNTPELFKTSRISPGSLRYYGLGLQNGPYIVSLQFAEMLFKDPSTRTWEST  526

Query  586  GRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPV  407
            GRR FD+ IQG R+ RDF++ +EAGG +RA+V+KF A V+ N L+IH  WAGKGTCCIP 
Sbjct  527  GRRVFDIYIQGIRLERDFDISKEAGGVQRAVVRKFHATVSKNYLEIHLLWAGKGTCCIPF  586

Query  406  QSTFGPIVSAIHVVQEVNLDDSSDGSDKKRVGKIIGITL  290
            +  +GP +SA+ VV  +        S+    G I GI +
Sbjct  587  EGYYGPSISALSVVSALE-RMPPPPSETSNTGFIAGIAV  624



>ref|XP_006422235.1| hypothetical protein CICLE_v10007054mg, partial [Citrus clementina]
 gb|ESR35475.1| hypothetical protein CICLE_v10007054mg, partial [Citrus clementina]
Length=962

 Score =   155 bits (392),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y + S SQ  NTLD EL++TAR+S SSLRYYG+GL+ G Y V L FAE+ + D  + W+ 
Sbjct  422  YKSSSLSQFTNTLDSELFQTARLSASSLRYYGLGLENGNYTVLLQFAEMAILDT-NRWES  480

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FDV IQG RVL+DF++K+EAGG SKRA+ ++ K  V+ N L+IH FWAGKGTCC+
Sbjct  481  LGRRVFDVYIQGNRVLKDFDIKREAGGVSKRAIQREIKTRVSENYLEIHLFWAGKGTCCV  540

Query  412  PVQSTFGPIV  383
            P Q  F P V
Sbjct  541  PAQD-FTPTV  549



>gb|EEE61689.1| hypothetical protein OsJ_16162 [Oryza sativa Japonica Group]
Length=908

 Score =   155 bits (391),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  +S  Q  +TLD EL++TAR+SPSSLRYYG+GL+ G Y V L FAEI+ +D K SWK 
Sbjct  417  YIFNSSRQFQSTLDPELFQTARLSPSSLRYYGIGLENGNYTVTLQFAEIEFEDTK-SWKS  475

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LGRR FD+ IQGER  R+F++++  GG S  A+ K++   VT N ++IH FWAGKGTCCI
Sbjct  476  LGRRVFDIYIQGERKERNFDIRKATGGKSYTAVKKQYLIPVTKNFVEIHLFWAGKGTCCI  535

Query  412  PVQSTFGPIVSAIHV  368
            P Q  +GP +SA+ +
Sbjct  536  PAQGYYGPSISALSL  550



>ref|XP_009341192.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Pyrus x bretschneideri]
Length=1037

 Score =   155 bits (392),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 108/166 (65%), Gaps = 11/166 (7%)
 Frame = -2

Query  721  LYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKD-SWKGLGRRYFDVSIQGERV  545
            LY+T+R+SP SLRYYG+GL  G Y V LHFAE   +     +W+ LGRR FD+ IQG R+
Sbjct  503  LYQTSRMSPGSLRYYGLGLVNGPYTVTLHFAETVYESRNSHTWQSLGRRVFDIYIQGTRM  562

Query  544  LRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHVV  365
             +DF++ +EA G  RA+VKKF  NV+ N L+IH FWAGKGTCCIP    +GP+++AIH  
Sbjct  563  TKDFDISKEADGVNRAVVKKFNVNVSENYLEIHLFWAGKGTCCIPNYGDYGPLIAAIHA-  621

Query  364  QEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWTKKK  227
                   +SD + K + G I+GI      GV+ +  IF + + ++K
Sbjct  622  -------TSDFTKKSKTGLIVGI--AVLVGVVSLLLIFAILYMRRK  658



>gb|KJB69971.1| hypothetical protein B456_011G052300 [Gossypium raimondii]
Length=678

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 113/188 (60%), Gaps = 7/188 (4%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDS  599
            Q +  ++  Q+ +T   ELY+T+RISP SLRYYG+GL+ G Y V L FAE    +    S
Sbjct  479  QQFVENNGGQVRSTNTPELYETSRISPGSLRYYGLGLENGPYTVRLFFAETGFPERTSGS  538

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W+ L RR FDV IQG R LRDF++ +EAGG +RA+ + F  NVT N L+IH FWAGKGT 
Sbjct  539  WRSLARRVFDVYIQGARRLRDFDISKEAGGVQRAISRNFTTNVTANHLEIHLFWAGKGTS  598

Query  418  CIPVQSTFGPIVSAIHVVQE----VNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIF  251
              P    +GP +SAI VV      V+    S+  +K     I G+T+   A  LI+  IF
Sbjct  599  GTPEDGYYGPSISAISVVPNFIPTVSGIPPSNPKEKNHTALIAGVTVPVVALALIL--IF  656

Query  250  YVWWTKKK  227
             + + K+K
Sbjct  657  AIIYVKRK  664



>ref|XP_004972617.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X3 [Setaria italica]
Length=1015

 Score =   155 bits (392),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 114/185 (62%), Gaps = 7/185 (4%)
 Frame = -2

Query  772  NYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWK  593
            +Y  HS  Q  N  D EL++TAR+SPSSLRYYG+GL+ G Y VEL FAE    +   +W 
Sbjct  445  SYIIHSSRQFQNARDSELFQTARMSPSSLRYYGIGLENGNYTVELQFAEFAYPE-SPTWD  503

Query  592  GLGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCC  416
              GRR FD+ +QG    ++F++++ AGG S  A+ KK+ A V+ N L+IH FWAGKGTCC
Sbjct  504  STGRRVFDIYVQGHLKEKNFDIRKTAGGKSYVAVYKKYNATVSKNFLEIHLFWAGKGTCC  563

Query  415  IPVQSTFGPIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITLGSAAGVLIICSIFYVW  242
            IP Q  +GP++SA+ V          +G  KK  + G I GI +G  A VL + ++  V+
Sbjct  564  IPTQGYYGPMISALSVTPNFT-PTVRNGVPKKKSKAGAIAGIVIG--ASVLGLAALLGVF  620

Query  241  WTKKK  227
               KK
Sbjct  621  MLVKK  625



>ref|XP_006659919.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Oryza brachyantha]
Length=1031

 Score =   155 bits (392),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 117/184 (64%), Gaps = 7/184 (4%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y  +S  Q  N LD EL++TAR+SPSSLRYYG+GL+ G Y V L FAE    D + +W+ 
Sbjct  486  YLMYSSQQFQNPLDSELFQTARMSPSSLRYYGLGLENGNYTVLLEFAEFAYPDTQ-TWQS  544

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGG-SKRALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            +GRR FD+ +QG+   R+F+V++ AGG S  A+ K++ A V+ N L+IH FWAGKGTCCI
Sbjct  545  IGRRVFDIYVQGDLKERNFDVRKIAGGKSFTAINKRYNATVSKNFLEIHLFWAGKGTCCI  604

Query  412  PVQSTFGPIVSAIHVVQEVNLDDSSDGSDKK--RVGKIIGITLGSAAGVLIICSIFYVWW  239
            P Q  +GP++SA+ +          +G  K+  + G I GI +G  A VL+  ++  ++ 
Sbjct  605  PTQGYYGPMISALSITPNFT-PTVRNGVPKRKSKAGAITGIVIG--ASVLVSAALLGIFL  661

Query  238  TKKK  227
              KK
Sbjct  662  MIKK  665



>ref|XP_006392563.1| hypothetical protein EUTSA_v10012222mg, partial [Eutrema salsugineum]
 gb|ESQ29849.1| hypothetical protein EUTSA_v10012222mg, partial [Eutrema salsugineum]
Length=986

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 101/133 (76%), Gaps = 2/133 (2%)
 Frame = -2

Query  769  YTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDDIKDSWKG  590
            Y + S SQ  NTLD EL+++AR+S SSLRYYG+GL+ G Y V L FAEIQ+    ++W+ 
Sbjct  471  YISTSQSQFINTLDSELFQSARLSASSLRYYGLGLENGGYTVTLEFAEIQILG-SNTWRS  529

Query  589  LGRRYFDVSIQGERVLRDFNVKQEAGGSK-RALVKKFKANVTNNVLDIHFFWAGKGTCCI  413
            LG+R FD+ +QG  V +DF++++ AG S  RA+ +++KANV+ N L+IH FWAGKGTCCI
Sbjct  530  LGKRRFDIYVQGRLVEKDFDIRRRAGDSTFRAVQREYKANVSENYLEIHLFWAGKGTCCI  589

Query  412  PVQSTFGPIVSAI  374
            P+Q  +GP++SA+
Sbjct  590  PIQGAYGPLISAV  602



>gb|KJB69970.1| hypothetical protein B456_011G052300 [Gossypium raimondii]
Length=718

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 113/188 (60%), Gaps = 7/188 (4%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDS  599
            Q +  ++  Q+ +T   ELY+T+RISP SLRYYG+GL+ G Y V L FAE    +    S
Sbjct  479  QQFVENNGGQVRSTNTPELYETSRISPGSLRYYGLGLENGPYTVRLFFAETGFPERTSGS  538

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W+ L RR FDV IQG R LRDF++ +EAGG +RA+ + F  NVT N L+IH FWAGKGT 
Sbjct  539  WRSLARRVFDVYIQGARRLRDFDISKEAGGVQRAISRNFTTNVTANHLEIHLFWAGKGTS  598

Query  418  CIPVQSTFGPIVSAIHVVQE----VNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIF  251
              P    +GP +SAI VV      V+    S+  +K     I G+T+   A  LI+  IF
Sbjct  599  GTPEDGYYGPSISAISVVPNFIPTVSGIPPSNPKEKNHTALIAGVTVPVVALALIL--IF  656

Query  250  YVWWTKKK  227
             + + K+K
Sbjct  657  AIIYVKRK  664



>gb|KJB69969.1| hypothetical protein B456_011G052300 [Gossypium raimondii]
Length=620

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 113/188 (60%), Gaps = 7/188 (4%)
 Frame = -2

Query  775  QNYTAHSFSQIPNTLDXELYKTARISPSSLRYYGVGLKKGIYRVELHFAEIQMDD-IKDS  599
            Q +  ++  Q+ +T   ELY+T+RISP SLRYYG+GL+ G Y V L FAE    +    S
Sbjct  59   QQFVENNGGQVRSTNTPELYETSRISPGSLRYYGLGLENGPYTVRLFFAETGFPERTSGS  118

Query  598  WKGLGRRYFDVSIQGERVLRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTC  419
            W+ L RR FDV IQG R LRDF++ +EAGG +RA+ + F  NVT N L+IH FWAGKGT 
Sbjct  119  WRSLARRVFDVYIQGARRLRDFDISKEAGGVQRAISRNFTTNVTANHLEIHLFWAGKGTS  178

Query  418  CIPVQSTFGPIVSAIHVVQE----VNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIF  251
              P    +GP +SAI VV      V+    S+  +K     I G+T+   A  LI+  IF
Sbjct  179  GTPEDGYYGPSISAISVVPNFIPTVSGIPPSNPKEKNHTALIAGVTVPVVALALIL--IF  236

Query  250  YVWWTKKK  227
             + + K+K
Sbjct  237  AIIYVKRK  244



>ref|XP_009341189.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140, partial [Pyrus x bretschneideri]
Length=979

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 105/166 (63%), Gaps = 11/166 (7%)
 Frame = -2

Query  721  LYKTARISPSSLRYYGVGLKKGIYRVELHFAE-IQMDDIKDSWKGLGRRYFDVSIQGERV  545
            LY+T R+S  SLRYYG+GL  G Y V LHFAE I    I  +W+ LGRR FD+ IQG R 
Sbjct  528  LYQTTRMSTGSLRYYGLGLVNGPYTVTLHFAETIYESRISHTWQSLGRRVFDIYIQGTRR  587

Query  544  LRDFNVKQEAGGSKRALVKKFKANVTNNVLDIHFFWAGKGTCCIPVQSTFGPIVSAIHVV  365
            ++DF++ +EAGG  +A+V KF  NV  N L+IH FWAGKGTCCIP    +GP+++AIH  
Sbjct  588  MKDFDISKEAGGVNQAVVIKFNVNVLENYLEIHLFWAGKGTCCIPNPGDYGPLIAAIHA-  646

Query  364  QEVNLDDSSDGSDKKRVGKIIGITLGSAAGVLIICSIFYVWWTKKK  227
                   +SD   K + G  +GI +    GV+ +  IF + + ++K
Sbjct  647  -------TSDFKKKSKTGLTVGIAI--LVGVVSLLLIFAILFMRRK  683



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940