BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF021N21

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011101473.1|  PREDICTED: serine decarboxylase-like               341   4e-111   
ref|XP_006362822.1|  PREDICTED: histidine decarboxylase-like isof...    340   4e-111   Solanum tuberosum [potatoes]
ref|XP_004237774.1|  PREDICTED: serine decarboxylase                    340   5e-111   Solanum lycopersicum
ref|XP_009616512.1|  PREDICTED: serine decarboxylase                    338   4e-110   Nicotiana tomentosiformis
ref|XP_009784234.1|  PREDICTED: serine decarboxylase                    337   7e-110   Nicotiana sylvestris
ref|XP_007019463.1|  Pyridoxal phosphate (PLP)-dependent transfer...    333   2e-108   Theobroma cacao [chocolate]
ref|NP_001047064.2|  Os02g0541300                                       322   5e-108   
ref|XP_010108654.1|  Histidine decarboxylase                            331   1e-107   Morus notabilis
ref|XP_010063879.1|  PREDICTED: serine decarboxylase-like               328   1e-106   
gb|EYU17447.1|  hypothetical protein MIMGU_mgv1a005353mg                328   2e-106   Erythranthe guttata [common monkey flower]
ref|XP_010241731.1|  PREDICTED: serine decarboxylase-like               328   2e-106   Nelumbo nucifera [Indian lotus]
gb|KCW71161.1|  hypothetical protein EUGRSUZ_F04257                     329   2e-106   Eucalyptus grandis [rose gum]
ref|XP_002452231.1|  hypothetical protein SORBIDRAFT_04g022140          328   3e-106   Sorghum bicolor [broomcorn]
emb|CDP11372.1|  unnamed protein product                                324   6e-106   Coffea canephora [robusta coffee]
ref|XP_008645766.1|  PREDICTED: histidine decarboxylase-like            327   7e-106   
ref|XP_010260914.1|  PREDICTED: serine decarboxylase-like               326   2e-105   Nelumbo nucifera [Indian lotus]
ref|XP_004952686.1|  PREDICTED: histidine decarboxylase-like            325   2e-105   Setaria italica
sp|Q6ESZ9.1|SDC1_ORYSJ  RecName: Full=Serine decarboxylase 1            325   4e-105   Oryza sativa Japonica Group [Japonica rice]
gb|KDO83688.1|  hypothetical protein CISIN_1g011842mg                   324   5e-105   Citrus sinensis [apfelsine]
gb|EAY86197.1|  hypothetical protein OsI_07573                          324   5e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_006472964.1|  PREDICTED: histidine decarboxylase-like isof...    324   5e-105   Citrus sinensis [apfelsine]
ref|XP_003575093.1|  PREDICTED: serine decarboxylase 1                  323   1e-104   Brachypodium distachyon [annual false brome]
ref|XP_006434436.1|  hypothetical protein CICLE_v10000775mg             323   1e-104   Citrus clementina [clementine]
ref|XP_010931002.1|  PREDICTED: serine decarboxylase 1                  323   1e-104   Elaeis guineensis
gb|KDP43008.1|  hypothetical protein JCGZ_25194                         323   2e-104   Jatropha curcas
ref|XP_003579728.1|  PREDICTED: serine decarboxylase 1                  323   2e-104   Brachypodium distachyon [annual false brome]
ref|XP_004290538.1|  PREDICTED: serine decarboxylase                    323   2e-104   Fragaria vesca subsp. vesca
ref|XP_002306690.1|  serine decarboxylase family protein                323   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011044197.1|  PREDICTED: serine decarboxylase-like               322   3e-104   Populus euphratica
ref|XP_011042836.1|  PREDICTED: serine decarboxylase-like               322   4e-104   Populus euphratica
ref|XP_006393773.1|  hypothetical protein EUTSA_v10011430mg             322   5e-104   Eutrema salsugineum [saltwater cress]
gb|KJB16470.1|  hypothetical protein B456_002G231300                    322   6e-104   Gossypium raimondii
gb|KJB16468.1|  hypothetical protein B456_002G231300                    321   7e-104   Gossypium raimondii
gb|KJB16469.1|  hypothetical protein B456_002G231300                    321   7e-104   Gossypium raimondii
gb|KHG24953.1|  Histidine decarboxylase                                 321   8e-104   Gossypium arboreum [tree cotton]
ref|XP_009416900.1|  PREDICTED: serine decarboxylase 1-like             321   9e-104   
ref|XP_002533017.1|  group II plp decarboxylase, putative               321   1e-103   Ricinus communis
dbj|BAE07183.1|  putative serine decarboxylase                          321   1e-103   Beta vulgaris [beet]
ref|XP_006434437.1|  hypothetical protein CICLE_v10000775mg             323   1e-103   
ref|XP_007201012.1|  hypothetical protein PRUPE_ppa005028mg             321   1e-103   Prunus persica
emb|CBI18554.3|  unnamed protein product                                319   1e-103   Vitis vinifera
ref|XP_009406072.1|  PREDICTED: serine decarboxylase 1-like             320   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002302186.1|  serine decarboxylase family protein                320   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010519398.1|  PREDICTED: serine decarboxylase-like               321   2e-103   Tarenaya hassleriana [spider flower]
gb|EPS66281.1|  serine decarboxylase                                    318   2e-103   Genlisea aurea
ref|XP_010680495.1|  PREDICTED: serine decarboxylase                    320   2e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002266398.1|  PREDICTED: serine decarboxylase                    320   3e-103   Vitis vinifera
ref|XP_008243632.1|  PREDICTED: histidine decarboxylase-like            319   5e-103   Prunus mume [ume]
gb|AFK28264.1|  putative serine decarboxylase                           311   5e-103   Helianthus paradoxus
ref|XP_004140971.1|  PREDICTED: histidine decarboxylase-like isof...    319   7e-103   
ref|XP_004140972.1|  PREDICTED: histidine decarboxylase-like isof...    319   8e-103   Cucumis sativus [cucumbers]
gb|KJB59412.1|  hypothetical protein B456_009G253400                    318   1e-102   Gossypium raimondii
emb|CAN70523.1|  hypothetical protein VITISV_034634                     318   1e-102   Vitis vinifera
ref|NP_175036.1|  serine decarboxylase 1                                318   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AFK28277.1|  putative serine decarboxylase                           310   2e-102   Helianthus petiolaris
emb|CDY41717.1|  BnaA09g15450D                                          317   2e-102   Brassica napus [oilseed rape]
gb|KHG04394.1|  Histidine decarboxylase                                 317   2e-102   Gossypium arboreum [tree cotton]
gb|KJB59411.1|  hypothetical protein B456_009G253400                    317   2e-102   Gossypium raimondii
gb|KJB59410.1|  hypothetical protein B456_009G253400                    317   3e-102   Gossypium raimondii
ref|XP_009107655.1|  PREDICTED: serine decarboxylase-like               318   3e-102   Brassica rapa
ref|XP_009113392.1|  PREDICTED: serine decarboxylase-like               317   3e-102   Brassica rapa
gb|AFK28270.1|  putative serine decarboxylase                           309   3e-102   Helianthus deserticola
gb|AFK28279.1|  putative serine decarboxylase                           309   3e-102   Helianthus petiolaris
ref|XP_010500117.1|  PREDICTED: serine decarboxylase-like               317   4e-102   Camelina sativa [gold-of-pleasure]
gb|AFK28253.1|  putative serine decarboxylase                           308   4e-102   Helianthus argophyllus
ref|XP_008441526.1|  PREDICTED: histidine decarboxylase isoform X2      317   4e-102   
ref|XP_010461415.1|  PREDICTED: serine decarboxylase-like               317   4e-102   Camelina sativa [gold-of-pleasure]
ref|XP_008441525.1|  PREDICTED: histidine decarboxylase isoform X1      317   4e-102   Cucumis melo [Oriental melon]
gb|AFK28256.1|  putative serine decarboxylase                           308   5e-102   Helianthus annuus
ref|XP_006648711.1|  PREDICTED: histidine decarboxylase-like            316   6e-102   
ref|XP_008781392.1|  PREDICTED: serine decarboxylase 1                  316   7e-102   Phoenix dactylifera
gb|AFK28281.1|  putative serine decarboxylase                           308   8e-102   Helianthus debilis [cucumberleaf sunflower]
gb|AFK28260.1|  putative serine decarboxylase                           308   8e-102   Helianthus annuus
emb|CDX80723.1|  BnaC08g05570D                                          317   8e-102   
dbj|BAA78331.1|  serine decarboxylase                                   317   9e-102   Brassica napus [oilseed rape]
ref|XP_002893962.1|  EMB1075                                            315   1e-101   
gb|AFK28257.1|  putative serine decarboxylase                           307   1e-101   Helianthus annuus
ref|XP_006307198.1|  hypothetical protein CARUB_v10008789mg             318   1e-101   
gb|AFW62562.1|  hypothetical protein ZEAMMB73_033583                    313   1e-101   
ref|XP_010479021.1|  PREDICTED: serine decarboxylase                    316   1e-101   Camelina sativa [gold-of-pleasure]
gb|AFK28273.1|  putative serine decarboxylase                           307   1e-101   Helianthus anomalus
gb|AFK28271.1|  putative serine decarboxylase                           307   1e-101   Helianthus anomalus
gb|AFK28261.1|  putative serine decarboxylase                           307   1e-101   Helianthus annuus
gb|AFK28262.1|  putative serine decarboxylase                           307   1e-101   Helianthus annuus
gb|AFK28254.1|  putative serine decarboxylase                           307   2e-101   Helianthus argophyllus
emb|CDY48944.1|  BnaA08g04700D                                          315   2e-101   Brassica napus [oilseed rape]
gb|AFK28287.1|  putative serine decarboxylase                           306   2e-101   Helianthus bolanderi
gb|AFK28267.1|  putative serine decarboxylase                           306   3e-101   Helianthus deserticola
ref|XP_008678685.1|  PREDICTED: histidine decarboxylase-like            315   4e-101   Zea mays [maize]
ref|XP_010530241.1|  PREDICTED: serine decarboxylase                    315   5e-101   Tarenaya hassleriana [spider flower]
gb|AFK28272.1|  putative serine decarboxylase                           305   7e-101   Helianthus anomalus
gb|AFK28291.1|  putative serine decarboxylase                           305   8e-101   Helianthus niveus
emb|CDY59264.1|  BnaC09g51700D                                          313   8e-101   Brassica napus [oilseed rape]
gb|AFK28269.1|  putative serine decarboxylase                           305   1e-100   Helianthus deserticola
ref|XP_009368241.1|  PREDICTED: serine decarboxylase-like               313   2e-100   
ref|XP_009343619.1|  PREDICTED: serine decarboxylase-like               312   2e-100   Pyrus x bretschneideri [bai li]
ref|XP_009145064.1|  PREDICTED: serine decarboxylase                    311   3e-100   Brassica rapa
gb|KFK24263.1|  hypothetical protein AALP_AAs40498U000700               312   4e-100   Arabis alpina [alpine rockcress]
gb|AFK39410.1|  unknown                                                 306   4e-100   Medicago truncatula
ref|XP_003593129.1|  Histidine decarboxylase                            311   6e-100   Medicago truncatula
ref|XP_006854520.1|  hypothetical protein AMTR_s00030p00012550          311   8e-100   Amborella trichopoda
emb|CDY30753.1|  BnaC05g51500D                                          311   9e-100   Brassica napus [oilseed rape]
ref|XP_008339120.1|  PREDICTED: histidine decarboxylase-like            310   1e-99    Malus domestica [apple tree]
ref|XP_007227607.1|  hypothetical protein PRUPE_ppa020363mg             310   2e-99    Prunus persica
ref|XP_008381807.1|  PREDICTED: histidine decarboxylase                 310   2e-99    Malus domestica [apple tree]
ref|XP_009368490.1|  PREDICTED: serine decarboxylase-like               310   2e-99    Pyrus x bretschneideri [bai li]
ref|XP_004485538.1|  PREDICTED: histidine decarboxylase-like isof...    310   3e-99    Cicer arietinum [garbanzo]
ref|XP_007148444.1|  hypothetical protein PHAVU_006G209300g             310   3e-99    Phaseolus vulgaris [French bean]
ref|XP_008218831.1|  PREDICTED: histidine decarboxylase-like            308   4e-99    Prunus mume [ume]
ref|XP_009420591.1|  PREDICTED: serine decarboxylase 1-like             308   9e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010241734.1|  PREDICTED: serine decarboxylase 1-like             308   1e-98    Nelumbo nucifera [Indian lotus]
gb|ACJ85197.1|  unknown                                                 307   3e-98    Medicago truncatula
ref|XP_006584565.1|  PREDICTED: uncharacterized protein LOC100792...    306   3e-98    Glycine max [soybeans]
gb|KHN39188.1|  Histidine decarboxylase                                 307   4e-98    Glycine soja [wild soybean]
ref|XP_006584560.1|  PREDICTED: uncharacterized protein LOC100792...    306   4e-98    
ref|XP_006584563.1|  PREDICTED: uncharacterized protein LOC100792...    306   5e-98    Glycine max [soybeans]
ref|NP_001241244.1|  uncharacterized protein LOC100795577               302   3e-96    Glycine max [soybeans]
gb|KHN26720.1|  Histidine decarboxylase                                 302   3e-96    Glycine soja [wild soybean]
ref|XP_003547587.1|  PREDICTED: histidine decarboxylase                 302   4e-96    Glycine max [soybeans]
gb|AFA36595.1|  putative serine decarboxylase                           290   1e-94    Lolium perenne [perennial ryegrass]
gb|AFK28252.1|  putative serine decarboxylase                           288   3e-94    Helianthus agrestis
ref|XP_001761266.1|  predicted protein                                  293   5e-93    
ref|XP_001754291.1|  predicted protein                                  283   1e-89    
ref|XP_002976233.1|  hypothetical protein SELMODRAFT_175502             283   5e-89    
ref|XP_010676037.1|  PREDICTED: serine decarboxylase-like               282   6e-89    
ref|XP_010675834.1|  PREDICTED: serine decarboxylase-like               282   6e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002987141.1|  hypothetical protein SELMODRAFT_158539             282   1e-88    
gb|EMT14427.1|  Histidine decarboxylase                                 278   7e-87    
ref|XP_003566804.1|  PREDICTED: serine decarboxylase 1-like             275   7e-86    Brachypodium distachyon [annual false brome]
ref|XP_006365167.1|  PREDICTED: histidine decarboxylase-like            265   6e-82    Solanum tuberosum [potatoes]
ref|NP_001233845.1|  aromatic amino acid decarboxylase 1A               265   7e-82    Solanum lycopersicum
gb|KEH26769.1|  serine decarboxylase                                    254   1e-81    Medicago truncatula
ref|XP_004245280.1|  PREDICTED: histidine decarboxylase-like isof...    263   4e-81    
ref|XP_010325179.1|  PREDICTED: histidine decarboxylase-like isof...    262   4e-81    
ref|XP_009789723.1|  PREDICTED: histidine decarboxylase-like            262   6e-81    Nicotiana sylvestris
gb|AES76141.2|  serine decarboxylase                                    255   7e-81    Medicago truncatula
ref|XP_009769413.1|  PREDICTED: histidine decarboxylase-like isof...    261   9e-81    Nicotiana sylvestris
ref|XP_004245427.1|  PREDICTED: histidine decarboxylase-like            261   2e-80    Solanum lycopersicum
ref|XP_009599698.1|  PREDICTED: histidine decarboxylase-like            260   3e-80    Nicotiana tomentosiformis
ref|XP_009620691.1|  PREDICTED: histidine decarboxylase-like            260   3e-80    Nicotiana tomentosiformis
ref|XP_006365162.1|  PREDICTED: histidine decarboxylase-like isof...    259   5e-80    Solanum tuberosum [potatoes]
ref|XP_006365164.1|  PREDICTED: histidine decarboxylase-like isof...    259   6e-80    
ref|XP_006365163.1|  PREDICTED: histidine decarboxylase-like isof...    259   7e-80    Solanum tuberosum [potatoes]
ref|XP_004245281.1|  PREDICTED: histidine decarboxylase-like            258   1e-79    Solanum lycopersicum
ref|XP_006365166.1|  PREDICTED: histidine decarboxylase-like            258   1e-79    Solanum tuberosum [potatoes]
ref|XP_006365165.1|  PREDICTED: histidine decarboxylase-like            258   2e-79    
ref|XP_006365087.1|  PREDICTED: histidine decarboxylase-like            258   2e-79    Solanum tuberosum [potatoes]
ref|XP_004244519.1|  PREDICTED: histidine decarboxylase                 258   3e-79    Solanum lycopersicum
ref|XP_006357084.1|  PREDICTED: histidine decarboxylase-like            257   5e-79    Solanum tuberosum [potatoes]
ref|XP_009600675.1|  PREDICTED: histidine decarboxylase-like            256   7e-79    
ref|NP_001233859.1|  aromatic amino acid decarboxylase 2                256   7e-79    Solanum lycopersicum
ref|XP_006365168.1|  PREDICTED: histidine decarboxylase-like            256   1e-78    Solanum tuberosum [potatoes]
ref|NP_001233852.1|  aromatic amino acid decarboxylase 1B               256   1e-78    
ref|XP_011081981.1|  PREDICTED: histidine decarboxylase-like isof...    256   2e-78    Sesamum indicum [beniseed]
ref|XP_011081982.1|  PREDICTED: histidine decarboxylase-like isof...    256   2e-78    Sesamum indicum [beniseed]
ref|XP_004245279.1|  PREDICTED: histidine decarboxylase-like            255   2e-78    Solanum lycopersicum
ref|XP_006357083.1|  PREDICTED: histidine decarboxylase-like            254   5e-78    Solanum tuberosum [potatoes]
gb|KHN16991.1|  Histidine decarboxylase                                 252   1e-77    Glycine soja [wild soybean]
ref|XP_004244809.1|  PREDICTED: histidine decarboxylase-like            253   2e-77    Solanum lycopersicum
gb|EMS49846.1|  Histidine decarboxylase                                 249   2e-77    Triticum urartu
ref|XP_006346847.1|  PREDICTED: histidine decarboxylase-like            253   3e-77    
ref|XP_003535578.1|  PREDICTED: histidine decarboxylase-like            250   5e-77    
ref|XP_003535572.1|  PREDICTED: histidine decarboxylase-like            251   6e-77    Glycine max [soybeans]
ref|XP_003619923.1|  L-tyrosine decarboxylase                           249   1e-76    
ref|XP_006366216.1|  PREDICTED: histidine decarboxylase-like            249   2e-76    
ref|XP_006367691.1|  PREDICTED: histidine decarboxylase-like            250   2e-76    Solanum tuberosum [potatoes]
ref|XP_011082255.1|  PREDICTED: serine decarboxylase-like               248   1e-75    Sesamum indicum [beniseed]
gb|ACU18860.1|  unknown                                                 237   2e-75    Glycine max [soybeans]
gb|AES89541.2|  serine decarboxylase                                    240   3e-75    Medicago truncatula
ref|XP_003607344.1|  Serine decarboxylase                               239   3e-75    
gb|EAY77466.1|  hypothetical protein OsI_32510                          246   7e-75    Oryza sativa Indica Group [Indian rice]
sp|Q8RV06.1|SDC2_ORYSJ  RecName: Full=Serine decarboxylase 2            246   8e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003607341.1|  Embryo defective 1075-like protein                 246   1e-74    
ref|XP_003592126.1|  Histidine decarboxylase                            245   1e-74    
ref|XP_006661594.1|  PREDICTED: histidine decarboxylase-like            243   1e-73    Oryza brachyantha
gb|AHG12639.1|  histidine decarboxylase                                 240   9e-73    Nicotiana tabacum [American tobacco]
ref|XP_009779195.1|  PREDICTED: histidine decarboxylase-like            240   1e-72    Nicotiana sylvestris
gb|KCW44086.1|  hypothetical protein EUGRSUZ_L02502                     233   2e-72    Eucalyptus grandis [rose gum]
gb|EYU29207.1|  hypothetical protein MIMGU_mgv1a026642mg                237   2e-72    Erythranthe guttata [common monkey flower]
gb|AIE54278.1|  aromatic amino acid decarboxylase 2                     239   3e-72    Nicotiana tabacum [American tobacco]
ref|XP_009774334.1|  PREDICTED: histidine decarboxylase-like            238   5e-72    Nicotiana sylvestris
ref|XP_009622262.1|  PREDICTED: LOW QUALITY PROTEIN: histidine de...    238   6e-72    
ref|XP_002953989.1|  serine decarboxylase                               239   6e-72    Volvox carteri f. nagariensis
ref|NP_001242861.1|  uncharacterized protein LOC100792053               238   6e-72    
ref|XP_009601849.1|  PREDICTED: histidine decarboxylase-like isof...    235   4e-71    Nicotiana tomentosiformis
ref|XP_001689659.1|  serine decarboxylase                               233   6e-71    Chlamydomonas reinhardtii
ref|XP_004496485.1|  PREDICTED: histidine decarboxylase-like            235   7e-71    Cicer arietinum [garbanzo]
ref|XP_011401256.1|  Histidine decarboxylase                            236   8e-71    Auxenochlorella protothecoides
ref|XP_009601848.1|  PREDICTED: histidine decarboxylase-like isof...    235   9e-71    
ref|XP_005845371.1|  hypothetical protein CHLNCDRAFT_53969              235   1e-70    Chlorella variabilis
ref|XP_003592128.1|  Embryo defective 1075-like protein                 233   4e-70    
ref|XP_009602156.1|  PREDICTED: histidine decarboxylase-like            231   2e-69    Nicotiana tomentosiformis
ref|XP_006364728.1|  PREDICTED: histidine decarboxylase-like            228   3e-68    
ref|XP_006364727.1|  PREDICTED: histidine decarboxylase-like            228   3e-68    
gb|KEH43660.1|  serine decarboxylase                                    230   5e-68    Medicago truncatula
gb|EYU40386.1|  hypothetical protein MIMGU_mgv1a026369mg                224   5e-68    Erythranthe guttata [common monkey flower]
gb|KDD76585.1|  hypothetical protein H632_c172p0                        229   5e-68    Helicosporidium sp. ATCC 50920
ref|XP_011082256.1|  PREDICTED: serine decarboxylase-like               228   6e-68    
gb|EMS65243.1|  Histidine decarboxylase                                 223   3e-67    Triticum urartu
gb|EYU30500.1|  hypothetical protein MIMGU_mgv1a023109mg                224   5e-67    Erythranthe guttata [common monkey flower]
gb|KIZ00141.1|  histidine decarboxylase                                 226   9e-67    Monoraphidium neglectum
gb|EYU19378.1|  hypothetical protein MIMGU_mgv1a006611mg                224   1e-66    Erythranthe guttata [common monkey flower]
ref|XP_006362640.1|  PREDICTED: histidine decarboxylase-like            221   2e-66    
gb|EEC76705.1|  hypothetical protein OsI_14710                          223   2e-66    Oryza sativa Indica Group [Indian rice]
gb|AES62380.2|  serine decarboxylase                                    223   3e-66    Medicago truncatula
ref|XP_003592129.1|  Serine decarboxylase                               223   5e-66    
gb|EEE60437.1|  hypothetical protein OsJ_13648                          218   2e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004245146.1|  PREDICTED: histidine decarboxylase-like            221   2e-65    Solanum lycopersicum
ref|XP_004245145.1|  PREDICTED: histidine decarboxylase-like            221   3e-65    Solanum lycopersicum
ref|XP_005646136.1|  serine decarboxylase                               218   4e-65    Coccomyxa subellipsoidea C-169
ref|XP_003592132.1|  FAR1-related protein                               229   9e-65    
sp|Q7X8D4.2|SDC3_ORYSJ  RecName: Full=Serine decarboxylase 3            219   2e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663420.1|  PREDICTED: histidine decarboxylase-like            218   3e-64    Oryza brachyantha
ref|XP_002456988.1|  hypothetical protein SORBIDRAFT_03g046840          219   3e-64    Sorghum bicolor [broomcorn]
ref|XP_004245144.1|  PREDICTED: histidine decarboxylase                 217   6e-64    Solanum lycopersicum
ref|NP_001234136.1|  histidine decarboxylase                            213   1e-62    
gb|AEW07461.1|  hypothetical protein 0_2106_01                          203   4e-62    Pinus radiata
gb|AFG54679.1|  hypothetical protein 0_2106_01                          201   2e-61    Pinus taeda
ref|XP_007159060.1|  hypothetical protein PHAVU_002G204900g             209   7e-61    Phaseolus vulgaris [French bean]
ref|XP_009609584.1|  PREDICTED: histidine decarboxylase-like            203   2e-60    
ref|XP_007159059.1|  hypothetical protein PHAVU_002G204900g             209   2e-60    Phaseolus vulgaris [French bean]
ref|XP_002292250.1|  histidine decarboxylase                            194   5e-56    Thalassiosira pseudonana CCMP1335
ref|XP_002178784.1|  predicted protein                                  192   4e-55    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002679079.1|  predicted protein                                  191   8e-54    Naegleria gruberi strain NEG-M
ref|XP_004364837.2|  serine decarboxylase                               193   4e-53    Capsaspora owczarzaki ATCC 30864
gb|KJE90702.1|  serine decarboxylase                                    192   5e-53    Capsaspora owczarzaki ATCC 30864
ref|XP_003593127.1|  Histidine decarboxylase                            163   8e-47    
ref|WP_026730962.1|  histidine decarboxylase                            162   1e-43    
ref|WP_040468965.1|  histidine decarboxylase                            152   4e-42    
ref|WP_017312078.1|  histidine decarboxylase                            158   7e-42    Fischerella sp. PCC 9339
gb|ABA93664.1|  retrotransposon protein, putative, unclassified         163   8e-42    Oryza sativa Japonica Group [Japonica rice]
ref|WP_015112001.1|  Histidine decarboxylase                            156   3e-41    Nostoc sp. PCC 7107
ref|WP_016859640.1|  histidine decarboxylase                            156   4e-41    Fischerella muscicola
ref|WP_016870188.1|  histidine decarboxylase                            153   3e-40    Fischerella muscicola
ref|WP_026721610.1|  histidine decarboxylase                            153   4e-40    Fischerella sp. PCC 9431
ref|WP_009455225.1|  histidine decarboxylase                            152   5e-40    Fischerella thermalis
ref|WP_012408195.1|  histidine decarboxylase                            150   3e-39    Nostoc punctiforme
ref|XP_005840580.1|  hypothetical protein GUITHDRAFT_156940             147   2e-38    Guillardia theta CCMP2712
ref|WP_026731780.1|  histidine decarboxylase                            145   2e-37    
ref|NP_001176002.1|  Os10g0105700                                       141   4e-37    
gb|KCW71157.1|  hypothetical protein EUGRSUZ_F04254                     133   1e-35    Eucalyptus grandis [rose gum]
ref|WP_025665600.1|  histidine decarboxylase                            141   1e-35    Aquimarina megaterium
ref|WP_003514849.1|  histidine decarboxylase                            141   1e-35    Hungateiclostridium thermocellum
ref|WP_003516909.1|  histidine decarboxylase                            141   2e-35    Hungateiclostridium thermocellum
ref|WP_034238501.1|  histidine decarboxylase                            140   2e-35    Aquimarina atlantica
ref|WP_023062889.1|  histidine decarboxylase                            141   2e-35    Hungateiclostridium thermocellum
ref|WP_020457998.1|  histidine decarboxylase                            141   2e-35    Hungateiclostridium thermocellum
gb|EZH75803.1|  histidine decarboxylase                                 140   2e-35    Aquimarina atlantica
gb|EYU24758.1|  hypothetical protein MIMGU_mgv1a026373mg                137   4e-35    Erythranthe guttata [common monkey flower]
ref|WP_008878268.1|  Pyridoxal-dependent decarboxylase                  138   9e-35    
ref|WP_035090976.1|  histidine decarboxylase                            138   9e-35    Aquimarina macrocephali
ref|WP_017497877.1|  histidine decarboxylase                            136   8e-34    Flavobacterium sp. WG21
dbj|BAH97114.1|  amino acid decarboxylase                               134   1e-33    Naegleria fowleri [brain-eating amoeba]
ref|WP_014680621.1|  histidine decarboxylase                            135   2e-33    Solitalea canadensis
gb|EMT14424.1|  Histidine decarboxylase                                 135   4e-33    
ref|WP_004156018.1|  histidine decarboxylase                            134   4e-33    Microscilla marina
ref|WP_027411177.1|  histidine decarboxylase                            133   7e-33    Aquimarina muelleri
ref|WP_034760693.1|  histidine decarboxylase                            133   9e-33    Chryseobacterium sp. OV259
ref|WP_034646581.1|  histidine decarboxylase                            132   3e-32    Cellulophaga
gb|EAZ18332.1|  hypothetical protein OsJ_33863                          132   3e-32    Oryza sativa Japonica Group [Japonica rice]
ref|WP_038505799.1|  histidine decarboxylase                            132   3e-32    Cellulophaga lytica
ref|WP_013621330.1|  histidine decarboxylase                            132   3e-32    Cellulophaga lytica
gb|AFY36874.1|  Histidine decarboxylase                                 134   3e-32    Leptolyngbya sp. PCC 7376
ref|WP_041764715.1|  hypothetical protein                               131   5e-32    
ref|WP_042506313.1|  histidine decarboxylase                            130   7e-32    Algibacter lectus
ref|WP_011142216.1|  histidine decarboxylase                            130   8e-32    Gloeobacter violaceus
ref|WP_024740708.1|  histidine decarboxylase                            130   9e-32    Tenacibaculum maritimum
ref|WP_043706361.1|  histidine decarboxylase                            130   1e-31    
ref|WP_015192440.1|  Histidine decarboxylase                            131   2e-31    Stanieria cyanosphaera
ref|WP_040295065.1|  hypothetical protein                               129   2e-31    
gb|EIJ41099.1|  PLP-dependent enzyme, glutamate decarboxylase           129   2e-31    Beggiatoa alba B18LD
gb|KFF73912.1|  histidine decarboxylase                                 129   4e-31    Chryseobacterium sp. P1-3
ref|WP_007138876.1|  histidine decarboxylase                            129   4e-31    Flavobacterium frigoris
ref|WP_036288070.1|  histidine decarboxylase                            128   5e-31    
ref|WP_014680343.1|  histidine decarboxylase                            128   7e-31    Solitalea canadensis
gb|KHN17002.1|  Histidine decarboxylase                                 129   7e-31    Glycine soja [wild soybean]
ref|WP_038006112.1|  histidine decarboxylase                            128   8e-31    Tenacibaculum sp. 47A_GOM-205m
ref|WP_008032061.1|  Pyridoxal-dependent decarboxylase                  128   9e-31    Rhodobacter sp. SW2
ref|WP_019504461.1|  hypothetical protein                               128   1e-30    Pleurocapsa sp. PCC 7319
ref|WP_026632650.1|  histidine decarboxylase                            127   2e-30    
ref|WP_026815498.1|  histidine decarboxylase                            127   2e-30    
ref|WP_013663956.1|  histidine decarboxylase                            126   2e-30    
gb|KIX22111.1|  histidine decarboxylase                                 127   2e-30    
ref|WP_037437993.1|  histidine decarboxylase                            126   3e-30    
ref|WP_028889574.1|  histidine decarboxylase                            126   3e-30    
gb|AGT16577.1|  histidine decarboxylase-like protein                    125   5e-30    
ref|WP_042499973.1|  histidine decarboxylase                            125   5e-30    
ref|WP_039116802.1|  histidine decarboxylase                            125   6e-30    
ref|XP_008620940.1|  histidine decarboxylase                            125   1e-29    
ref|WP_025146293.1|  histidine decarboxylase                            124   1e-29    
ref|WP_029274788.1|  histidine decarboxylase                            124   1e-29    
ref|WP_040574889.1|  hypothetical protein                               124   2e-29    
ref|WP_041885112.1|  histidine decarboxylase                            124   2e-29    
ref|WP_010473064.1|  histidine decarboxylase                            124   4e-29    
ref|WP_012166190.1|  histidine decarboxylase                            124   5e-29    
ref|WP_009963501.1|  histidine decarboxylase                            123   5e-29    
ref|WP_014201338.1|  histidine decarboxylase                            122   6e-29    
ref|WP_039472909.1|  histidine decarboxylase                            122   7e-29    
gb|EIJ36795.1|  Pyridoxal-dependent decarboxylase                       122   8e-29    
gb|KDO21825.1|  hypothetical protein SPRG_12642                         122   8e-29    
ref|WP_026362388.1|  histidine decarboxylase                            121   2e-28    
ref|WP_038239506.1|  histidine decarboxylase                            121   2e-28    
gb|KGR35339.1|  histidine decarboxylase                                 121   2e-28    
ref|XP_009600053.1|  PREDICTED: histidine decarboxylase-like            118   2e-28    
ref|WP_005427952.1|  histidine decarboxylase                            121   2e-28    
ref|WP_036146264.1|  histidine decarboxylase                            120   3e-28    
ref|WP_041881750.1|  histidine decarboxylase                            120   3e-28    
ref|WP_038528108.1|  histidine decarboxylase                            120   4e-28    
ref|WP_012127831.1|  histidine decarboxylase                            120   5e-28    
ref|WP_038863593.1|  histidine decarboxylase                            120   5e-28    
ref|WP_038890337.1|  histidine decarboxylase                            119   7e-28    
ref|WP_005533429.1|  histidine decarboxylase                            119   8e-28    
ref|WP_010647516.1|  histidine decarboxylase                            119   1e-27    
ref|WP_038170807.1|  histidine decarboxylase                            119   1e-27    
ref|WP_017055794.1|  histidine decarboxylase                            119   1e-27    
ref|WP_034885662.1|  pyridoxal-dependent decarboxylase                  118   2e-27    
ref|WP_033002296.1|  histidine decarboxylase                            117   3e-27    
ref|WP_016529303.1|  histidine decarboxylase                            117   4e-27    
ref|WP_040841268.1|  hypothetical protein                               117   4e-27    
ref|WP_018151708.1|  hypothetical protein                               117   5e-27    
ref|WP_013995757.1|  histidine decarboxylase                            116   7e-27    
ref|WP_038267770.1|  histidine decarboxylase                            116   8e-27    
ref|WP_028892147.1|  histidine decarboxylase                            116   9e-27    
ref|WP_010913856.1|  histidine decarboxylase                            116   1e-26    
ref|WP_020977926.1|  histidine decarboxylase                            115   2e-26    
ref|WP_009841733.1|  histidine decarboxylase                            115   2e-26    
ref|WP_011154645.1|  histidine decarboxylase                            115   3e-26    
ref|WP_013661870.1|  histidine decarboxylase                            113   1e-25    
ref|WP_004737502.1|  histidine decarboxylase                            113   1e-25    
gb|ABR25820.1|  histidine decarboxylase                                 107   1e-25    
dbj|GAJ47127.1|  histidine decarboxylase                                112   1e-25    
ref|WP_010181748.1|  histidine decarboxylase                            113   2e-25    
gb|KDW84254.1|  hypothetical protein AC70_4802                          108   2e-25    
ref|WP_034524496.1|  histidine decarboxylase                            112   2e-25    
emb|CCJ09762.1|  putative histidine decarboxylase-like                  105   3e-25    
ref|WP_043144304.1|  histidine decarboxylase                            112   3e-25    
ref|WP_042467211.1|  histidine decarboxylase                            112   3e-25    
gb|EQC02399.1|  histidine decarboxylase                                 112   3e-25    
gb|ABO92295.1|  histidine decarboxylase                                 112   3e-25    
ref|WP_034281999.1|  histidine decarboxylase                            112   3e-25    
gb|EHI50832.1|  histidine decarboxylase                                 112   3e-25    
emb|CAN84646.1|  histidine decarboxylase                                111   6e-25    
ref|WP_042556656.1|  histidine decarboxylase                            111   8e-25    
ref|WP_004863422.1|  histidine decarboxylase                            110   1e-24    
ref|WP_042585292.1|  histidine decarboxylase                            110   1e-24    
ref|WP_012069347.1|  histidine decarboxylase                            110   1e-24    
gb|KIP17071.1|  histidine decarboxylase                                 110   1e-24    
ref|WP_005788362.1|  histidine decarboxylase                            110   2e-24    
ref|WP_022551512.1|  Histidine decarboxylase                            109   2e-24    
ref|WP_026037108.1|  histidine decarboxylase                            108   4e-24    
ref|WP_029661164.1|  hypothetical protein                               108   4e-24    
ref|WP_010521317.1|  histidine decarboxylase                            108   4e-24    
ref|WP_036985757.1|  histidine decarboxylase                            108   5e-24    
ref|WP_034119545.1|  histidine decarboxylase                            108   5e-24    
ref|WP_026948110.1|  hypothetical protein                               108   6e-24    
ref|WP_043639836.1|  histidine decarboxylase                            108   6e-24    
ref|WP_043592636.1|  histidine decarboxylase                            108   6e-24    
gb|EFA28401.1|  histidine decarboxylase                                 105   6e-24    
ref|WP_031316740.1|  histidine decarboxylase                            108   8e-24    
ref|WP_006995234.1|  MULTISPECIES: histidine decarboxylase              108   9e-24    
ref|WP_030334778.1|  histidine decarboxylase                            108   9e-24    
ref|WP_010864579.1|  histidine decarboxylase                            107   9e-24    
ref|WP_005692801.1|  histidine decarboxylase                            107   1e-23    
ref|WP_039045861.1|  histidine decarboxylase                            107   1e-23    
ref|WP_005301029.1|  histidine decarboxylase                            107   1e-23    
dbj|BAE94285.1|  histidine decarboxylase                                107   1e-23    
ref|WP_018788874.1|  histidine decarboxylase                            107   1e-23    
ref|WP_018788565.1|  histidine decarboxylase                            107   2e-23    
gb|KJF87341.1|  histidine decarboxylase                                 104   2e-23    
dbj|GAD76103.1|  hypothetical protein VAZ01S_036_00470                  107   2e-23    
ref|WP_022610851.1|  Histidine decarboxylase                            107   2e-23    
ref|WP_022589616.1|  Histidine decarboxylase                            107   2e-23    
ref|WP_004401828.1|  histidine decarboxylase                            107   2e-23    
ref|WP_033003777.1|  histidine decarboxylase                            107   2e-23    
ref|WP_025468757.1|  histidine decarboxylase                            103   4e-23    
gb|EMU06553.1|  histidine decarboxylase                                 103   4e-23    
ref|WP_002058887.1|  histidine decarboxylase                            105   8e-23    
ref|WP_032037888.1|  histidine decarboxylase                            105   9e-23    
ref|WP_005138337.1|  histidine decarboxylase                            105   1e-22    
ref|WP_005131724.1|  histidine decarboxylase                            104   1e-22    
ref|WP_011533709.1|  histidine decarboxylase                            104   2e-22    
gb|EYU30499.1|  hypothetical protein MIMGU_mgv1a018143mg                102   2e-22    
ref|WP_020302734.1|  histidine decarboxylase                            103   2e-22    
ref|WP_014718553.1|  MULTISPECIES: histidine decarboxylase              103   2e-22    
ref|WP_019817102.1|  histidine decarboxylase                            103   2e-22    
sp|P95477.1|DCHS_PSEFL  RecName: Full=Histidine decarboxylase; Sh...    103   3e-22    
ref|WP_036558522.1|  histidine decarboxylase                            103   3e-22    
ref|WP_004869084.1|  MULTISPECIES: histidine decarboxylase              103   3e-22    
gb|AAA25071.1|  histidine decarboxylase                                 103   3e-22    
ref|WP_000603877.1|  histidine decarboxylase                            103   4e-22    
ref|WP_005196164.1|  histidine decarboxylase                            103   4e-22    
ref|WP_033847713.1|  histidine decarboxylase                            103   5e-22    
ref|WP_000603871.1|  histidine decarboxylase                            103   5e-22    
ref|WP_005068053.1|  MULTISPECIES: histidine decarboxylase              103   5e-22    
ref|WP_031993225.1|  histidine decarboxylase                            103   5e-22    
ref|WP_031995260.1|  histidine decarboxylase                            103   5e-22    
ref|WP_005109677.1|  histidine decarboxylase                            103   5e-22    
ref|WP_032045777.1|  histidine decarboxylase                            102   5e-22    
ref|WP_000603869.1|  histidine decarboxylase                            102   5e-22    
ref|WP_018828666.1|  histidine decarboxylase                            103   5e-22    
ref|WP_031965236.1|  histidine decarboxylase                            102   5e-22    
ref|WP_032060642.1|  histidine decarboxylase                            102   5e-22    
ref|WP_032058746.1|  histidine decarboxylase                            102   5e-22    
ref|WP_004746555.1|  histidine decarboxylase                            102   5e-22    
ref|WP_039759067.1|  histidine decarboxylase                            102   5e-22    
ref|WP_016653750.1|  histidine decarboxylase                            102   5e-22    
ref|WP_004840538.1|  histidine decarboxylase                            102   5e-22    
ref|WP_011859800.1|  histidine decarboxylase                            102   5e-22    
ref|WP_024436628.1|  histidine decarboxylase                            102   5e-22    
ref|WP_024433575.1|  histidine decarboxylase                            102   5e-22    
ref|WP_021511013.1|  histidine decarboxylase                            102   5e-22    
ref|WP_017480701.1|  MULTISPECIES: histidine decarboxylase              102   5e-22    
ref|WP_000603872.1|  histidine decarboxylase                            102   5e-22    
ref|WP_031978061.1|  histidine decarboxylase                            102   5e-22    
ref|WP_000603865.1|  histidine decarboxylase                            102   5e-22    
ref|WP_023896388.1|  Histidine decarboxylase                            102   5e-22    
ref|WP_017386577.1|  MULTISPECIES: histidine decarboxylase              102   5e-22    
ref|WP_000603876.1|  histidine decarboxylase                            102   5e-22    
ref|WP_030424673.1|  histidine decarboxylase                            102   5e-22    
ref|WP_000603861.1|  histidine decarboxylase                            102   5e-22    
ref|WP_000927250.1|  histidine decarboxylase                            102   5e-22    
ref|WP_000603880.1|  histidine decarboxylase                            102   5e-22    
ref|WP_044101067.1|  histidine decarboxylase                            102   5e-22    
ref|WP_017815795.1|  histidine decarboxylase                            102   5e-22    
ref|WP_031955420.1|  histidine decarboxylase                            102   5e-22    
ref|WP_000603882.1|  histidine decarboxylase                            102   5e-22    
ref|WP_032009129.1|  histidine decarboxylase                            102   6e-22    
gb|KJG27749.1|  histidine decarboxylase                                 102   6e-22    
ref|WP_032001354.1|  histidine decarboxylase                            102   6e-22    
ref|WP_032027924.1|  histidine decarboxylase                            102   6e-22    
gb|KJG35078.1|  histidine decarboxylase                                 102   6e-22    
ref|WP_038349211.1|  histidine decarboxylase                            102   6e-22    
ref|WP_000603863.1|  histidine decarboxylase                            102   6e-22    
ref|WP_000603881.1|  histidine decarboxylase                            102   6e-22    
ref|WP_002132193.1|  histidine decarboxylase                            102   7e-22    
ref|WP_013289227.1|  histidine decarboxylase                            102   7e-22    
ref|WP_000603864.1|  histidine decarboxylase                            102   7e-22    
ref|WP_002046800.1|  histidine decarboxylase                            102   7e-22    
ref|WP_032004531.1|  histidine decarboxylase                            102   7e-22    
ref|WP_031948968.1|  histidine decarboxylase                            102   7e-22    
ref|WP_005073362.1|  histidine decarboxylase                            102   7e-22    
ref|WP_002126558.1|  histidine decarboxylase                            102   7e-22    
ref|WP_023221881.1|  histidine decarboxylase                            102   8e-22    
ref|WP_043188769.1|  histidine decarboxylase                            102   8e-22    
ref|WP_023248740.1|  histidine decarboxylase                            102   8e-22    
ref|WP_002118388.1|  MULTISPECIES: histidine decarboxylase              102   8e-22    
ref|WP_032017576.1|  histidine decarboxylase                            102   8e-22    
ref|WP_001750840.1|  histidine decarboxylase                            102   8e-22    
ref|WP_032035746.1|  histidine decarboxylase                            102   8e-22    
ref|WP_005128217.1|  histidine decarboxylase                            102   8e-22    
ref|WP_000603866.1|  histidine decarboxylase                            102   8e-22    
ref|WP_032063040.1|  histidine decarboxylase                            102   9e-22    
gb|AAO65983.1|  putative pyridoxal 5' phosphate-dependent histidi...    102   9e-22    
ref|WP_017725496.1|  histidine decarboxylase                            102   9e-22    
ref|WP_005084750.1|  MULTISPECIES: histidine decarboxylase              102   9e-22    
dbj|BAE94284.1|  histidine decarboxylase                                102   9e-22    
ref|WP_039098800.1|  histidine decarboxylase                            102   9e-22    
ref|WP_032058148.1|  histidine decarboxylase                            102   9e-22    
ref|WP_031976591.1|  histidine decarboxylase                            102   9e-22    
ref|WP_032866759.1|  histidine decarboxylase                            102   9e-22    
ref|WP_009507303.1|  histidine decarboxylase                            102   9e-22    
ref|WP_032874071.1|  histidine decarboxylase                            102   9e-22    
ref|WP_000603873.1|  histidine decarboxylase                            102   9e-22    
ref|WP_000603868.1|  MULTISPECIES: histidine decarboxylase              102   1e-21    
ref|WP_000603867.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000603862.1|  histidine decarboxylase                            102   1e-21    
ref|WP_000603875.1|  histidine decarboxylase                            102   1e-21    
dbj|BAC87908.1|  probable acinetobactin biosynthesis protein            102   1e-21    
gb|EEP75303.1|  histidine decarboxylase                                 101   1e-21    
ref|WP_000603884.1|  histidine decarboxylase                            102   1e-21    
ref|WP_033851982.1|  histidine decarboxylase                            102   1e-21    
ref|WP_025152530.1|  histidine decarboxylase                            101   1e-21    
gb|KJG15285.1|  histidine decarboxylase                                 101   1e-21    
ref|WP_031380129.1|  histidine decarboxylase                            101   1e-21    
ref|WP_024439211.1|  histidine decarboxylase                            101   1e-21    
ref|WP_036788792.1|  histidine decarboxylase                            101   1e-21    
ref|WP_032068226.1|  histidine decarboxylase                            101   1e-21    
ref|WP_024474395.1|  histidine decarboxylase                            101   1e-21    
ref|WP_004234859.1|  MULTISPECIES: histidine decarboxylase              101   1e-21    
ref|WP_004639823.1|  histidine decarboxylase                            101   1e-21    
ref|WP_000603885.1|  histidine decarboxylase                            101   1e-21    
emb|CBV42710.1|  histidine decarboxylase                                101   2e-21    
ref|WP_031961008.1|  histidine decarboxylase                            101   2e-21    
ref|WP_032000503.1|  histidine decarboxylase                            101   2e-21    
ref|WP_000603883.1|  histidine decarboxylase                            101   2e-21    
ref|WP_000603878.1|  histidine decarboxylase                            101   2e-21    
gb|AII01327.1|  histidine decarboxylase                                 101   2e-21    
ref|WP_040791628.1|  hypothetical protein                               101   2e-21    
ref|WP_041602526.1|  histidine decarboxylase                            101   2e-21    
gb|KGF60681.1|  histidine decarboxylase                                 101   2e-21    
sp|P05034.2|DCHS_MORMO  RecName: Full=Histidine decarboxylase; Sh...    101   2e-21    
gb|ERB65931.1|  hypothetical protein N779_07570                       99.4    3e-21    
ref|WP_031964057.1|  histidine decarboxylase                            100   3e-21    
ref|WP_032043772.1|  histidine decarboxylase                            100   3e-21    
ref|WP_032055342.1|  histidine decarboxylase                            100   4e-21    
emb|CBJ48808.1|  conserved unknown protein                              100   4e-21    
ref|WP_000603870.1|  histidine decarboxylase                            100   5e-21    
ref|WP_035278364.1|  hypothetical protein                             99.8    5e-21    
ref|WP_042005730.1|  histidine decarboxylase                            100   5e-21    
ref|WP_000603874.1|  histidine decarboxylase                            100   5e-21    



>ref|XP_011101473.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
 ref|XP_011101480.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=517

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  307  KPIGSVSVSGHKFVGCPMPCGVQLTRLQHINALSSNVEYLASRDATIMGSRNGHAPIFLW  366

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  367  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRDEEFVRRWQ  426

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE NM+HVVVMPSVTVEKLD FL+E+IQ RS+WY+ GN  PPCLA D+G +NC C LH
Sbjct  427  LACEGNMAHVVVMPSVTVEKLDFFLNEIIQGRSIWYKDGNVHPPCLAADIGSNNCSCALH  486

Query  201  K  199
            K
Sbjct  487  K  487



>ref|XP_006362822.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
 ref|XP_006362823.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   340 bits (872),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  304  KPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPLFLW  363

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L GAGISAMLNELSSTVVFERPKDEEFVR+WQ
Sbjct  364  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEEFVRKWQ  423

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACERNM+HVVVMPSVTV+KLD FLDEL++ARS+WY+  + KPPCLA D+G  NCCC  H
Sbjct  424  LACERNMAHVVVMPSVTVDKLDNFLDELVEARSIWYKDEDVKPPCLASDIGSKNCCCPHH  483

Query  201  K  199
            +
Sbjct  484  R  484



>ref|XP_004237774.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
 ref|XP_010320069.1| PREDICTED: serine decarboxylase [Solanum lycopersicum]
Length=482

 Score =   340 bits (871),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  303  KPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPLFLW  362

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L GAGISAMLNELSSTVVFERPKDEEFVR+WQ
Sbjct  363  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEEFVRKWQ  422

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACERNM+HVVVMPSVTV+KLD FLDEL++ARS+WY+  + KPPCLA D+G  NCCC  H
Sbjct  423  LACERNMAHVVVMPSVTVDKLDNFLDELVEARSIWYKDEDVKPPCLASDIGSKNCCCPQH  482



>ref|XP_009616512.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
 ref|XP_009616514.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
Length=487

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  303  KPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  362

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
             TLNRKGYKGFQKEVQKCLRNAHYLKD+L GAGISAMLNELSSTVVFERPKDEEFVR+WQ
Sbjct  363  CTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEEFVRKWQ  422

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACERNMSHVVVMPSVTVEKLD FLDEL++ARS+WY+  N KPPCLA D+G  NCCC  H
Sbjct  423  LACERNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVKPPCLAADIGSQNCCCPQH  482

Query  201  K  199
            +
Sbjct  483  R  483



>ref|XP_009784234.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
 ref|XP_009784235.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
Length=487

 Score =   337 bits (864),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  303  KPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  362

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
             TLNRKGYKGFQKEVQKCLRNAHYLKD+L GAGIS MLNELSSTVVFERPKDEEFVR+WQ
Sbjct  363  CTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISGMLNELSSTVVFERPKDEEFVRKWQ  422

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACERNMSHVVVMPSVTVEKLD FLDEL++ARS+WY+  N  PPCLA D+G  NCCC  H
Sbjct  423  LACERNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVNPPCLAADIGSRNCCCPQH  482

Query  201  K*CNN  187
            + CN+
Sbjct  483  RGCNS  487



>ref|XP_007019463.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOY16688.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=491

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  311  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  370

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LRGAGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  371  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPRDEEFVRRWQ  430

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMP+VT+EKLD FLDEL++ RS WY+  + +PPC+A DVG  NC C LH
Sbjct  431  LACEGNIAHVVVMPNVTIEKLDLFLDELVEKRSTWYQEEHDQPPCIAADVGKENCACALH  490

Query  201  K  199
            K
Sbjct  491  K  491



>ref|NP_001047064.2| Os02g0541300 [Oryza sativa Japonica Group]
 dbj|BAF08978.2| Os02g0541300, partial [Oryza sativa Japonica Group]
Length=207

 Score =   322 bits (826),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  26   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRNGHAPIFLW  85

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  86   YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQ  145

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSVT++KLD FL+EL + R+ WY+ G+ +PPCLA+DVG  NC C +H
Sbjct  146  LACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIH  205

Query  201  K  199
            K
Sbjct  206  K  206



>ref|XP_010108654.1| Histidine decarboxylase [Morus notabilis]
 gb|EXC19910.1| Histidine decarboxylase [Morus notabilis]
Length=483

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  304  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  363

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LRGAGISAMLNELSSTVVFERP DEEF+RRWQ
Sbjct  364  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPLDEEFIRRWQ  423

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ NM+HVVVMP+VT+EKLD FL+ELI+ RS WY+  N +PPCLA ++G  NC C LH
Sbjct  424  LACQGNMAHVVVMPNVTIEKLDVFLNELIEERSAWYQDENVQPPCLAAEIGAENCACKLH  483



>ref|XP_010063879.1| PREDICTED: serine decarboxylase-like [Eucalyptus grandis]
Length=477

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+DHINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  297  KPIGSVSVSGHKFVGCPMPCGVQITRMDHINALSRNVEYLASRDATIMGSRNGHAPIFLW  356

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERP +EEFVRRWQ
Sbjct  357  YTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVVFERPSEEEFVRRWQ  416

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCLA D+G  NCCC LH
Sbjct  417  LACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGAENCCCALH  476

Query  201  K  199
            K
Sbjct  477  K  477



>gb|EYU17447.1| hypothetical protein MIMGU_mgv1a005353mg [Erythranthe guttata]
Length=487

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCG+Q+TRL HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  307  KPIGSVSVSGHKFVGCPMPCGIQITRLRHINALSRNVEYLASRDATIMGSRNGHAPIFLW  366

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVR WQ
Sbjct  367  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRDEEFVRMWQ  426

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE NM+H+VVMP+VTVEKLD FL+EL + R++WY+ G  +PPCLA DVG+ NC C +H
Sbjct  427  LACEGNMAHIVVMPNVTVEKLDYFLNELAKGRAIWYKDGKEQPPCLAVDVGIENCSCAVH  486

Query  201  K  199
            K
Sbjct  487  K  487



>ref|XP_010241731.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
 ref|XP_010241733.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HIN LS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  303  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINTLSRNVEYLASRDATIMGSRNGHAPIFLW  362

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  363  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLRAAGIGAMLNELSSTVVFERPQDEEFVRRWQ  422

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP++T+EKLD FL+ELIQ R  W++ G S+PPC+A DVG  NC CVLH
Sbjct  423  LACQGNIAHVVVMPNITIEKLDNFLNELIQKRLTWFQDGKSQPPCIAADVGKENCACVLH  482

Query  201  K  199
            K
Sbjct  483  K  483



>gb|KCW71161.1| hypothetical protein EUGRSUZ_F04257 [Eucalyptus grandis]
Length=517

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+DHINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  337  KPIGSVSVSGHKFVGCPMPCGVQITRMDHINALSRNVEYLASRDATIMGSRNGHAPIFLW  396

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERP +EEFVRRWQ
Sbjct  397  YTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVVFERPSEEEFVRRWQ  456

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCLA D+G  NCCC LH
Sbjct  457  LACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGAENCCCALH  516

Query  201  K  199
            K
Sbjct  517  K  517



>ref|XP_002452231.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
 gb|EES05207.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
Length=494

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  314  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLW  373

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG+ AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  374  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGVGAMLNELSSTVVFERPKDEEFVRRWQ  433

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A DVGV NC C LH
Sbjct  434  LACEGNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGVENCLCGLH  493

Query  201  K  199
            K
Sbjct  494  K  494



>emb|CDP11372.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  216  KPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLW  275

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVR+WQ
Sbjct  276  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLRQAGISAMLNELSSTVVFERPRDEEFVRQWQ  335

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ NM+HVVVMP+VT+EKL+ FLD LI+ RS+WY+    KPPCLA ++G  NC C LH
Sbjct  336  LACQGNMAHVVVMPNVTIEKLEGFLDALIEGRSIWYKDDKGKPPCLAAEIGSGNCSCPLH  395

Query  201  K  199
            K
Sbjct  396  K  396



>ref|XP_008645766.1| PREDICTED: histidine decarboxylase-like [Zea mays]
 gb|AFW71722.1| hypothetical protein ZEAMMB73_965103 [Zea mays]
Length=494

 Score =   327 bits (838),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  314  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLW  373

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  374  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQ  433

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A DVGV +C C LH
Sbjct  434  LACEGNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGVESCLCGLH  493

Query  201  K  199
            K
Sbjct  494  K  494



>ref|XP_010260914.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  303  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  362

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  363  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLRSAGIGAMLNELSSTVVFERPQDEEFVRRWQ  422

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMP++TVEKLD FL+ELI  RS W++ G S+PPC+A DVG  NC CV+H
Sbjct  423  LACQGSIAHVVVMPNITVEKLDDFLNELIGKRSTWFQDGKSQPPCIAADVGKENCACVMH  482

Query  201  K  199
            K
Sbjct  483  K  483



>ref|XP_004952686.1| PREDICTED: histidine decarboxylase-like [Setaria italica]
Length=489

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  309  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  368

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  369  YTLNRKGYVGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQ  428

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV ++KLD FL EL++ R+ WY+ G SKPPCLA D+GV NC C LH
Sbjct  429  LACEGNIAHVVVMPSVNIDKLDYFLTELVEKRATWYQDGISKPPCLARDLGVENCLCGLH  488

Query  201  K  199
            K
Sbjct  489  K  489



>sp|Q6ESZ9.1|SDC1_ORYSJ RecName: Full=Serine decarboxylase 1 [Oryza sativa Japonica Group]
 dbj|BAD28070.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD28221.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 gb|EAZ23358.1| hypothetical protein OsJ_07054 [Oryza sativa Japonica Group]
Length=482

 Score =   325 bits (832),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  301  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRNGHAPIFLW  360

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  361  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQ  420

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSVT++KLD FL+EL + R+ WY+ G+ +PPCLA+DVG  NC C +H
Sbjct  421  LACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIH  480

Query  201  K  199
            K
Sbjct  481  K  481



>gb|KDO83688.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
 gb|KDO83689.1| hypothetical protein CISIN_1g011842mg [Citrus sinensis]
Length=476

 Score =   324 bits (831),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  296  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  355

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  356  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQ  415

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT++KLD FL+ELI+ RS WYE G  +PPC+A D+G  NC C  H
Sbjct  416  LACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAH  475

Query  201  K  199
            K
Sbjct  476  K  476



>gb|EAY86197.1| hypothetical protein OsI_07573 [Oryza sativa Indica Group]
Length=484

 Score =   324 bits (831),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  303  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINRLSSNVEYLASRDATIMGSRNGHAPIFLW  362

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  363  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEEFVRRWQ  422

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSVT++KLD FL+EL + R+ WY+ G+ +PPCLA+DVG  NC C +H
Sbjct  423  LACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIH  482

Query  201  K  199
            K
Sbjct  483  K  483



>ref|XP_006472964.1| PREDICTED: histidine decarboxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006472965.1| PREDICTED: histidine decarboxylase-like isoform X2 [Citrus sinensis]
Length=476

 Score =   324 bits (831),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  296  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  355

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  356  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQ  415

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT++KLD FL+ELI+ RS WYE G  +PPC+A D+G  NC C  H
Sbjct  416  LACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAH  475

Query  201  K  199
            K
Sbjct  476  K  476



>ref|XP_003575093.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=470

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  289  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLW  348

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L  AGI AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  349  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLNAAGIGAMLNELSSTVVFERPKDEEFVRRWQ  408

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSVT++KLD FL EL++ R+VWY+ G  +PPC+A DVG  +C C LH
Sbjct  409  LACEGNIAHVVVMPSVTIDKLDYFLRELVEKRAVWYKDGICQPPCIARDVGEKSCFCSLH  468

Query  201  K  199
            K
Sbjct  469  K  469



>ref|XP_006434436.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47676.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=476

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  296  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  355

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  356  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQ  415

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT++KLD FL+ELI  RS WYE G  +PPC+A D+G  NC C  H
Sbjct  416  LACQGNIAHVVVMPNVTIDKLDDFLNELIDNRSTWYEDGKRQPPCIAADIGSENCVCAAH  475

Query  201  K  199
            K
Sbjct  476  K  476



>ref|XP_010931002.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
 ref|XP_010931003.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
Length=475

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HI  LSSNVEYLASRD+TIMGSRNGHAPIFLW
Sbjct  294  KPIGSVSVSGHKFVGCPMPCGVQITRLEHIKVLSSNVEYLASRDSTIMGSRNGHAPIFLW  353

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG+ AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  354  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKAAGVGAMLNELSSTVVFERPKDEEFVRRWQ  413

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++H+VVMP+VT+EKLD FL+ELIQ RS WYEGG    PCLA D+G  NC C LH
Sbjct  414  LACEGNIAHIVVMPNVTIEKLDTFLNELIQKRSSWYEGGKIPSPCLAADIGDENCLCSLH  473

Query  201  K  199
            +
Sbjct  474  Q  474



>gb|KDP43008.1| hypothetical protein JCGZ_25194 [Jatropha curcas]
Length=484

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL+HIN LS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  304  KPIGSVSVSGHKFVGCPMPCGVQLTRLEHINVLSRNVEYLASRDATIMGSRNGHAPIFLW  363

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  364  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPRDEEFVRRWQ  423

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMP+VT+EKLD FL+ELI+ RS WY+ G  + PC+A DVG  NC C LH
Sbjct  424  LACQGSIAHVVVMPNVTIEKLDNFLNELIEKRSTWYQDGQLQSPCIATDVGSENCACALH  483

Query  201  K  199
            K
Sbjct  484  K  484



>ref|XP_003579728.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=469

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL HINAL+SNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  288  KPIGSVSVSGHKFVGCPMPCGVQITRLKHINALASNVEYLASRDATIMGSRNGHAPIFLW  347

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  348  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLRNAGISAMLNELSSTVVFERPKDEEFVRRWQ  407

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N+SHVVVMPSVT+ KLD FL+EL++ R  WY+ G  + PC+A DVG  NC C +H
Sbjct  408  LACEGNISHVVVMPSVTINKLDSFLNELVEKRVTWYQEGICQSPCIAGDVGQHNCLCTMH  467

Query  201  K  199
            K
Sbjct  468  K  468



>ref|XP_004290538.1| PREDICTED: serine decarboxylase [Fragaria vesca subsp. vesca]
Length=476

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HIN LS+NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  296  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINVLSNNVEYLASRDATIMGSRNGHAPIFLW  355

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  356  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPQDEEFVRRWQ  415

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSV+V+KLD FL+EL++ RS WY+ G  +PPC+A DVG  NC C  H
Sbjct  416  LACQGNIAHVVVMPSVSVDKLDDFLNELVEKRSTWYKDGKVQPPCIAADVGSENCVCGRH  475

Query  201  K  199
            K
Sbjct  476  K  476



>ref|XP_002306690.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE93686.1| serine decarboxylase family protein [Populus trichocarpa]
Length=478

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI+ LS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  293  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIDVLSRNVEYLASRDATIMGSRNGHAPIFLW  352

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP DEEFVRRWQ
Sbjct  353  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLHDAGISAMLNELSSTVVFERPLDEEFVRRWQ  412

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSVT+EKLD FL+EL++ RS+WY  G  +PPC+A DVG  NC C LH
Sbjct  413  LACQGNIAHVVVMPSVTIEKLDDFLNELVEKRSIWYRDGGVQPPCIAADVGCENCACALH  472

Query  201  K  199
            K
Sbjct  473  K  473



>ref|XP_011044197.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=478

 Score =   322 bits (826),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI+ LS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  293  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIDVLSRNVEYLASRDATIMGSRNGHAPIFLW  352

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP DEEFVRRWQ
Sbjct  353  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLHDAGISAMLNELSSTVVFERPLDEEFVRRWQ  412

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSVT+EKLD FL+EL++ RS WY  G  +PPC+A DVG  NC C LH
Sbjct  413  LACQGNIAHVVVMPSVTIEKLDDFLNELVEKRSTWYRDGGVQPPCIAADVGCENCACALH  472

Query  201  K  199
            K
Sbjct  473  K  473



>ref|XP_011042836.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
 ref|XP_011042837.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=463

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  283  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  342

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNA+YLKD+LR AGISAMLNELSSTVVFERP DE+FVRRWQ
Sbjct  343  YTLNRKGYKGFQKEVQKCLRNAYYLKDRLRDAGISAMLNELSSTVVFERPIDEDFVRRWQ  402

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSVT+EKLD F++EL++ RS WY+   ++PPC+A DVG  NC C LH
Sbjct  403  LACQGNIAHVVVMPSVTIEKLDDFVNELVEKRSTWYQDEKARPPCIAADVGSQNCSCDLH  462

Query  201  K  199
            K
Sbjct  463  K  463



>ref|XP_006393773.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
 gb|ESQ31059.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
Length=489

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  310  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  369

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  370  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  429

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCLA+DVG +NC C  H
Sbjct  430  LACQGDIAHVVVMPSVTIEKLDHFLKDLVEHRSVWYEDG-SQPPCLAKDVGTNNCICPTH  488

Query  201  K  199
            K
Sbjct  489  K  489



>gb|KJB16470.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=479

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  300  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPLFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  360  YTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRDEEFVRRWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G +NC C LH
Sbjct  420  LACEGNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGKANCVCALH  478

Query  201  K  199
            K
Sbjct  479  K  479



>gb|KJB16468.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=478

 Score =   321 bits (823),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  299  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPLFLW  358

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  359  YTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRDEEFVRRWQ  418

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G +NC C LH
Sbjct  419  LACEGNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGKANCVCALH  477

Query  201  K  199
            K
Sbjct  478  K  478



>gb|KJB16469.1| hypothetical protein B456_002G231300 [Gossypium raimondii]
Length=477

 Score =   321 bits (823),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  298  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPLFLW  357

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  358  YTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRDEEFVRRWQ  417

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G +NC C LH
Sbjct  418  LACEGNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGKANCVCALH  476

Query  201  K  199
            K
Sbjct  477  K  477



>gb|KHG24953.1| Histidine decarboxylase [Gossypium arboreum]
Length=478

 Score =   321 bits (823),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  299  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPLFLW  358

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQK+VQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  359  YTLNRKGYKGFQKDVQKCLRNAHYLKDRLHEAGISAMLNELSSTVVFERPRDEEFVRRWQ  418

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMP+VT+EKLD FL+EL++ RS WY+ GN +PPC+A ++G +NC C LH
Sbjct  419  LACEGNIAHVVVMPNVTIEKLDFFLNELVEKRSTWYQ-GNVQPPCIAAEIGKANCVCALH  477

Query  201  K  199
            K
Sbjct  478  K  478



>ref|XP_009416900.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   321 bits (823),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR  HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  298  KPIGSVSVSGHKFVGCPMPCGVQITRSKHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  357

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGIS MLNELSSTVVFERPKDEEFVR+WQ
Sbjct  358  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGISVMLNELSSTVVFERPKDEEFVRQWQ  417

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMP+VT++KLD FL+EL++ RS WY+ GN  PPC+A D+G  NCCC LH
Sbjct  418  LACEGNIAHVVVMPNVTIDKLDSFLNELLRHRSCWYQEGNISPPCIAADIGEENCCCALH  477

Query  201  K  199
            +
Sbjct  478  R  478



>ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis]
 gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis]
Length=471

 Score =   321 bits (822),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  291  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSKNVEYLASRDATIMGSRNGHAPIFLW  350

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQK+VQKCLRNAHYLK +LR AGISAMLNELSSTVV ERPKDEEFVRRWQ
Sbjct  351  YTLNRKGYKGFQKDVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVLERPKDEEFVRRWQ  410

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSVT+EKLD FLDEL++ RS WY+ G  + PC+A DVG  NC C LH
Sbjct  411  LACQGNIAHVVVMPSVTIEKLDNFLDELVKKRSTWYQDGQVQSPCIAADVGSENCACALH  470



>dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris]
Length=487

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  307  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINTLSSNVEYLASRDATIMGSRNGHAPIFLW  366

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+LR  GISAMLNELSSTVVFERP DEEF+RRWQ
Sbjct  367  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLREVGISAMLNELSSTVVFERPLDEEFIRRWQ  426

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP++T++KL+ FLDEL++ RS W++ G +KPPC+A D+G  NC C +H
Sbjct  427  LACQGNIAHVVVMPNITIDKLESFLDELVEKRSTWFKDGTNKPPCVASDIGQENCVCPMH  486

Query  201  K  199
            K
Sbjct  487  K  487



>ref|XP_006434437.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
 gb|ESR47677.1| hypothetical protein CICLE_v10000775mg [Citrus clementina]
Length=544

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  364  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  423

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  424  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQ  483

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT++KLD FL+ELI  RS WYE G  +PPC+A D+G  NC C  H
Sbjct  484  LACQGNIAHVVVMPNVTIDKLDDFLNELIDNRSTWYEDGKRQPPCIAADIGSENCVCAAH  543

Query  201  K  199
            K
Sbjct  544  K  544



>ref|XP_007201012.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
 gb|EMJ02211.1| hypothetical protein PRUPE_ppa005028mg [Prunus persica]
Length=480

 Score =   321 bits (822),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  300  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  360  YTLNKKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSV ++KLD FL+EL++ RS WY     +PPC+A DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVNIDKLDDFLNELVEKRSTWYNDEKVQPPCIAADVGTENCACGQH  479

Query  201  K  199
            K
Sbjct  480  K  480



>emb|CBI18554.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  258  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  317

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP D+EFVRRWQ
Sbjct  318  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPVDDEFVRRWQ  377

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FLDELI+ R+ W+     +PPC+A D+G  NC C LH
Sbjct  378  LACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGSENCLCDLH  437

Query  201  K  199
            K
Sbjct  438  K  438



>ref|XP_009406072.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  298  KPIGSVSVSGHKFVGCPMPCGVQITRLKHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  357

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKC+RNAHYLKD+L+ AGI AMLNELSSTVVFERPKD+EFVRRWQ
Sbjct  358  YTLNRKGYRGFQKEVQKCVRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDDEFVRRWQ  417

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMP+V ++KLD FL+EL Q RS WY+ G   PPC+A D+G  NC CVLH
Sbjct  418  LACEGNIAHVVVMPNVNIDKLDSFLEELFQKRSCWYQDGKMPPPCIAADIGQDNCFCVLH  477

Query  201  K  199
            K
Sbjct  478  K  478



>ref|XP_002302186.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE81459.1| serine decarboxylase family protein [Populus trichocarpa]
Length=463

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  283  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLW  342

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNA+YLKD+LR AGISAMLNELSSTVVFERP DE+FVRRWQ
Sbjct  343  YTLNRKGYKGFQKEVQKCLRNAYYLKDRLRDAGISAMLNELSSTVVFERPIDEDFVRRWQ  402

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSVT+EKLD F++EL++ RS WY+    +PPC+A D+G  NC C LH
Sbjct  403  LACQGNIAHVVVMPSVTIEKLDDFVNELVEKRSTWYQDEKVRPPCIAADIGSQNCSCDLH  462

Query  201  K  199
            K
Sbjct  463  K  463



>ref|XP_010519398.1| PREDICTED: serine decarboxylase-like [Tarenaya hassleriana]
Length=489

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI ALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  310  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKALSRNVEYLASRDATIMGSRNGHAPLFLW  369

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  370  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLRKAGISAMLNELSSTVVFERPKDEEFVRRWQ  429

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSVT+EKLD FLDEL++ RSVWY+ G S+  C+A DVGV NC C  H
Sbjct  430  LACQGNIAHVVVMPSVTIEKLDYFLDELVEQRSVWYKDG-SQALCIASDVGVENCICPAH  488

Query  201  K  199
            K
Sbjct  489  K  489



>gb|EPS66281.1| serine decarboxylase, partial [Genlisea aurea]
Length=426

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL HINALS +VEYLASRDATIMGSRNGHAPIFLW
Sbjct  247  KPIGSVSVSGHKFVGCPMPCGVQITRLRHINALSRDVEYLASRDATIMGSRNGHAPIFLW  306

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGF+KEVQKCLRNAHYL  +LR AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  307  YTLNRKGYKGFRKEVQKCLRNAHYLNHRLREAGISAMLNELSSTVVFERPRDEEFVRRWQ  366

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE +M+HVVVMP+VTV KLD FLDELI++RSVWYE G  +PPCLA D+G  NC C LH
Sbjct  367  LACEGSMAHVVVMPNVTVGKLDQFLDELIESRSVWYEDG-VEPPCLAADIGTENCSCPLH  425

Query  201  K  199
            K
Sbjct  426  K  426



>ref|XP_010680495.1| PREDICTED: serine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  307  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINTLSSNVEYLASRDATIMGSRNGHAPIFLW  366

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+LR  GISAMLNELSSTVVFERP DEEF+RRWQ
Sbjct  367  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLREVGISAMLNELSSTVVFERPLDEEFIRRWQ  426

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP++T++KL+ FLDEL++ RS W+  G +KPPC+A D+G  NC C +H
Sbjct  427  LACQGNIAHVVVMPNITIDKLESFLDELVEKRSTWFRDGTNKPPCVASDIGQENCVCPMH  486

Query  201  K  199
            K
Sbjct  487  K  487



>ref|XP_002266398.1| PREDICTED: serine decarboxylase [Vitis vinifera]
Length=482

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  302  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  361

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP D+EFVRRWQ
Sbjct  362  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPVDDEFVRRWQ  421

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FLDELI+ R+ W+     +PPC+A D+G  NC C LH
Sbjct  422  LACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGSENCLCDLH  481

Query  201  K  199
            K
Sbjct  482  K  482



>ref|XP_008243632.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=480

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  300  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  360  YTLNKKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSV ++KLD FL+EL++ RS WY+    +PPC+A DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVNIDKLDDFLNELVEKRSTWYKDEKVQPPCIAVDVGTENCACGQH  479

Query  201  K  199
            +
Sbjct  480  Q  480



>gb|AFK28264.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28265.1| putative serine decarboxylase, partial [Helianthus paradoxus]
 gb|AFK28266.1| putative serine decarboxylase, partial [Helianthus paradoxus]
Length=239

 Score =   311 bits (796),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L GAGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTGAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_004140971.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
 ref|XP_004170442.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus]
Length=486

 Score =   319 bits (818),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  305  KPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L   GISAMLNELSSTVVFERP+DEEF+RRWQ
Sbjct  365  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDVGISAMLNELSSTVVFERPRDEEFIRRWQ  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV+ EKLD FL +L++ RS WY+G N +PPC+A ++G  +C C LH
Sbjct  425  LACEGNIAHVVVMPSVSQEKLDDFLSDLVEKRSTWYDGENVQPPCVAAELGNESCACKLH  484

Query  201  K  199
            +
Sbjct  485  R  485



>ref|XP_004140972.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 ref|XP_004170443.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus]
 gb|KGN46150.1| hypothetical protein Csa_6G057160 [Cucumis sativus]
Length=481

 Score =   319 bits (817),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  300  KPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L   GISAMLNELSSTVVFERP+DEEF+RRWQ
Sbjct  360  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDVGISAMLNELSSTVVFERPRDEEFIRRWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV+ EKLD FL +L++ RS WY+G N +PPC+A ++G  +C C LH
Sbjct  420  LACEGNIAHVVVMPSVSQEKLDDFLSDLVEKRSTWYDGENVQPPCVAAELGNESCACKLH  479

Query  201  K  199
            +
Sbjct  480  R  480



>gb|KJB59412.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=463

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 163/181 (90%), Gaps = 2/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++H+NALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  285  KPIGSVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRNGHAPIFLW  344

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DE+FVRRWQ
Sbjct  345  YTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRDEDFVRRWQ  404

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G  NC C LH
Sbjct  405  LACEGNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EKQPPCIAADIGKENCACPLH  462

Query  201  K  199
            K
Sbjct  463  K  463



>emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera]
Length=473

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  293  KPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  352

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP D+EFVRRWQ
Sbjct  353  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPXDDEFVRRWQ  412

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FLD LI+ R+ W+     +PPC+A D+G  NC C LH
Sbjct  413  LACQGNIAHVVVMPNVTIEKLDYFLDXLIEKRNTWFLDKKVQPPCVAADIGSENCLCDLH  472

Query  201  K  199
            K
Sbjct  473  K  473



>ref|NP_175036.1| serine decarboxylase 1 [Arabidopsis thaliana]
 sp|Q9MA74.1|SDC1_ARATH RecName: Full=Serine decarboxylase; Short=AtSDC; AltName: Full=Protein 
EMBRYO DEFECTIVE 1075; AltName: Full=Serine decarboxylase 
1; Short=AtSDC1 [Arabidopsis thaliana]
 gb|AAF63121.1|AC009526_6 Putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK25943.1|AF360233_1 putative histidine decarboxylase [Arabidopsis thaliana]
 gb|AAK77493.1|AF389349_1 serine decarboxylase [Arabidopsis thaliana]
 gb|AAK64091.1| putative histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79456.1| histidine decarboxylase [Arabidopsis thaliana]
 dbj|BAB79457.1| histidine decarboxylase [Arabidopsis thaliana]
 gb|AEE31989.1| serine decarboxylase 1 [Arabidopsis thaliana]
Length=482

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI  LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  303  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLW  362

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  363  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  422

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD FL +L++ R +WYE G S+PPCLA +VG +NC C  H
Sbjct  423  LACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRLIWYEDG-SQPPCLASEVGTNNCICPAH  481

Query  201  K  199
            K
Sbjct  482  K  482



>gb|AFK28277.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   310 bits (793),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ RSVWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRSVWYKDGKRKPPCVASDIGQANCLCEL  239



>emb|CDY41717.1| BnaA09g15450D [Brassica napus]
Length=467

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  288  KPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  347

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL+RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  348  YTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  407

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCL +DVG+ NC C  H
Sbjct  408  LACQGDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEDG-SQPPCLVKDVGIKNCICPAH  466

Query  201  K  199
            K
Sbjct  467  K  467



>gb|KHG04394.1| Histidine decarboxylase [Gossypium arboreum]
Length=476

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 163/181 (90%), Gaps = 2/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++H+NALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  298  KPIGSVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRNGHAPIFLW  357

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DE+FVRRWQ
Sbjct  358  YTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRDEDFVRRWQ  417

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G  NC C LH
Sbjct  418  LACEGNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EQQPPCIAADIGKENCACPLH  475

Query  201  K  199
            K
Sbjct  476  K  476



>gb|KJB59411.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=475

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 163/181 (90%), Gaps = 2/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++H+NALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  297  KPIGSVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRNGHAPIFLW  356

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DE+FVRRWQ
Sbjct  357  YTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRDEDFVRRWQ  416

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G  NC C LH
Sbjct  417  LACEGNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EKQPPCIAADIGKENCACPLH  474

Query  201  K  199
            K
Sbjct  475  K  475



>gb|KJB59410.1| hypothetical protein B456_009G253400 [Gossypium raimondii]
Length=476

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 163/181 (90%), Gaps = 2/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++H+NALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  298  KPIGSVSVSGHKFVGCPMPCGVQITRMEHVNALSSNVEYLASRDATIMGSRNGHAPIFLW  357

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY GF KEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERP+DE+FVRRWQ
Sbjct  358  YTLNRKGYNGFAKEVQKCLRNAHYLKDQLRAAGIGAMLNELSSTVVFERPRDEDFVRRWQ  417

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPC+A D+G  NC C LH
Sbjct  418  LACEGNIAHVVVMPSVSIEKLDVFLNELVKNRSTWYQ--EKQPPCIAADIGKENCACPLH  475

Query  201  K  199
            K
Sbjct  476  K  476



>ref|XP_009107655.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=490

 Score =   318 bits (814),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  311  KPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  370

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+EEFVRRWQ
Sbjct  371  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKEEEFVRRWQ  430

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVTVEKLD FL +L++ R VWYE G SKPPCL +DVG++NC C  H
Sbjct  431  LACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-SKPPCLVKDVGINNCICPAH  489

Query  201  K  199
            K
Sbjct  490  K  490



>ref|XP_009113392.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=477

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  298  KPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  357

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL+RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  358  YTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  417

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCL +DVG+ NC C  H
Sbjct  418  LACQGDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEDG-SQPPCLVKDVGIKNCICPAH  476

Query  201  K  199
            K
Sbjct  477  K  477



>gb|AFK28270.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   309 bits (791),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28279.1| putative serine decarboxylase, partial [Helianthus petiolaris]
Length=239

 Score =   309 bits (791),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_010500117.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=481

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI  LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  302  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLW  361

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  362  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  421

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD F+ +L++ RSVWYE G ++PPCL  +VG +NC C  H
Sbjct  422  LACQGDIAHVVVMPSVTIEKLDNFVKDLVKHRSVWYEDG-TQPPCLVSEVGTNNCLCPAH  480

Query  201  K  199
            K
Sbjct  481  K  481



>gb|AFK28253.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28255.1| putative serine decarboxylase, partial [Helianthus argophyllus]
 gb|AFK28258.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28259.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28263.1| putative serine decarboxylase, partial [Helianthus annuus]
 gb|AFK28268.1| putative serine decarboxylase, partial [Helianthus deserticola]
 gb|AFK28274.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28275.1| putative serine decarboxylase, partial [Helianthus anomalus]
 gb|AFK28276.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28278.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28280.1| putative serine decarboxylase, partial [Helianthus petiolaris]
 gb|AFK28284.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28285.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28286.1| putative serine decarboxylase, partial [Helianthus bolanderi]
 gb|AFK28288.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28289.1| putative serine decarboxylase, partial [Helianthus exilis]
 gb|AFK28290.1| putative serine decarboxylase, partial [Helianthus neglectus]
Length=239

 Score =   308 bits (790),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_008441526.1| PREDICTED: histidine decarboxylase isoform X2 [Cucumis melo]
Length=481

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  300  KPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEF+RRWQ
Sbjct  360  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPRDEEFIRRWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE +++HVVVMPSV+ EKLD FL EL++ RS WY+  N +PPC+A ++G  +C C LH
Sbjct  420  LACEGSIAHVVVMPSVSQEKLDDFLAELVEKRSTWYDDENVQPPCVAAELGNESCACKLH  479

Query  201  K  199
            +
Sbjct  480  R  480



>ref|XP_010461415.1| PREDICTED: serine decarboxylase-like [Camelina sativa]
Length=485

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI  LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  306  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLW  365

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  366  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  425

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD F+ +L++ RSVWYE G ++PPCL  +VG +NC C  H
Sbjct  426  LACQGDIAHVVVMPSVTIEKLDNFVKDLVKHRSVWYEDG-TQPPCLVSEVGTNNCICPAH  484

Query  201  K  199
            K
Sbjct  485  K  485



>ref|XP_008441525.1| PREDICTED: histidine decarboxylase isoform X1 [Cucumis melo]
Length=486

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQLTRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  305  KPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERP+DEEF+RRWQ
Sbjct  365  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPRDEEFIRRWQ  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE +++HVVVMPSV+ EKLD FL EL++ RS WY+  N +PPC+A ++G  +C C LH
Sbjct  425  LACEGSIAHVVVMPSVSQEKLDDFLAELVEKRSTWYDDENVQPPCVAAELGNESCACKLH  484

Query  201  K  199
            +
Sbjct  485  R  485



>gb|AFK28256.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   308 bits (790),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_006648711.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=467

 Score =   316 bits (810),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 165/182 (91%), Gaps = 1/182 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  285  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSSNVEYLASRDATIMGSRNGHAPIFLW  344

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+LR AGI AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  345  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLREAGIGAMLNELSSTVVFERPKDEEFVRRWQ  404

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE-GGNSKPPCLAEDVGVSNCCCVL  205
            LACE +++HVVVMP+VT++KLD FL+EL + R+ WY+ GG  + PC+A DVG  +C C L
Sbjct  405  LACEGSIAHVVVMPNVTIDKLDYFLNELREKRATWYQDGGMCQAPCIARDVGQDSCLCSL  464

Query  204  HK  199
            HK
Sbjct  465  HK  466



>ref|XP_008781392.1| PREDICTED: serine decarboxylase 1 [Phoenix dactylifera]
Length=475

 Score =   316 bits (810),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HI  LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  294  KPIGSVSVSGHKFVGCPMPCGVQITRLEHIKVLSSNVEYLASRDATIMGSRNGHAPIFLW  353

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AG+SAMLNELSSTVVFERPKD EFVRRWQ
Sbjct  354  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKAAGVSAMLNELSSTVVFERPKDGEFVRRWQ  413

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMP+VTVEKLD FL+ELIQ RS  YE GN   PC+A D+G  NC C LH
Sbjct  414  LACEGNIAHVVVMPNVTVEKLDTFLNELIQNRSSCYEDGNIPFPCIAADIGDENCLCSLH  473

Query  201  K  199
            +
Sbjct  474  Q  474



>gb|AFK28281.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28282.1| putative serine decarboxylase, partial [Helianthus debilis]
 gb|AFK28283.1| putative serine decarboxylase, partial [Helianthus debilis]
Length=239

 Score =   308 bits (788),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRGVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28260.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   308 bits (788),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY  G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYRDGKRKPPCVASDIGRANCLCEL  239



>emb|CDX80723.1| BnaC08g05570D [Brassica napus]
Length=489

 Score =   317 bits (811),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  310  KPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  369

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+EEFVRRWQ
Sbjct  370  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKEEEFVRRWQ  429

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVTVEKLD FL +L++ R VWYE G S+PPCL +DVG++NC C  H
Sbjct  430  LACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-SQPPCLVKDVGINNCICPAH  488

Query  201  K  199
            K
Sbjct  489  K  489



>dbj|BAA78331.1| serine decarboxylase [Brassica napus]
Length=490

 Score =   317 bits (811),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  311  KPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  370

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+EEFVRRWQ
Sbjct  371  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKEEEFVRRWQ  430

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVTVEKLD FL +L++ R VWYE G S+PPCL +DVG++NC C  H
Sbjct  431  LACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-SQPPCLVKDVGINNCICPAH  489

Query  201  K  199
            K
Sbjct  490  K  490



>ref|XP_002893962.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70221.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  283  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  342

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  343  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLCEAGISAMLNELSSTVVFERPKDEEFVRRWQ  402

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE G S+PPCLA +VG +NC C  H
Sbjct  403  LACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRSVWYEDG-SQPPCLASEVGTNNCICPTH  461

Query  201  K  199
            K
Sbjct  462  K  462



>gb|AFK28257.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++E I+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNEFIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_006307198.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
 gb|EOA40096.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
Length=542

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  363  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  422

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKDKLR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  423  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  482

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD FL +L++ R VWYE G ++PPCLA +VG +NC C  H
Sbjct  483  LACQGDIAHVVVMPSVTIEKLDDFLKDLVKHRLVWYEDG-TQPPCLASEVGTNNCICPAH  541

Query  201  K  199
            K
Sbjct  542  K  542



>gb|AFW62562.1| hypothetical protein ZEAMMB73_033583 [Zea mays]
Length=406

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL++INALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  226  KPIGSVSVSGHKFVGCPMPCGVQITRLEYINALSSNVEYLASRDATIMGSRNGHAPIFLW  285

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDE FVRRWQ
Sbjct  286  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEVFVRRWQ  345

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N+ HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A  VG  NC C  H
Sbjct  346  LACEGNICHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARVVGFENCLCGRH  405

Query  201  K  199
            K
Sbjct  406  K  406



>ref|XP_010479021.1| PREDICTED: serine decarboxylase [Camelina sativa]
Length=490

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI  LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  311  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLW  370

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  371  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  430

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD FL +L++ R VWYE G ++PPCL  +VG +NC C  H
Sbjct  431  LACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRLVWYEDG-TQPPCLVSEVGTNNCICPAH  489

Query  201  K  199
            K
Sbjct  490  K  490



>gb|AFK28273.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI  R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIGKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28271.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRVVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28261.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HV VMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVAVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28262.1| putative serine decarboxylase, partial [Helianthus annuus]
Length=239

 Score =   307 bits (787),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRD TIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDTTIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28254.1| putative serine decarboxylase, partial [Helianthus argophyllus]
Length=239

 Score =   307 bits (786),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS N EYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNXEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>emb|CDY48944.1| BnaA08g04700D [Brassica napus]
Length=490

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  311  KPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  370

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPK+EEFVRRWQ
Sbjct  371  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPKEEEFVRRWQ  430

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVTVEKLD FL +L++ R VWYE G  KPPCL +DVG++NC C  H
Sbjct  431  LACQGDIAHVVVMPSVTVEKLDHFLKDLVEHRLVWYEDG-CKPPCLVKDVGINNCICPAH  489

Query  201  K  199
            K
Sbjct  490  K  490



>gb|AFK28287.1| putative serine decarboxylase, partial [Helianthus bolanderi]
Length=239

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVV+P++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVVPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28267.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   306 bits (784),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++K D F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKSDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>ref|XP_008678685.1| PREDICTED: histidine decarboxylase-like [Zea mays]
Length=489

 Score =   315 bits (806),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL++INALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  309  KPIGSVSVSGHKFVGCPMPCGVQITRLEYINALSSNVEYLASRDATIMGSRNGHAPIFLW  368

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD+L+ AGI AMLNELSSTVVFERPKDE FVRRWQ
Sbjct  369  YTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAMLNELSSTVVFERPKDEVFVRRWQ  428

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N+ HVVVMPSV ++KLD FL+EL++ R+ WY+ G S+PPC+A  VG  NC C  H
Sbjct  429  LACEGNICHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARVVGFENCLCGRH  488

Query  201  K  199
            K
Sbjct  489  K  489



>ref|XP_010530241.1| PREDICTED: serine decarboxylase [Tarenaya hassleriana]
Length=498

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI  LS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  319  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSRNVEYLASRDATIMGSRNGHAPLFLW  378

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL++KGYKGFQKEVQKCLRNAHYLKD+LRGAGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  379  YTLSQKGYKGFQKEVQKCLRNAHYLKDRLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  438

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSV++ KLD FL+EL++ RS+WY+   S+PPC+A DVG  NC C  H
Sbjct  439  LACQGNIAHVVVMPSVSIGKLDSFLNELVEQRSLWYK-DESQPPCVASDVGTENCICPTH  497

Query  201  K  199
            K
Sbjct  498  K  498



>gb|AFK28272.1| putative serine decarboxylase, partial [Helianthus anomalus]
Length=239

 Score =   305 bits (782),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQTTRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI A LNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGATLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNITHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>gb|AFK28291.1| putative serine decarboxylase, partial [Helianthus niveus]
Length=239

 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI A LNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGATLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T+++LD F++ELI+ R+VWY+ G  KPPC+A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDRLDDFVNELIEKRAVWYKDGKRKPPCVASDIGQANCLCEL  239



>emb|CDY59264.1| BnaC09g51700D [Brassica napus]
Length=470

 Score =   313 bits (803),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  290  KPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  349

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL+RKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  350  YTLSRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPRDEEFVRRWQ  409

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD FL +L++ RSVWYE   S+ PCL +DVG+ NC C  H
Sbjct  410  LACQGDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEEYGSQLPCLVKDVGIKNCICPAH  469

Query  201  K  199
            K
Sbjct  470  K  470



>gb|AFK28269.1| putative serine decarboxylase, partial [Helianthus deserticola]
Length=239

 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KPP +A D+G +NC C L
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKRKPPRVASDIGQANCLCEL  239



>ref|XP_009368241.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  300  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGY GFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  360  YTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSV +EKLD FL EL++ RS WY+    +PPC+A DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVNIEKLDDFLSELVEKRSTWYD-EKVQPPCIAADVGTENCSCGQH  478

Query  201  K  199
            K
Sbjct  479  K  479



>ref|XP_009343619.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  300  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGY GFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  360  YTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSV +EKLD FL EL++ RS WY+    +PPC+A DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVNIEKLDDFLSELVEKRSTWYD-EKVQPPCIAADVGTENCSCGQH  478

Query  201  K  199
            K
Sbjct  479  K  479



>ref|XP_009145064.1| PREDICTED: serine decarboxylase [Brassica rapa]
 emb|CDY40942.1| BnaAnng06510D [Brassica napus]
Length=472

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HI  LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  293  KPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSSNVEYLASRDATIMGSRNGHAPLFLW  352

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  353  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  412

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+  ++HVVVMPSVT+EKLD FL +L++ RS+W + G S+ PCLA+DVG +NC C  H
Sbjct  413  LACQGEIAHVVVMPSVTIEKLDHFLKDLVEHRSIWCKDG-SQTPCLAKDVGTNNCVCPAH  471

Query  201  K  199
            K
Sbjct  472  K  472



>gb|KFK24263.1| hypothetical protein AALP_AAs40498U000700 [Arabis alpina]
Length=489

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HI  LS+NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  310  KPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSNNVEYLASRDATIMGSRNGHAPLFLW  369

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+L  +GISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  370  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLCESGISAMLNELSSTVVFERPKDEEFVRRWQ  429

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT+EKLD FL +L+Q RSVWY  G S+PPCL  +VG  NC C  H
Sbjct  430  LACQGDIAHVVVMPSVTIEKLDSFLKDLVQHRSVWYADG-SQPPCLVSEVGTHNCICPAH  488

Query  201  K  199
            K
Sbjct  489  K  489



>gb|AFK39410.1| unknown [Medicago truncatula]
Length=320

 Score =   306 bits (785),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVE LASRDATIMGSRNGHAPIFLW
Sbjct  140  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVECLASRDATIMGSRNGHAPIFLW  199

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  200  YTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  259

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  H
Sbjct  260  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  319

Query  201  K  199
            K
Sbjct  320  K  320



>ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63380.1| serine decarboxylase [Medicago truncatula]
Length=486

 Score =   311 bits (798),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  306  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  365

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  366  YTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  425

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  H
Sbjct  426  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  485

Query  201  K  199
            K
Sbjct  486  K  486



>ref|XP_006854520.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
 gb|ERN15987.1| hypothetical protein AMTR_s00030p00012550 [Amborella trichopoda]
Length=488

 Score =   311 bits (797),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRLDHINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  308  KPIGSVSVSGHKFVGCPMPCGVQITRLDHINALSRNVEYLASRDATIMGSRNGHAPIFLW  367

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYLKD LR  GISAMLNELSSTVVFERP+DEEFVRRWQ
Sbjct  368  YTLNRKGYRGFQKEVQKCLRNAHYLKDCLRSEGISAMLNELSSTVVFERPQDEEFVRRWQ  427

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++H VVMP++T+EKLD F+ EL   RS W++ G ++ PC+A+++G  NC C  H
Sbjct  428  LACQGNIAHAVVMPNITIEKLDDFVKELTAKRSTWFKDGKAQAPCIADEIGAENCACARH  487



>emb|CDY30753.1| BnaC05g51500D [Brassica napus]
Length=472

 Score =   311 bits (796),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HI  LSSNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  293  KPIGSVSVSGHKFVGCPMPCGVQITRMKHIKVLSSNVEYLASRDATIMGSRNGHAPLFLW  352

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGYKGFQKEVQKCLRNAHYLKD+LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  353  YTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQ  412

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ +++HVVVMPSVT++KLD FL +L++ RS+W + G S+ PCLA+DVG +NC C  H
Sbjct  413  LACQGDIAHVVVMPSVTIKKLDHFLKDLVEHRSIWCKDG-SQTPCLAKDVGTNNCVCPAH  471

Query  201  K  199
            K
Sbjct  472  K  472



>ref|XP_008339120.1| PREDICTED: histidine decarboxylase-like [Malus domestica]
Length=479

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHK VGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  300  KPIGSVSVSGHKLVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGY GFQKEVQKCLRNAHYLK +LR A ISAMLNELSSTVVFERPKDEEFVR+WQ
Sbjct  360  YTLNKKGYTGFQKEVQKCLRNAHYLKGRLRDARISAMLNELSSTVVFERPKDEEFVRKWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSV++EKLD FL+EL++ RS WY+  N +PPCLA DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVSIEKLDNFLNELVEKRSTWYD-ENVQPPCLAADVGTENCSCRQH  478

Query  201  K  199
            K
Sbjct  479  K  479



>ref|XP_007227607.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
 gb|EMJ28806.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
Length=457

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  277  KPIGSVSVSGHKFVGCPMPCGVQITRLKHINCLSSNVEYLASRDATIMGSRNGHAPIFLW  336

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY GFQKEVQKCL+NAHYLKD+LR AGI AMLNELSSTVVFERP++EEFVR+WQ
Sbjct  337  YTLNRKGYGGFQKEVQKCLKNAHYLKDRLREAGIGAMLNELSSTVVFERPQEEEFVRKWQ  396

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HV+VMP++T+EKLD FL EL+Q R+ W++ G  + PC+A DVG  NC C  H
Sbjct  397  LACQGNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGTENCLCASH  456

Query  201  K  199
            K
Sbjct  457  K  457



>ref|XP_008381807.1| PREDICTED: histidine decarboxylase [Malus domestica]
Length=479

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  300  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGY GFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  360  YTLNKKGYSGFQKEVQKCLRNAHYLKGRLRDAGISAMLNELSSTVVFERPKDEEFVRRWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSV +EKLD FL+EL++ RS WY+    + PC+A DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVNIEKLDDFLNELVEKRSTWYD-EKVQAPCIAADVGTENCSCGQH  478

Query  201  K  199
            K
Sbjct  479  K  479



>ref|XP_009368490.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHK VGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  300  KPIGSVSVSGHKLVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPIFLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGY GFQKEVQKCLRNAHYLK  LR AGISAMLNELSSTVVFERPKDEEFVR+WQ
Sbjct  360  YTLNKKGYTGFQKEVQKCLRNAHYLKGHLRDAGISAMLNELSSTVVFERPKDEEFVRKWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMPSV++EKLD FL+EL++ RS WY+    +PPCLA DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVSIEKLDNFLNELVEKRSTWYD-EKVQPPCLAADVGTENCSCRQH  478

Query  201  K  199
            K
Sbjct  479  K  479



>ref|XP_004485538.1| PREDICTED: histidine decarboxylase-like isoform X1 [Cicer arietinum]
 ref|XP_004485539.1| PREDICTED: histidine decarboxylase-like isoform X2 [Cicer arietinum]
 ref|XP_004485540.1| PREDICTED: histidine decarboxylase-like isoform X3 [Cicer arietinum]
Length=485

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  305  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSQNVEYLASRDATIMGSRNGHAPIFLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+RRWQ
Sbjct  365  YTLNRKGYRGFQKEVQKCLRNAHYFKDRLVEAGIGAMLNELSSTVVFERPHDEEFIRRWQ  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT++KLD FL+EL + R+ W+E G  +P C+A DVG ++C C LH
Sbjct  425  LACKGNIAHVVVMPNVTIQKLDDFLNELKEKRAAWFEDGKYQPYCIASDVGENHCLCALH  484

Query  201  K  199
            K
Sbjct  485  K  485



>ref|XP_007148444.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
 gb|ESW20438.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
Length=483

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRLD++NALS +VEYLASRDATIMGSRNGHAPIFLW
Sbjct  303  KPIGSVSVSGHKFVGCPMPCGVQITRLDYVNALSRDVEYLASRDATIMGSRNGHAPIFLW  362

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+RRWQ
Sbjct  363  YTLNRKGYRGFQKEVQKCLRNAHYFKDRLVEAGIGAMLNELSSTVVFERPHDEEFIRRWQ  422

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP++T+EKLD FL+EL++ R+ W++ G  +P C++ DVG  NC C LH
Sbjct  423  LACKGNIAHVVVMPNITIEKLDDFLNELLEKRTTWFQDGKDQPYCISADVGEKNCLCALH  482

Query  201  K  199
            K
Sbjct  483  K  483



>ref|XP_008218831.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=457

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL HIN LSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  277  KPIGSVSVSGHKFVGCPMPCGVQITRLKHINCLSSNVEYLASRDATIMGSRNGHAPIFLW  336

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY GFQKEVQKCL NAHYLKD+LR AGI AMLNELSSTVVFERP++EEFVR+WQ
Sbjct  337  YTLNRKGYGGFQKEVQKCLENAHYLKDRLREAGIGAMLNELSSTVVFERPQEEEFVRKWQ  396

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HV+VMP++T+EKLD FL EL+Q R+ W++ G  + PC+A DVG  NC C  H
Sbjct  397  LACQGNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGTENCLCASH  456

Query  201  K  199
            K
Sbjct  457  K  457



>ref|XP_009420591.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score =   308 bits (789),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL HINAL+SNVEYLASRDATIMGSRNGHAP+FLW
Sbjct  292  KPIGSVSVSGHKFVGCPMPCGVQITRLKHINALASNVEYLASRDATIMGSRNGHAPLFLW  351

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GF+KEVQKCLRNAHYL+D+L  AG+ AMLN LSSTVVFERPKDE FVRRWQ
Sbjct  352  YTLNRKGYRGFRKEVQKCLRNAHYLRDRLMAAGVGAMLNPLSSTVVFERPKDEGFVRRWQ  411

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HVVVMPSVT+EKLD FLDEL+  RS WY   +   PC+A ++G  NC C +H
Sbjct  412  LACEGNIAHVVVMPSVTIEKLDDFLDELVAGRSAWYRDRSRPSPCIAAEIGQENCHCSMH  471

Query  201  K  199
            K
Sbjct  472  K  472



>ref|XP_010241734.1| PREDICTED: serine decarboxylase 1-like [Nelumbo nucifera]
Length=486

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 159/182 (87%), Gaps = 1/182 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS SVSGHKFVGCP PCGV++TRL+HINALS NVEYLASRDATIMGSRNGH PIFLW
Sbjct  305  KPIGSASVSGHKFVGCPMPCGVEITRLEHINALSRNVEYLASRDATIMGSRNGHTPIFLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGYKGFQKEVQKCL NA YLKD+LR AG+ AMLNE SSTVVFERP+DEEFVRRW 
Sbjct  365  YTLNQKGYKGFQKEVQKCLSNAFYLKDRLRAAGVGAMLNEFSSTVVFERPQDEEFVRRWH  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNS-KPPCLAEDVGVSNCCCVL  205
            LAC+ +++HVVVMP+VT+EKLD F+DEL+Q RS W+  G   +PPC+A DVG  NC C+L
Sbjct  425  LACQGDIAHVVVMPNVTIEKLDVFVDELMQKRSAWFRNGRILQPPCIAADVGNENCACIL  484

Query  204  HK  199
            HK
Sbjct  485  HK  486



>gb|ACJ85197.1| unknown [Medicago truncatula]
Length=486

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVE LASRDATIMGSRNGHAPIFLW
Sbjct  306  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVECLASRDATIMGSRNGHAPIFLW  365

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  366  YTLNRKGYRGFQKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  425

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  H
Sbjct  426  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  485

Query  201  K  199
            K
Sbjct  486  K  486



>ref|XP_006584565.1| PREDICTED: uncharacterized protein LOC100792053 isoform X6 [Glycine 
max]
Length=458

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  278  KPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLW  337

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQ
Sbjct  338  YSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQ  397

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG  NC C LH
Sbjct  398  LACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALH  457

Query  201  K  199
            +
Sbjct  458  R  458



>gb|KHN39188.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  305  KPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQ
Sbjct  365  YSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQ  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG  NC C LH
Sbjct  425  LACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALH  484

Query  201  K  199
            +
Sbjct  485  R  485



>ref|XP_006584560.1| PREDICTED: uncharacterized protein LOC100792053 isoform X1 [Glycine 
max]
 ref|XP_006584561.1| PREDICTED: uncharacterized protein LOC100792053 isoform X2 [Glycine 
max]
 ref|XP_006584562.1| PREDICTED: uncharacterized protein LOC100792053 isoform X3 [Glycine 
max]
Length=485

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  305  KPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQ
Sbjct  365  YSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQ  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG  NC C LH
Sbjct  425  LACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALH  484

Query  201  K  199
            +
Sbjct  485  R  485



>ref|XP_006584563.1| PREDICTED: uncharacterized protein LOC100792053 isoform X4 [Glycine 
max]
 ref|XP_006584564.1| PREDICTED: uncharacterized protein LOC100792053 isoform X5 [Glycine 
max]
Length=468

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  288  KPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLW  347

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQ
Sbjct  348  YSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQ  407

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+VW+  GN +P C+A DVG  NC C LH
Sbjct  408  LACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALH  467

Query  201  K  199
            +
Sbjct  468  R  468



>ref|NP_001241244.1| uncharacterized protein LOC100795577 [Glycine max]
 gb|ACU18100.1| unknown [Glycine max]
Length=483

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KP+GSVSVSGHKFVGCP PCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNGHAPIFLW
Sbjct  303  KPVGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIFLW  362

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  363  YTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  422

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP++T+EKLD FL+EL++ R+ W++ G  +P C++ DVG  NC C LH
Sbjct  423  LACKGNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGEKNCLCALH  482

Query  201  K  199
            K
Sbjct  483  K  483



>gb|KHN26720.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KP+GSVSVSGHKFVGCP PCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNGHAPIFLW
Sbjct  305  KPVGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIFLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  365  YTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP++T+EKLD FL+EL++ R+ W++ G  +P C++ DVG  NC C LH
Sbjct  425  LACKGNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGEKNCLCALH  484

Query  201  K  199
            K
Sbjct  485  K  485



>ref|XP_003547587.1| PREDICTED: histidine decarboxylase [Glycine max]
 gb|KHN33495.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNGHAPIFLW
Sbjct  305  KPIGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIFLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  365  YTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP++T+EKLD FL+EL+  R+ W++ G  +P C++ DVG  NC C LH
Sbjct  425  LACKGNIAHVVVMPNITIEKLDDFLNELLDKRATWFQDGKDQPYCISSDVGEKNCLCALH  484

Query  201  K  199
            K
Sbjct  485  K  485



>gb|AFA36595.1| putative serine decarboxylase, partial [Lolium perenne]
Length=245

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL HINALSSNVEYLASRDATIMGSRNGHAPIFLW
Sbjct  91   KPIGSVSVSGHKFVGCPMPCGVQVTRLKHINALSSNVEYLASRDATIMGSRNGHAPIFLW  150

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGY+GFQKEVQKCLRNAHYLKD+L  AGI AMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  151  YTLNQKGYRGFQKEVQKCLRNAHYLKDRLNAAGIGAMLNELSSTVVFERPKDEEFVRRWQ  210

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVW  277
            LACE N++HVVVMPSV ++KLD FL EL++ R+VW
Sbjct  211  LACEGNIAHVVVMPSVNIDKLDYFLRELVEKRAVW  245



>gb|AFK28252.1| putative serine decarboxylase, partial [Helianthus agrestis]
Length=223

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HINALS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  61   KPIGSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLW  120

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHYL+ +L  AGI AMLNELSSTVVFERP+DEEF R+WQ
Sbjct  121  YTLNRKGYRGFQKEVQKCLRNAHYLRGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQ  180

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKP  253
            LAC+ N++HVVVMP++T++KLD F++ELI+ R+VWY+ G  KP
Sbjct  181  LACQGNIAHVVVMPNITIDKLDDFVNELIEKRAVWYKDGKHKP  223



>ref|XP_001761266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73988.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKF+GCP PCGVQ TR+ HIN+LS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  240  KPIGSVSVSGHKFIGCPMPCGVQFTRMKHINSLSRNVEYLASRDATIMGSRNGHAPIFLW  299

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQK+VQ+CLRNAHYLK++LR A I  MLNELSSTVVFERP DE F+ +WQ
Sbjct  300  YTLNRKGYRGFQKDVQRCLRNAHYLKERLREAKIGVMLNELSSTVVFERPLDEAFILKWQ  359

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+  ++H VVMPSVTVEKLD F++ELI+ R   +  GN K PC+ E+VGV NC C LH
Sbjct  360  LACQGKIAHAVVMPSVTVEKLDNFVEELIEVRKRSFPEGNVKIPCIVEEVGVQNCACSLH  419

Query  201  K*CNNNP  181
            +     P
Sbjct  420  RGAGTIP  426



>ref|XP_001754291.1| predicted protein [Physcomitrella patens]
 gb|EDQ80741.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR+ HIN LS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  228  KPIGSVSVSGHKFVGCPMPCGVQITRMKHINVLSRNVEYLASRDATIMGSRNGHAPIFLW  287

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQ+CLRNA+YLK++LR A +  +LNELSSTVVFERP DE F+ +WQ
Sbjct  288  YTLNRKGYRGFQKEVQRCLRNAYYLKERLREANVGVLLNELSSTVVFERPLDEAFILKWQ  347

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+  ++H VVMPSVTVEKLD F++ELI+ R+  +  G+   PC+ E+VG  NC C +H
Sbjct  348  LACQGKIAHAVVMPSVTVEKLDDFVEELIEVRNRAFPDGDVVVPCIVEEVGPENCACSVH  407

Query  201  K  199
            +
Sbjct  408  R  408



>ref|XP_002976233.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
 gb|EFJ22493.1| hypothetical protein SELMODRAFT_175502 [Selaginella moellendorffii]
Length=472

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCG+Q+TR++HIN LS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  289  KPIGSVSVSGHKFVGCPMPCGIQITRIEHINTLSRNVEYLASRDATIMGSRNGHAPLFLW  348

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GF+KEV+KCL NAHYL   LR +G  AMLNELSSTVVFERP+DE FVR+WQ
Sbjct  349  YTLNRKGYRGFKKEVEKCLANAHYLAGCLRESGFGAMLNELSSTVVFERPQDEAFVRKWQ  408

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+  ++H VVMPSVTV+KL  FL ELI++RS  +  G    PC+AE++G  NC CV H
Sbjct  409  LACQGKIAHAVVMPSVTVDKLKVFLKELIESRSRLFPDGKIVAPCVAEELGAKNCACVKH  468

Query  201  K*CN  190
              C+
Sbjct  469  SSCS  472



>ref|XP_010676037.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKF+GCP PCGVQ+ R  HINALS N+EY+AS+DATI GSRNGH PIFLW
Sbjct  268  KPIGSVSVSGHKFLGCPMPCGVQIVRKKHINALSRNIEYIASKDATITGSRNGHTPIFLW  327

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LNRKGY G QK+VQ C+RNA YLK +L+  G+S MLN+LS+TVVFERP+DEEF+RRWQ
Sbjct  328  YALNRKGYHGLQKDVQMCMRNADYLKGRLKEFGVSVMLNKLSNTVVFERPQDEEFIRRWQ  387

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HV+VMP VT+EKLD FL+EL++ R  W++ G ++PPC+A ++G  NC C LH
Sbjct  388  LACEGNIAHVIVMPHVTIEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGKENCACPLH  447



>ref|XP_010675834.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKF+GCP PCGVQ+ R  HINALS N+EY+AS+DATI GSRNGH PIFLW
Sbjct  268  KPIGSVSVSGHKFLGCPMPCGVQIVRKKHINALSRNIEYIASKDATITGSRNGHTPIFLW  327

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LNRKGY G QK+VQ C+RNA YLK +L+  G+S MLN+LS+TVVFERP+DEEF+RRWQ
Sbjct  328  YALNRKGYHGLQKDVQMCMRNADYLKGRLKEFGVSVMLNKLSNTVVFERPQDEEFIRRWQ  387

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++HV+VMP VT+EKLD FL+EL++ R  W++ G ++PPC+A ++G  NC C LH
Sbjct  388  LACEGNIAHVIVMPHVTIEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGKENCACPLH  447



>ref|XP_002987141.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
 gb|EFJ11717.1| hypothetical protein SELMODRAFT_158539 [Selaginella moellendorffii]
Length=472

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCG+Q+TR++HIN LS NVEYLASRDATIMGSRNGHAP+FLW
Sbjct  289  KPIGSVSVSGHKFVGCPMPCGIQITRIEHINTLSRNVEYLASRDATIMGSRNGHAPLFLW  348

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GF+KEV+KCL NAHYL   LR +G  AMLNELSSTVVFERP+DE FVR+WQ
Sbjct  349  YTLNRKGYRGFKKEVEKCLANAHYLAGCLRESGFGAMLNELSSTVVFERPQDEAFVRKWQ  408

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+  ++H VVMPSVTV+KL  FL ELI++RS  +  G    PC+A+++G  NC CV H
Sbjct  409  LACQGKIAHAVVMPSVTVDKLKVFLKELIESRSRLFPDGKIVAPCVADELGAKNCACVKH  468

Query  201  K*CN  190
              C+
Sbjct  469  SSCS  472



>gb|EMT14427.1| Histidine decarboxylase [Aegilops tauschii]
Length=488

 Score =   278 bits (711),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKF+GCP PCGV +TRL+H+  LS+++EYL+SRDATIMGSRNGHAP+FLW
Sbjct  302  KPIGSVSVSGHKFMGCPVPCGVVITRLEHVKVLSTDIEYLSSRDATIMGSRNGHAPMFLW  361

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGY+G +KEVQKCLRNAH+L ++LR AG+SA LNELSSTVVFERP DE FV +WQ
Sbjct  362  YTLNKKGYRGIRKEVQKCLRNAHHLANRLREAGVSAYLNELSSTVVFERPHDEAFVHKWQ  421

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE +++HVVVMP+V+VEKL+ F++ELI  R  W+EGG  + PC+A+D+G  NC C +H
Sbjct  422  LACEGSIAHVVVMPNVSVEKLNNFVEELIGERPRWHEGGGFRVPCVAKDIGQENCLCGVH  481



>ref|XP_003566804.1| PREDICTED: serine decarboxylase 1-like [Brachypodium distachyon]
Length=484

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCGV +TRL H+  LS+++EYL+SRD TIMGSRNGHAPIFLW
Sbjct  295  KPIGSVSISGHKFMGCPVPCGVVITRLAHVKVLSTDIEYLSSRDTTIMGSRNGHAPIFLW  354

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGY+GF+KEV+KCLRNAHYL ++LR  G+SA LN LSSTVVFERP+D  FV +WQ
Sbjct  355  YTLNKKGYRGFRKEVRKCLRNAHYLANRLREEGVSASLNMLSSTVVFERPRDVAFVHKWQ  414

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE +++HVVVMP+V+VEKLD F++EL+  RS WY+G     PC+A+D+G  NC C LH
Sbjct  415  LACEGSIAHVVVMPNVSVEKLDGFVEELVANRSCWYDGKGHDIPCVAKDIGQDNCLCSLH  474

Query  201  K*CNNNPE  178
               + N E
Sbjct  475  NTKHKNVE  482



>ref|XP_006365167.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  284  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  343

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  344  YSLSAKGQIGLQKDVERCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  403

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELMQQRKVWYQNGKTNPPCVGEDIGAQNCACSYH  463

Query  201  K  199
            K
Sbjct  464  K  464



>ref|NP_001233845.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
 gb|ABE77149.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
Length=471

 Score =   265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  285  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  344

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  345  YSLSAKGQVGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  404

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTDPPCVGEDIGAQNCACSYH  464

Query  201  K  199
            K
Sbjct  465  K  465



>gb|KEH26769.1| serine decarboxylase [Medicago truncatula]
Length=192

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 143/181 (79%), Gaps = 13/181 (7%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCG+  T L            L  R  +IMGSRNGHAPIFLW
Sbjct  25   KPIGSVSVSGHKFVGCPMPCGMWNTLL------------LGMR-LSIMGSRNGHAPIFLW  71

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  72   YTLNRKGYRGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  131

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  H
Sbjct  132  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  191

Query  201  K  199
            K
Sbjct  192  K  192



>ref|XP_004245280.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum lycopersicum]
Length=476

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  285  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  344

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+  GIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  345  YSLSAKGQLGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFVRRWQ  404

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDIGAQNCACSYH  464

Query  201  K  199
            K
Sbjct  465  K  465



>ref|XP_010325179.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum lycopersicum]
Length=469

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  278  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  337

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+  GIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  338  YSLSAKGQLGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFVRRWQ  397

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  H
Sbjct  398  LSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDIGAQNCACSYH  457

Query  201  K  199
            K
Sbjct  458  K  458



>ref|XP_009789723.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=465

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCG+Q+TR  +IN LS  VEY+AS DATI GSRNG APIFLW
Sbjct  279  KPIGSVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLW  338

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  339  YSLSAKGQVGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  398

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HV+VMP +T E LD F+++L+Q R  WY+ GN  PPC+AED+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCACSYH  458

Query  201  K  199
            K
Sbjct  459  K  459



>gb|AES76141.2| serine decarboxylase [Medicago truncatula]
Length=261

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 143/181 (79%), Gaps = 13/181 (7%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCG+  T L            L  R  +IMGSRNGHAPIFLW
Sbjct  94   KPIGSVSVSGHKFVGCPMPCGMWNTLL------------LGMR-LSIMGSRNGHAPIFLW  140

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  141  YTLNRKGYRGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  200

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  H
Sbjct  201  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  260

Query  201  K  199
            K
Sbjct  261  K  261



>ref|XP_009769413.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769414.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=465

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCG+Q+TR  +IN LS  VEY+AS DATI GSRNG APIFLW
Sbjct  279  KPIGSVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLW  338

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AG+S MLNELS  VV ERP+D EFVRRWQ
Sbjct  339  YSLSSKGQIGLQKDVKRCLDNAKYLKDRLQQAGVSVMLNELSIIVVLERPRDHEFVRRWQ  398

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HV+VMP +T E LD F+++L+Q R  WY+ GN  PPC+AED+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCACSYH  458

Query  201  K  199
            K
Sbjct  459  K  459



>ref|XP_004245427.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG   IFLW
Sbjct  285  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTLIFLW  344

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  345  YSLSAKGQVGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  404

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R VWY+ G + PPC+ ED+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTNPPCVGEDIGAQNCACSYH  464

Query  201  K  199
            K
Sbjct  465  K  465



>ref|XP_009599698.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCG+Q+TR  +IN LS  VEY+AS DATI GSRNG APIFLW
Sbjct  274  KPIGSVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLW  333

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  334  YSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  393

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HV+VMP +T + LD F+++L+Q R  WY+ GN  PPC+A+D+G  NC C  H
Sbjct  394  LSCVRDMAHVIVMPGITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCACSYH  453

Query  201  K  199
            K
Sbjct  454  K  454



>ref|XP_009620691.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCG+Q+TR  +IN LS  VEY+AS DATI GSRNG APIFLW
Sbjct  274  KPIGSVTISGHKFLGCPMPCGIQITRKSYINNLSRKVEYIASVDATISGSRNGLAPIFLW  333

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  334  YSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  393

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HV+VMP +T + LD F+++L+Q R  WY+ GN  PPC+A+D+G  NC C  H
Sbjct  394  LSCVRDMAHVIVMPGITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCACSYH  453

Query  201  K  199
            K
Sbjct  454  K  454



>ref|XP_006365162.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
Length=470

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  284  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  343

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V+KCL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  344  YSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  403

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  463

Query  201  K  199
            K
Sbjct  464  K  464



>ref|XP_006365164.1| PREDICTED: histidine decarboxylase-like isoform X3 [Solanum tuberosum]
Length=470

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  284  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  343

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V+KCL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  344  YSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  403

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  463

Query  201  K  199
            K
Sbjct  464  K  464



>ref|XP_006365163.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=470

 Score =   259 bits (662),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  284  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  343

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V+KCL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  344  YSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  403

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  463

Query  201  K  199
            K
Sbjct  464  K  464



>ref|XP_004245281.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=455

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  274  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  333

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD L+ AGIS MLNE+S  VV ERP D EFVRRWQ
Sbjct  334  YSLSTKGQIGLQKDVKRCLDNAKYLKDGLQQAGISVMLNEISIIVVLERPHDHEFVRRWQ  393

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HVVVMP +T E LD F+ EL+Q R  WY+GG ++ PC+A+D+G  NC C  H
Sbjct  394  LSCVKDMAHVVVMPGITREMLDNFISELVQQRKHWYQGGKAEAPCVADDIGTQNCACSYH  453

Query  201  K  199
            K
Sbjct  454  K  454



>ref|XP_006365166.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=469

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  284  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  343

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V+KCL NA YLKD+L  AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  344  YSLSAKGQIGLQKDVKKCLDNAKYLKDRLLQAGISVMLNELSIIVVLERPRDHEFVRRWQ  403

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+A+D+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDIGAQNCACSYH  463

Query  201  K  199
            K
Sbjct  464  K  464



>ref|XP_006365165.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=482

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  297  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  356

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V+KCL NA YLKD+L+  GIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  357  YSLSAKGQIGLQKDVKKCLDNAKYLKDRLQQEGISVMLNELSIIVVLERPRDHEFVRRWQ  416

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+A+D+G  NC C  H
Sbjct  417  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDIGAQNCACSYH  476

Query  201  K  199
            K
Sbjct  477  K  477



>ref|XP_006365087.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=467

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  281  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  340

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  341  YSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  400

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  H
Sbjct  401  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  460

Query  201  K  199
            K
Sbjct  461  K  461



>ref|XP_004244519.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=465

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  PIFLW
Sbjct  279  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLW  338

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  GFQK+V++C  NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  339  YSLSAKGQIGFQKDVKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  398

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HV+VMP +T E LD F+++L+Q R  WY+ G   PPC+A D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITRETLDGFINDLLQQRKKWYQDGRISPPCVASDIGAQNCTCSYH  458

Query  201  K  199
            K
Sbjct  459  K  459



>ref|XP_006357084.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  PIFLW
Sbjct  279  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLW  338

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  GFQK+V++C  NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  339  YSLSAKGQIGFQKDVKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  398

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HV+VMP +T E LD F+ +L+Q R  WY+ G   PPC+A D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITRETLDGFITDLLQQRKKWYQDGRISPPCVASDIGAQNCTCSYH  458

Query  201  K  199
            K
Sbjct  459  K  459



>ref|XP_009600675.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=456

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS NVEY+AS DATI GSRNG  PIFLW
Sbjct  270  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRNVEYIASVDATISGSRNGLTPIFLW  329

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  330  YSLSAKGQIGLQKDVKRCLDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  389

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+++L+Q R +WY+ G    PC+A+D+G  NC C  H
Sbjct  390  LSCMKDMAHVIVMPGITRETLDNFVNDLVQQRKLWYQHGRVTTPCIADDIGAQNCSCSYH  449

Query  201  K  199
            K
Sbjct  450  K  450



>ref|NP_001233859.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
 gb|ABE77151.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
Length=465

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  PIFLW
Sbjct  279  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLW  338

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+++ KG  GFQK+V++C  NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  339  YSISAKGQIGFQKDVKRCFDNAKYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  398

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HV+VMP +T E LD F+++L+Q R  WY+ G   PPC+A D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITRETLDGFINDLLQQRKKWYQDGRISPPCVANDIGAQNCACSYH  458

Query  201  K  199
            K
Sbjct  459  K  459



>ref|XP_006365168.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  284  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  343

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+  GIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  344  YSLSAKGQIGLQKDVKRCLDNAKYLKDRLQKEGISVMLNELSIIVVLERPRDHEFVRRWQ  403

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R  WY+ G ++ PC+ ED+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  463

Query  201  K  199
            K
Sbjct  464  K  464



>ref|NP_001233852.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
 gb|ABE77150.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
Length=471

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  285  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  344

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLK++L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  345  YSLSAKGQVGLQKDVKRCLDNAKYLKNRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  404

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R  WY  G ++ PC+ ED+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCACSYH  464

Query  201  K  199
            K
Sbjct  465  K  465



>ref|XP_011081981.1| PREDICTED: histidine decarboxylase-like isoform X1 [Sesamum indicum]
Length=465

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 145/180 (81%), Gaps = 2/180 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCGV +TR  +I+ +S N+EY+AS D TI GSRNGH+P+F+W
Sbjct  282  KPIGSVSISGHKFLGCPMPCGVLITRRRYIDLISRNIEYIASFDTTIAGSRNGHSPVFMW  341

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LN KG++G +++VQKCLRNA YL+ +L+ AGIS+MLNE+S TVVFERP D EFVR WQ
Sbjct  342  YVLNLKGWRGLEQDVQKCLRNARYLRHRLKKAGISSMLNEMSITVVFERPPDNEFVRHWQ  401

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L C  NM+HVVVMP VTVE L+ FL +LI+ R+ WY  G  +PPCLAED+G+ NC C +H
Sbjct  402  LQCLENMAHVVVMPHVTVEMLERFLSDLIRKRNTWY--GKVQPPCLAEDIGICNCACPVH  459



>ref|XP_011081982.1| PREDICTED: histidine decarboxylase-like isoform X2 [Sesamum indicum]
Length=463

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 145/180 (81%), Gaps = 2/180 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCGV +TR  +I+ +S N+EY+AS D TI GSRNGH+P+F+W
Sbjct  280  KPIGSVSISGHKFLGCPMPCGVLITRRRYIDLISRNIEYIASFDTTIAGSRNGHSPVFMW  339

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LN KG++G +++VQKCLRNA YL+ +L+ AGIS+MLNE+S TVVFERP D EFVR WQ
Sbjct  340  YVLNLKGWRGLEQDVQKCLRNARYLRHRLKKAGISSMLNEMSITVVFERPPDNEFVRHWQ  399

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L C  NM+HVVVMP VTVE L+ FL +LI+ R+ WY  G  +PPCLAED+G+ NC C +H
Sbjct  400  LQCLENMAHVVVMPHVTVEMLERFLSDLIRKRNTWY--GKVQPPCLAEDIGICNCACPVH  457



>ref|XP_004245279.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS+NVEY+AS DATI GSRNG  PIFLW
Sbjct  285  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSTNVEYIASVDATISGSRNGLTPIFLW  344

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLK++L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  345  YSLSAKGQVGLQKDVKRCLDNAKYLKNRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  404

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++M+HV+VMP +T E LD F+ EL+Q R  WY  G ++ PC+ ED+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCACSYH  464

Query  201  K  199
            K
Sbjct  465  K  465



>ref|XP_006357083.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS  VEY+AS DATI GSRNG  PIFLW
Sbjct  279  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRRVEYIASVDATISGSRNGLTPIFLW  338

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  GFQK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  339  YSLSAKGQIGFQKDVKRCLDNAIYLKDRLQKAGISVMLNELSIIVVLERPRDHEFVRRWQ  398

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HV+VMP +T E LD F+ +L+Q R  WY+ G    PC+A D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITRETLDGFITDLLQQRKKWYQDGRISAPCVASDIGAQNCACSYH  458

Query  201  K  199
            K
Sbjct  459  K  459



>gb|KHN16991.1| Histidine decarboxylase [Glycine soja]
Length=413

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+++SGHKF+GCP PCGV +TRL++IN L+ NVEY+ASRD TI GSR+GHAPIFLW
Sbjct  232  KPIGSITISGHKFLGCPFPCGVLITRLEYINTLAKNVEYIASRDVTITGSRSGHAPIFLW  291

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L  +G  G Q EVQKC+ +A YL+ +LR A I AMLNE S+TVVFERP+D++F R+W 
Sbjct  292  YALKERGSVGLQNEVQKCIISARYLQHRLREAKIGAMLNEFSNTVVFERPQDDDFARKWS  351

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE-GGNSKPPCLAEDVGVSNCCCVL  205
            LAC++N++H VVM  VTVE LD F++E IQ R +W++  G   P CLA D+GV NC C+L
Sbjct  352  LACKKNIAHGVVMQHVTVEMLDSFVNEFIQERQIWFQDDGKRNPLCLANDIGVGNCACIL  411

Query  204  HK  199
            H+
Sbjct  412  HE  413



>ref|XP_004244809.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=457

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  HI  LS NVEY+AS DATI GSRNG  PI LW
Sbjct  271  KPIGSVTISGHKFIGCPIPCGVQITRKSHIGYLSRNVEYIASMDATISGSRNGLTPILLW  330

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G Q++V++CL NA YL+D+L+ A IS MLNELS+ VV ERP D EF R WQ
Sbjct  331  YSLSSKGQIGIQQDVKRCLNNARYLRDRLKQANISVMLNELSTIVVLERPHDHEFTRHWQ  390

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C ++++HV+VMPS+T E LD F  +L+Q R +WY+ G+ KPPC+A+D+G  NC C LH
Sbjct  391  LSCVKDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCACALH  450



>gb|EMS49846.1| Histidine decarboxylase [Triticum urartu]
Length=341

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKF+GCP PCGV +TRL+H+  LS+++EYL+SRDATIMGSRNGHAP++LW
Sbjct  174  KPIGSVSVSGHKFMGCPVPCGVVITRLEHVKVLSTDIEYLSSRDATIMGSRNGHAPMYLW  233

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGYKG +KEVQKCLRNAH+L ++L+  G+SA LNELSSTVVFERP+DE FV +WQ
Sbjct  234  YTLNKKGYKGIRKEVQKCLRNAHHLANRLKEMGVSASLNELSSTVVFERPQDETFVHKWQ  293

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAED  235
            LACE +++HVVVMP++ VEKLD F++EL+ AR  W+E       C+A++
Sbjct  294  LACESSIAHVVVMPNIDVEKLDDFVEELV-ARRAWHERKVFDILCVAKE  341



>ref|XP_006346847.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=498

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 146/200 (73%), Gaps = 0/200 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  HI  LS NVEY+AS DATI GSRNG  PI LW
Sbjct  271  KPIGSVTISGHKFLGCPIPCGVQITRKSHIAYLSRNVEYIASMDATISGSRNGLTPILLW  330

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ A IS MLNELS+ VV ERP D EF R WQ
Sbjct  331  YSLSSKGQIGIQKDVKRCLNNARYLKDRLQQANISVMLNELSTIVVLERPHDHEFTRHWQ  390

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+++HV+VMPS+T E LD F  +L+Q R +WY+ G+ KPPC+A+D+G  NC C  H
Sbjct  391  LSCVRHIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCSCAFH  450

Query  201  K*CNNNPEGRSFILGLCLPV  142
               ++     + ++ +  P 
Sbjct  451  NDSDSEMANDNVMVDVAAPT  470



>ref|XP_003535578.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=423

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 142/182 (78%), Gaps = 1/182 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+++SGHKF+GCP PCGV +TRL++IN L+ NVEY+ASRD TI GSR GHAPIFLW
Sbjct  242  KPIGSITISGHKFLGCPFPCGVLITRLEYINTLAKNVEYIASRDVTITGSRRGHAPIFLW  301

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L  +G  G Q EVQKC+ +A YL+ +LR A I AMLNE S+TVVFERP+D++F R+W 
Sbjct  302  YALKERGSVGLQNEVQKCIISARYLQHRLREAKIGAMLNEFSNTVVFERPQDDDFARKWS  361

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE-GGNSKPPCLAEDVGVSNCCCVL  205
            LAC++N++H VVM  VTVE LD F++E IQ R +W++  G   P CLA D+GV NC C+L
Sbjct  362  LACKKNIAHGVVMQHVTVEMLDSFVNEFIQERQIWFQDDGKRNPLCLANDIGVGNCACIL  421

Query  204  HK  199
            H+
Sbjct  422  HE  423



>ref|XP_003535572.1| PREDICTED: histidine decarboxylase-like [Glycine max]
Length=462

 Score =   251 bits (642),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCG+ +TRL +INALS +VEY+ SRD TI GSR GHAPIFLW
Sbjct  277  KPIGSVAISGHKFLGCPIPCGIVITRLRYINALSRDVEYIGSRDVTITGSRCGHAPIFLW  336

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y + RKG  G Q EV+KC+ NAHYL+ +LR AGI AMLN  SSTVVF+RP DEEF RRW 
Sbjct  337  YAIKRKGLIGLQNEVRKCIMNAHYLQSRLRNAGIGAMLNRFSSTVVFKRPLDEEFTRRWN  396

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVM  VT+E LD F+ E +Q RS+W+E    +  C+A+D+G  NC C +H
Sbjct  397  LACKGNIAHVVVMQHVTIEMLDSFVAEFLQKRSIWFEDEQFQHVCIAKDIGSGNCGCSMH  456



>ref|XP_003619923.1| L-tyrosine decarboxylase [Medicago truncatula]
Length=384

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 139/181 (77%), Gaps = 19/181 (10%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+HIN LS NVEYLASRDATI             
Sbjct  223  KPIGSVSVSGHKFVGCPMPCGVQITRLEHINGLSRNVEYLASRDATI-------------  269

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
                   + GFQKEVQKCLRNA+Y KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  270  ------DHGGFQKEVQKCLRNAYYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  323

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C C  H
Sbjct  324  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  383

Query  201  K  199
            K
Sbjct  384  K  384



>ref|XP_006366216.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=418

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKF+GCP PCG+Q+ R  H++ LS N+EY+AS DATI GSR GHAPIFLW
Sbjct  236  KPIGSVSVSGHKFLGCPMPCGIQIARKKHVDILSRNIEYIASIDATISGSRGGHAPIFLW  295

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L++K +   Q + ++C++NA YLKD LR +GISAMLNE S TVVFERP ++EF+ +WQ
Sbjct  296  YSLSKKCHTTLQDDAKRCIQNARYLKDSLRNSGISAMLNEHSITVVFERPLEQEFIHKWQ  355

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNS-KPPCLAEDVGVSNCCCVL  205
            L+CER+M+HVVVMP VT + LD F+ E  + R +WY+ GN  +PPCLA D+G+ NC C  
Sbjct  356  LSCERDMTHVVVMPGVTTQMLDNFVSEFAKKRLIWYQDGNKVQPPCLANDIGMHNCVCPH  415

Query  204  HK  199
            HK
Sbjct  416  HK  417



>ref|XP_006367691.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=457

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  HI  LS NVEY+AS DATI GSRNG  PI LW
Sbjct  271  KPIGSVTISGHKFLGCPIPCGVQITRKSHIAYLSRNVEYIASMDATISGSRNGLTPILLW  330

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ K   G Q++V++CL NA YLKD+L+ A IS MLNELS+ VV ERP D EF R WQ
Sbjct  331  YSLSSKNQIGIQQDVKRCLYNARYLKDRLQQANISVMLNELSTIVVLERPLDHEFTRHWQ  390

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+++HV+VMPS+T E LD F  +L+Q R +WY+ G+ KPPC+A+D+G  NC C LH
Sbjct  391  LSCVRDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCACALH  450



>ref|XP_011082255.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=461

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 144/180 (80%), Gaps = 2/180 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCGV LTR  +I  +S N+EY+A+ D+TI GSRNGH+PIF+W
Sbjct  278  KPIGSVSISGHKFLGCPMPCGVLLTRRKYIKLISRNIEYIATCDSTIAGSRNGHSPIFMW  337

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LN KG+KG +++V+KCL+NA YL+  L+ AGIS+MLNE S TVVFERP+D EF+R WQ
Sbjct  338  YVLNIKGWKGLKQDVEKCLKNARYLRHHLKKAGISSMLNETSVTVVFERPQDSEFIRHWQ  397

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L C  +M+HVVVMP VT+E LD FL +LI+ R++W+  G   PPCLAED+G+ NC C +H
Sbjct  398  LQCLGSMAHVVVMPHVTIEMLDRFLYDLIRKRNIWH--GTLHPPCLAEDMGICNCACPVH  455



>gb|ACU18860.1| unknown [Glycine max]
Length=152

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+++NAL+ +VEYLASRDATIMGSRNGHAPIFLW
Sbjct  15   KPIGSVSVSGHKFVGCPMPCGVQITRLEYVNALARDVEYLASRDATIMGSRNGHAPIFLW  74

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLNRKGY+GFQKEVQKCLRNAHY K +L  AGI AMLNELSSTVVFERP DEEF+R+WQ
Sbjct  75   YTLNRKGYRGFQKEVQKCLRNAHYFKGRLVEAGIGAMLNELSSTVVFERPHDEEFIRKWQ  134

Query  381  LACERNMSHV  352
            LAC+ N++HV
Sbjct  135  LACKGNIAHV  144



>gb|AES89541.2| serine decarboxylase [Medicago truncatula]
Length=228

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR+GHAPIFLW
Sbjct  43   KPIDSVTISGHKFLGCPFPCGVLITRLKYINALSRDVEYIASRDATITGSRSGHAPIFLW  102

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP D+ F RRW 
Sbjct  103  YALKKRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPFDDHFTRRWN  162

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LA   N++HVVV+  +T+E LD F+ E IQ RS+W + G  + PC+A DVG  NC C +H
Sbjct  163  LASNGNIAHVVVLKHITIEMLDTFVCEFIQKRSIWSKDGQFQLPCIASDVGSRNCACSIH  222



>ref|XP_003607344.1| Serine decarboxylase [Medicago truncatula]
Length=207

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR+GHAPIFLW
Sbjct  22   KPIDSVTISGHKFLGCPFPCGVLITRLKYINALSRDVEYIASRDATITGSRSGHAPIFLW  81

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP D+ F RRW 
Sbjct  82   YALKKRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPFDDHFTRRWN  141

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LA   N++HVVV+  +T+E LD F+ E IQ RS+W + G  + PC+A DVG  NC C +H
Sbjct  142  LASNGNIAHVVVLKHITIEMLDTFVCEFIQKRSIWSKDGQFQLPCIASDVGSRNCACSIH  201



>gb|EAY77466.1| hypothetical protein OsI_32510 [Oryza sativa Indica Group]
Length=467

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+SVSGHKF+GCP PCGV +TRL+H   LS+++EY+ASRD+TI GSRNGHAPIFLW
Sbjct  279  KPIGSISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPIFLW  338

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL++KGYKG  KEV  C+ NA YL+  L+  GISA  N LS+ VVFERPKDE  V RWQ
Sbjct  339  YTLSKKGYKGLLKEVHICMGNARYLEVLLKQVGISASCNTLSNIVVFERPKDERIVCRWQ  398

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++H+VVMP+VT EKL  F++EL + R+ WY+      PCLA D+G  NC C LH
Sbjct  399  LACEGNLAHIVVMPNVTFEKLTVFVEELAEKRNDWYQDKGFDIPCLAVDIGKENCYCNLH  458



>sp|Q8RV06.1|SDC2_ORYSJ RecName: Full=Serine decarboxylase 2 [Oryza sativa Japonica Group]
 gb|AAG12476.2|AC037197_1 Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAL75763.1| Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAP51789.1| Histidine decarboxylase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ15061.1| hypothetical protein OsJ_30471 [Oryza sativa Japonica Group]
Length=467

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+SVSGHKF+GCP PCGV +TRL+H   LS+++EY+ASRD+TI GSRNGHAPIFLW
Sbjct  279  KPIGSISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPIFLW  338

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL++KGYKG  KEV  C+ NA YL+  L+  GISA  N LS+ VVFERPKDE  V RWQ
Sbjct  339  YTLSKKGYKGLLKEVHICMGNARYLEVLLKQVGISASCNTLSNIVVFERPKDERIVCRWQ  398

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++H+VVMP+VT EKL  F++EL + R  WY+      PCLA D+G  NC C LH
Sbjct  399  LACEGNLAHIVVMPNVTFEKLTVFVEELAEKRKDWYQDKGFDIPCLAVDIGKENCYCNLH  458



>ref|XP_003607341.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES89538.1| serine decarboxylase [Medicago truncatula]
Length=452

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI SV++SGHKF+GCP PCGV +TRL +INALS +VEY+ASRDATI GSR+GHAPI LW
Sbjct  267  KPIDSVTISGHKFLGCPSPCGVLITRLKYINALSRDVEYIASRDATITGSRSGHAPILLW  326

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L ++G  G + EV +C+ NA YL ++LR AGI AMLNE S+ VVFERP D+ F RRW 
Sbjct  327  YALKKRGLIGLENEVHECITNARYLLNQLRDAGIGAMLNEFSNIVVFERPFDDHFTRRWN  386

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LA   N++HVVV+  +T+E LD F+ E IQ RS+W + G+ +PPC+A DVG  NC C +H
Sbjct  387  LASNENIAHVVVLKHITIEMLDTFVHEFIQKRSIWSKDGHFQPPCIASDVGSKNCACSIH  446



>ref|XP_003592126.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES62377.1| serine decarboxylase [Medicago truncatula]
Length=453

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+++SGHKF+GCP PCGV LTRL+HIN L  +VE + SRD TI GSR+GHAPIFLW
Sbjct  273  KPIGSITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRSGHAPIFLW  332

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L ++G  G Q EV KC+ NA YL+ KLR AGI  MLNE S+TVVFE+P D EF+R+W 
Sbjct  333  YALQKRGIIGLQNEVHKCMMNARYLQRKLRDAGIGTMLNEFSNTVVFEKPLDIEFIRKWS  392

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LA + N++HVVVM  VT+E LD F+DE  + R++W++ G  KP CLA+++G  NC C LH
Sbjct  393  LAYQGNIAHVVVMQHVTIEMLDSFVDEFTKKRAIWFQYGLRKPICLADEIGAENCICSLH  452



>ref|XP_006661594.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=461

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 137/180 (76%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            K IGS+SVSGHKF+GCP PCGV +TRL+H   LS++VEY+ASRD+TI GSRNGHAPIFLW
Sbjct  273  KTIGSISVSGHKFMGCPMPCGVVITRLEHAKVLSTDVEYIASRDSTITGSRNGHAPIFLW  332

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTLN+KGYKG  KEVQ CL NA YL+  L+  GISA     S+ VVFERPKDE+FV RWQ
Sbjct  333  YTLNKKGYKGILKEVQMCLGNARYLEVLLKQVGISASCATTSNIVVFERPKDEKFVCRWQ  392

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE N++H+VVMP+VT EK+  F++E  + R  WY+      PCLA D+G  NC C LH
Sbjct  393  LACEGNLAHIVVMPNVTFEKIIVFVEEFAKKRRDWYQDKGFNIPCLAVDIGKENCYCNLH  452



>gb|AHG12639.1| histidine decarboxylase [Nicotiana tabacum]
Length=446

 Score =   240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCG+Q+TR  +I+ LS+ +EY+AS DATI GSRNG APIFLW
Sbjct  263  KPIGSVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFLW  322

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L  KG  G Q++ + C  NA YLK +L  AGISAMLNE S  VVFERP D +F+R WQ
Sbjct  323  YSLCMKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHWQ  382

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HVVVMP +T E +D F ++L+Q R  WY+ G + PPCLA+D+G  NC C   
Sbjct  383  LSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQ  442

Query  201  K  199
            K
Sbjct  443  K  443



>ref|XP_009779195.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCG+Q+TR  +I+ LS+ +EY+AS DATI GSRNG APIFLW
Sbjct  263  KPIGSVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFLW  322

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L  KG  G Q++ + C  NA YLK +L  AGISAMLNE S  VVFERP D +F+R WQ
Sbjct  323  YSLCMKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHWQ  382

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HVVVMP +T E +D F ++L+Q R  WY+ G + PPCLA+D+G  NC C   
Sbjct  383  LSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQ  442

Query  201  K  199
            K
Sbjct  443  K  443



>gb|KCW44086.1| hypothetical protein EUGRSUZ_L02502 [Eucalyptus grandis]
Length=239

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  603  IMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVV  424
            I   RNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK +LR AGISAMLNELSSTVV
Sbjct  105  IEAVRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKGRLREAGISAMLNELSSTVV  164

Query  423  FERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCL  244
            FERP +EEFVRRWQLACE N++HVVVMPSV++EKLD F++ELI+ RS WY  G  +PPCL
Sbjct  165  FERPSEEEFVRRWQLACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCL  224

Query  243  AEDVGVSNCCCVLHK  199
            A D+G  NCCC LHK
Sbjct  225  AVDIGAENCCCALHK  239



>gb|EYU29207.1| hypothetical protein MIMGU_mgv1a026642mg, partial [Erythranthe 
guttata]
Length=377

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 134/180 (74%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVS HK +G   PCGV ++R  H+   S+N+EY+A++D TI GSRNGH PIF+W
Sbjct  196  KPIGSVSVSAHKLLGSSIPCGVFISRKMHMTDFSTNIEYIATQDTTISGSRNGHTPIFIW  255

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LN KG  GFQKEV+ CL NA YL+D L+ AGISAMLNE S  VVFERP D EFV  WQ
Sbjct  256  YGLNMKGRIGFQKEVKSCLTNARYLRDGLKEAGISAMLNESSIVVVFERPLDREFVDFWQ  315

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+   NM+HVV+MP VTV+ LD FL +L+Q R +WY  G  +P CLAE++GVSNC C +H
Sbjct  316  LSFLDNMAHVVLMPHVTVKMLDDFLSDLVQKREIWYGSGEVRPVCLAEEIGVSNCACSIH  375



>gb|AIE54278.1| aromatic amino acid decarboxylase 2 [Nicotiana tabacum]
Length=457

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCG+Q+TR  +I+ LS+ +EY+AS DATI GSRNG APIFLW
Sbjct  274  KPIGSVTISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFLW  333

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L  KG  G Q++ + C  NA YLK +L  AGISAMLNE S  VVFERP D +F+R WQ
Sbjct  334  YSLCMKGRAGLQQDAKICNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHWQ  393

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HVVVMP +T E +D F ++L+Q R  WY+ G + PPCLA+D+G  NC C   
Sbjct  394  LSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQ  453

Query  201  K  199
            K
Sbjct  454  K  454



>ref|XP_009774334.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCG+Q+TR  +I+ LS+ +EY+AS DATI GSRNG APIFLW
Sbjct  263  KPIGSVSISGHKFLGCPMPCGIQITRKSYISHLSTKIEYIASVDATISGSRNGLAPIFLW  322

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L  KG  G Q++ + C  NA YLK +L  AGISAMLNE S  VVFERP D +F+R WQ
Sbjct  323  YSLCMKGRAGLQQDAKMCNENARYLKGRLHKAGISAMLNESSIIVVFERPNDPKFIRHWQ  382

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HVVVMP +T E +D F ++L+Q R  WY+ G   PPCLA+D+G  NC C   
Sbjct  383  LSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTIVPPCLADDIGSQNCLCSKQ  442

Query  201  K  199
            K
Sbjct  443  K  443



>ref|XP_009622262.1| PREDICTED: LOW QUALITY PROTEIN: histidine decarboxylase-like 
[Nicotiana tomentosiformis]
Length=444

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCG+Q+TR  +I +LS+ +EY+AS DATI GSRNG APIFLW
Sbjct  261  KPIGSVSISGHKFLGCPMPCGIQITRKGYITSLSTKIEYIASVDATISGSRNGLAPIFLW  320

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L  KG  G Q++ + C  NA YLK +L  AGI+AMLNE S  VVFERP D +F+R WQ
Sbjct  321  YSLCMKGRAGLQQDAKMCNENARYLKGRLHKAGINAMLNECSIIVVFERPNDPKFIRHWQ  380

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HVV+MP +T E +D F  +L+Q R  WY+ G + PPCLA+D+G  NC C   
Sbjct  381  LSCTRDMAHVVIMPGITRETIDSFFKDLMQERXKWYQVGTTVPPCLADDIGSQNCICSKQ  440

Query  201  K  199
            K
Sbjct  441  K  441



>ref|XP_002953989.1| serine decarboxylase [Volvox carteri f. nagariensis]
 gb|EFJ45018.1| serine decarboxylase [Volvox carteri f. nagariensis]
Length=473

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVG P PCGV +TR  H+ ALSS+VEYL SRDATIMGSRNGHAPI+LW
Sbjct  298  KPIGSVSVSGHKFVGAPVPCGVVITRFKHVMALSSDVEYLNSRDATIMGSRNGHAPIYLW  357

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL RKGY+G +++V++C+RNAH LK  L  AGI  MLNELS+TVVFERPK+E FVR+WQ
Sbjct  358  YTLTRKGYEGMRRDVERCMRNAHVLKQMLESAGIRTMLNELSNTVVFERPKEEAFVRKWQ  417

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            LACE +++HVVVMP++TVEKL+ F+ + +Q+R+
Sbjct  418  LACEGDIAHVVVMPNITVEKLEEFVADYVQSRA  450



>ref|NP_001242861.1| uncharacterized protein LOC100792053 [Glycine max]
 gb|ACU18387.1| unknown [Glycine max]
Length=438

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TRL+H+NALS NVEYLASRDATIMGSRNGHAPIFLW
Sbjct  305  KPIGSVSVSGHKFVGCPMPCGVQITRLEHVNALSRNVEYLASRDATIMGSRNGHAPIFLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+LN KGY+GFQKEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DE FV +WQ
Sbjct  365  YSLNMKGYRGFQKEVQKCLRNAHYFKDRLVDAGIGAMLNELSSTVVFERPHDEGFVHKWQ  424

Query  381  LACERNMSHV  352
            LAC+ N++HV
Sbjct  425  LACQGNVAHV  434



>ref|XP_009601849.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=408

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            K +GSVS+SGHKF+GCP PCG+Q+TR  +I++LS+ +EY+AS DATI GSRNG API LW
Sbjct  225  KSVGSVSISGHKFLGCPMPCGIQMTRKSYISSLSTKIEYIASTDATISGSRNGLAPILLW  284

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L  KG  G Q++ + C+ NA YLK +L  AGISAMLNE S  VVFERP D +F+R+WQ
Sbjct  285  YSLCMKGRTGLQQDAKMCIENARYLKGQLHKAGISAMLNEFSIIVVFERPNDHKFIRQWQ  344

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+H VVMP +T E +D F  +L+  R  WY  G + PPCLA+D+   NC C  H
Sbjct  345  LSCTRDMTHAVVMPCITRETIDNFFKDLMHEREKWYRVGTTVPPCLADDIASQNCLCCCH  404

Query  201  K*CN  190
            K C+
Sbjct  405  KMCH  408



>ref|XP_001689659.1| serine decarboxylase [Chlamydomonas reinhardtii]
 gb|EDP09397.1| serine decarboxylase, partial [Chlamydomonas reinhardtii]
Length=375

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVG P PCGV +TR  ++ ALSS+VEYL SRDATIMGSRNGHAP++LW
Sbjct  224  KPIGSVSVSGHKFVGAPVPCGVIITRFKYVMALSSDVEYLNSRDATIMGSRNGHAPVYLW  283

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL RKGY G +++V+KC+RNAH L+  L  AGI  MLNELS+TVVFERPK+E FVR+WQ
Sbjct  284  YTLTRKGYDGMRRDVEKCMRNAHVLQQMLESAGIRTMLNELSNTVVFERPKEEAFVRKWQ  343

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
            LACE  ++HVVVMP++TVEKL+ F+ + +Q+R
Sbjct  344  LACEGEIAHVVVMPNITVEKLEEFVADYVQSR  375



>ref|XP_004496485.1| PREDICTED: histidine decarboxylase-like [Cicer arietinum]
Length=446

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI SV++SGHKF+GCP PCGV +TRL +IN LS +VE +ASRDATI GSR GHAPI LW
Sbjct  264  KPIDSVTISGHKFLGCPSPCGVVITRLKYINELSRDVEIIASRDATITGSRCGHAPILLW  323

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L +KG  G + EV +C+ NA YL D+LR AGI AMLNE S+ VVFE+P D+ F RRW 
Sbjct  324  YALKKKGLIGLKNEVHECIINARYLLDQLRDAGIGAMLNEFSNIVVFEKPLDDNFTRRWN  383

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LA + N++HVVV+  VT E LD F+ E IQ RS+WY+ G+ +P C+A  VG +NC C +H
Sbjct  384  LATKGNIAHVVVLMHVTKEMLDTFVREFIQKRSIWYKHGHFQPLCIANHVGSTNCVCSIH  443

Query  201  K  199
            K
Sbjct  444  K  444



>ref|XP_011401256.1| Histidine decarboxylase [Auxenochlorella protothecoides]
 gb|KFM28243.1| Histidine decarboxylase [Auxenochlorella protothecoides]
Length=479

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVG P PCGV +TRL HI ALS++VEYL SRDATIMGSRNGHAPI++W
Sbjct  305  KPIGSVSVSGHKFVGAPVPCGVVMTRLKHIQALSTDVEYLNSRDATIMGSRNGHAPIYMW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YT  RKGY+G +K+V++CLRNAH L+  L  AG+   LNELSSTVVFERP DE+FVRRWQ
Sbjct  365  YTFTRKGYEGLRKDVERCLRNAHLLRSMLERAGVVTSLNELSSTVVFERPADEDFVRRWQ  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            LAC+ +++HVVVMP++TV KL+ F+ ELI  R+
Sbjct  425  LACQGDIAHVVVMPNITVAKLERFVTELIAVRA  457



>ref|XP_009601848.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 135/184 (73%), Gaps = 0/184 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            K +GSVS+SGHKF+GCP PCG+Q+TR  +I++LS+ +EY+AS DATI GSRNG API LW
Sbjct  265  KSVGSVSISGHKFLGCPMPCGIQMTRKSYISSLSTKIEYIASTDATISGSRNGLAPILLW  324

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L  KG  G Q++ + C+ NA YLK +L  AGISAMLNE S  VVFERP D +F+R+WQ
Sbjct  325  YSLCMKGRTGLQQDAKMCIENARYLKGQLHKAGISAMLNEFSIIVVFERPNDHKFIRQWQ  384

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+H VVMP +T E +D F  +L+  R  WY  G + PPCLA+D+   NC C  H
Sbjct  385  LSCTRDMTHAVVMPCITRETIDNFFKDLMHEREKWYRVGTTVPPCLADDIASQNCLCCCH  444

Query  201  K*CN  190
            K C+
Sbjct  445  KMCH  448



>ref|XP_005845371.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
 gb|EFN53269.1| hypothetical protein CHLNCDRAFT_53969 [Chlorella variabilis]
Length=468

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+SVSGHKFVG P PCGV +TRL +I  +SS+VEYL SRDATIMGSRNGHAPI++W
Sbjct  294  KPIGSISVSGHKFVGSPVPCGVVMTRLRYIKGVSSDVEYLNSRDATIMGSRNGHAPIYMW  353

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YT  RKGY+G +K+V+KCLRNAH LK  L  AG+  MLNELSSTVVFERP++E FVR+WQ
Sbjct  354  YTFTRKGYEGLRKDVEKCLRNAHLLKSMLDTAGVRTMLNELSSTVVFERPREESFVRKWQ  413

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            LACE +++HVVVMP++T+ KL+ F+ EL+++R+
Sbjct  414  LACEGDIAHVVVMPNITIRKLETFVQELVESRA  446



>ref|XP_003592128.1| Embryo defective 1075-like protein [Medicago truncatula]
 gb|AES62379.1| serine decarboxylase [Medicago truncatula]
Length=451

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 133/180 (74%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI SV++SGHKF+GCP PCGV +TRL ++NALS +V+ +ASRDATI GSR GHAPIFLW
Sbjct  266  KPIDSVTISGHKFLGCPSPCGVLITRLKYMNALSRDVDIIASRDATITGSRCGHAPIFLW  325

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L ++G  G + EV +C+  AHYL + LR AGI AMLN+ S+ VVFERP D+ F RRW 
Sbjct  326  YALKKRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNKFSNIVVFERPLDDHFTRRWN  385

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LA  +N +HVVV+  VTVE LD F+ E  + +S+WY+    +PPC+A DVG  NC C +H
Sbjct  386  LASNKNTAHVVVLKHVTVEMLDSFVREFTEKQSIWYKDEQFQPPCIANDVGSRNCACSIH  445



>ref|XP_009602156.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=446

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 132/181 (73%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCG+Q+TR  +I +LS+ +EY+AS DATI GSRNG APIFLW
Sbjct  263  KPIGSVSISGHKFLGCPMPCGIQITRKSYITSLSTKIEYIASVDATISGSRNGLAPIFLW  322

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L  KG  G Q++ + C  NA YLK +L  AGIS MLNE S  VVFERP   +F+R WQ
Sbjct  323  YSLCMKGRAGLQQDAKMCNENARYLKGQLHKAGISTMLNESSIIVVFERPNVPKFIRHWQ  382

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+M+HVVVMP +T E +D F  +L+Q R  WY+ G   PPCLA+D+G  NC C   
Sbjct  383  LSCTRDMAHVVVMPGITRETIDNFFKDLMQERKKWYQVGIIVPPCLADDIGSQNCLCSKQ  442

Query  201  K  199
            K
Sbjct  443  K  443



>ref|XP_006364728.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=447

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+S+SGHKF+GCP PCG+Q+TR  ++++LS  +EY+AS D TI GSRNG  PIFLW
Sbjct  262  KPIGSISISGHKFLGCPMPCGIQITRKSYVSSLSK-IEYIASIDTTISGSRNGLTPIFLW  320

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LN KG+   Q++   C+ NA YLKD+L  AGISAMLNELS  VVFERP D EF+RRWQ
Sbjct  321  YCLNMKGHARLQQDSITCIENARYLKDRLVKAGISAMLNELSIIVVFERPCDHEFIRRWQ  380

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCC  211
            L     M+H+VVMP +T E +D F ++L+Q R  W++ G ++PPCLA+D G  NC C
Sbjct  381  LCYLSVMAHIVVMPFITREIIDSFFNDLMQERKRWFQDGKTRPPCLADDFGTQNCMC  437



>ref|XP_006364727.1| PREDICTED: histidine decarboxylase-like, partial [Solanum tuberosum]
Length=422

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+S+SGHKF+GCP PCG+Q+TR  ++++LS  +EY+ S DATI GSRNG  PIFLW
Sbjct  240  KPIGSISISGHKFLGCPMPCGIQITRKSYVSSLSK-IEYINSTDATISGSRNGLTPIFLW  298

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L+ KG+   Q++ + C+ NA YLKD+L  AGISAMLNE S TVVFERP D +F+RRW 
Sbjct  299  YCLSTKGHVRLQQDSKICIENARYLKDRLLEAGISAMLNEFSITVVFERPCDHKFIRRWN  358

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCC  211
            L   R M+HVVVMP +T E +D F ++L+Q R  W++ G ++PPCLA+D G  NC C
Sbjct  359  LCYLRGMAHVVVMPGITREIIDSFFNDLMQERKRWFQDGKTRPPCLADDFGTQNCMC  415



>gb|KEH43660.1| serine decarboxylase [Medicago truncatula]
Length=543

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 134/180 (74%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGV +TRL +++A+S +V  +ASRDATI GSR GHAPIFLW
Sbjct  269  KPIGSVTISGHKFLGCPSPCGVVITRLKYMSAISRDVGIIASRDATITGSRCGHAPIFLW  328

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L ++G  G + EV +C+  AHYL + LR AGI AMLNE S+ VVFERP D++F R W 
Sbjct  329  YALKKRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNEFSNIVVFERPLDDDFNRSWN  388

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC  N++HVVV+  V+VE LD F+ E I+ RS+W +    KP C+A DVG  NC C++H
Sbjct  389  LACSGNIAHVVVLQHVSVEMLDTFVHEFIEKRSIWSKDEQFKPLCIANDVGSKNCACLMH  448



>gb|EYU40386.1| hypothetical protein MIMGU_mgv1a026369mg, partial [Erythranthe 
guttata]
Length=300

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 127/181 (70%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHI-NALSSNVEYLASRDATIMGSRNGHAPIFL  565
            KPI S+SVS HK +G   PCGV +TR   I N LS NVEY+ + D TI GSRNGHAPIF+
Sbjct  118  KPIRSISVSAHKLLGSSIPCGVLMTRKGRITNNLSENVEYIDTLDTTISGSRNGHAPIFI  177

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WY L  KG  G   EV KCL NA YL+D  + AGISAMLNE S  VVFERP   EF+  W
Sbjct  178  WYGLKMKGRSGLHTEVNKCLTNAKYLRDGFKNAGISAMLNESSIVVVFERPLSREFIDYW  237

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            QL+    M+HVVVMP VTV+ LD FLD+L+Q R +WY  G  +P CLAE++GVSNC C++
Sbjct  238  QLSLLEKMAHVVVMPHVTVKMLDDFLDDLVQNREIWYGNGKVQPLCLAEEIGVSNCACLV  297

Query  204  H  202
            H
Sbjct  298  H  298



>gb|KDD76585.1| hypothetical protein H632_c172p0 [Helicosporidium sp. ATCC 50920]
Length=483

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVG P PCGV +TRL ++ ALSS VEYL SRDATIMGSRNGHAPI+LW
Sbjct  305  KPIGSVSVSGHKFVGAPMPCGVVMTRLRYVEALSSEVEYLNSRDATIMGSRNGHAPIYLW  364

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL RKG  G +K+V++CLRNAH LKD L+ AG+ A LN LSSTVVFERP D  FVRRWQ
Sbjct  365  YTLARKGLVGMRKDVERCLRNAHLLKDMLQRAGVGASLNPLSSTVVFERPADPAFVRRWQ  424

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            LACE +++HV+VMP++TV KL+ F+ EL+  R+
Sbjct  425  LACEGDIAHVIVMPNITVAKLEKFVKELLACRA  457



>ref|XP_011082256.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=437

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVS+SGHKF+GCP PCGV LTR  +I+ LS+++EY+A+ D TI GSRNGH+PIFLW
Sbjct  272  KPIGSVSISGHKFLGCPMPCGVLLTRKRYIDILSTSIEYIATVDTTIAGSRNGHSPIFLW  331

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LN KG KG +++V+KCL N+ YL+D+L+ AGI++MLNE+S TVVFERP D EF+R WQ
Sbjct  332  YVLNIKGQKGLEEDVEKCLINSRYLRDRLKKAGINSMLNEMSITVVFERPPDSEFIRHWQ  391

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWY  274
            L C  NM+HVV+MP VTVE LD FL +L+Q R++WY
Sbjct  392  LQCLGNMAHVVIMPHVTVEMLDHFLYDLLQKRNIWY  427



>gb|EMS65243.1| Histidine decarboxylase [Triticum urartu]
Length=357

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 124/181 (69%), Gaps = 39/181 (22%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR                                  
Sbjct  215  KPIGSVSVSGHKFVGCPMPCGVQITR----------------------------------  240

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
                 KGY+GFQKEVQKCLRNAHYLKD+L+ AGISAMLNELSSTVVFERPKDEEFVRRWQ
Sbjct  241  -----KGYRGFQKEVQKCLRNAHYLKDRLKDAGISAMLNELSSTVVFERPKDEEFVRRWQ  295

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LACE  +SHVVVMPSV V+KLD FL+EL++ R  WY+ G  + PC+A DVG  NC C LH
Sbjct  296  LACEGGISHVVVMPSVNVDKLDTFLNELVEKRVTWYQEGKCQSPCIAADVGQENCLCTLH  355

Query  201  K  199
            K
Sbjct  356  K  356



>gb|EYU30500.1| hypothetical protein MIMGU_mgv1a023109mg, partial [Erythranthe 
guttata]
Length=418

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 129/181 (71%), Gaps = 0/181 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVS HK +G   PCG+ ++R  H+   S+N+EY+A+ D TI GSRNGH PIF+W
Sbjct  236  KPIGSVSVSAHKLLGSSMPCGILISRKMHMTDFSTNIEYIATLDTTISGSRNGHTPIFIW  295

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LN KG  G QKEV  CL NA YL+D L  AGISAMLNE S  VVFERP D EF+  WQ
Sbjct  296  YGLNLKGRIGLQKEVNNCLTNAKYLRDGLNKAGISAMLNESSIVVVFERPLDREFIDYWQ  355

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+    M+HVV+MP VT++ LD FL +L++ R +WY  G  +P CLAE++G SNC C +H
Sbjct  356  LSFLGKMAHVVLMPHVTMKMLDDFLSDLVRKREIWYGSGEVRPVCLAEEIGASNCACSIH  415

Query  201  K  199
            +
Sbjct  416  R  416



>gb|KIZ00141.1| histidine decarboxylase [Monoraphidium neglectum]
Length=481

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKF+G P PCGV +TR  H+ ALSS+VEYL SRDATIMGSRNGHAP++LW
Sbjct  300  KPIGSVSVSGHKFLGAPVPCGVVITRFRHVLALSSDVEYLNSRDATIMGSRNGHAPLYLW  359

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            YTL RKGY G  ++V++C+RNAH LK  L  AG+  MLNELS+TVVFERP++E FVR+WQ
Sbjct  360  YTLTRKGYAGIARDVERCMRNAHTLKSMLDQAGVKTMLNELSNTVVFERPREEAFVRKWQ  419

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            LACE +++HVVVMP++ + KL+ F+ + I +R+
Sbjct  420  LACEGDIAHVVVMPNIDIAKLEEFVQDYISSRA  452



>gb|EYU19378.1| hypothetical protein MIMGU_mgv1a006611mg [Erythranthe guttata]
Length=437

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVS HK +G   PCGV +TR  HI   S N+EY+A+ D TI GSRNGHAPIF+W
Sbjct  249  KPIGSVSVSAHKLLGSSMPCGVFMTRKRHIADFSRNIEYIATVDNTISGSRNGHAPIFIW  308

Query  561  YTLNRK-GYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            Y+LN K G  G QKEV KCL NA YL+D L+ AGIS MLNE +  VVFERP D EF+  W
Sbjct  309  YSLNMKLGRMGLQKEVNKCLMNARYLRDGLKNAGISVMLNESNILVVFERPLDLEFIYHW  368

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            QL+ +  M+HV+VMP VTV+ LD FL +L + R +WY  G  +  CLAED+G+SNC C +
Sbjct  369  QLSVDGKMAHVIVMPHVTVKMLDDFLSDLTRKREIWYGSGEVRRLCLAEDIGLSNCACSV  428

Query  204  H  202
            H
Sbjct  429  H  429



>ref|XP_006362640.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=346

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 130/180 (72%), Gaps = 2/180 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            K IGS+SVSGHKF+GC   CGVQ+TR  +I  +S  VEY+AS D TI GSRNG APIFLW
Sbjct  165  KSIGSISVSGHKFLGCSMLCGVQITRKTYIATISKRVEYIASIDNTISGSRNGLAPIFLW  224

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG+ G Q+  + C  NA YLKD+L  AGISAMLNELS+ VVFERP D++F+RRWQ
Sbjct  225  YSLSMKGHVGLQQHAKMCYENARYLKDRLHKAGISAMLNELSNIVVFERPCDDKFIRRWQ  284

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L+C R+ +HVVVMP  T E +D F  +L+Q R  W   G +  PCLA+D+G  NC C  H
Sbjct  285  LSCTRDTAHVVVMPGTTKEIIDNFFKDLMQEREKW--CGITLAPCLADDIGSQNCLCSYH  342



>gb|EEC76705.1| hypothetical protein OsI_14710 [Oryza sativa Indica Group]
Length=407

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 133/181 (73%), Gaps = 6/181 (3%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSRNGHAPIFL  565
            KPIGS+ +SGHKF+GCP PCGV +TRL  IN  +S+N+EY++S D TI GSRNGHAPIFL
Sbjct  224  KPIGSICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSRNGHAPIFL  283

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WY L R GY G  K V+ CL+NA YL  +LR  G+S  LN LS TVVFERPKDE FVR+W
Sbjct  284  WYALKRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPKDETFVRKW  343

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            QLAC+  ++HVVVMP+V++E+++ FL+E  ++R   ++       C+A DVG  NC C L
Sbjct  344  QLACQGKIAHVVVMPNVSLERINMFLEEFTKSRITLHQ-----DKCVAGDVGQENCLCSL  398

Query  204  H  202
            H
Sbjct  399  H  399



>gb|AES62380.2| serine decarboxylase [Medicago truncatula]
Length=432

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 130/180 (72%), Gaps = 7/180 (4%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            K IGS+++SGHKF+GCP PCGV LTRL+HIN L  +VE + SRD TI GSR+GHA IF+W
Sbjct  259  KSIGSITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRSGHASIFIW  318

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L +KG  G + EV KC+ NA YLK KLR AGI  MLNE S+TVVFE+P D EF+R+W 
Sbjct  319  YALQKKGLLGLENEVHKCIMNACYLKRKLRDAGICTMLNEYSNTVVFEKPLDCEFIRKWN  378

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LA E +++HVVVM  VTVE LD F+DE I+ R         KP CLA+ +G  NC C+LH
Sbjct  379  LAYEGDIAHVVVMQHVTVEMLDSFVDEFIKTRL-------RKPLCLADKIGAENCTCILH  431



>ref|XP_003592129.1| Serine decarboxylase [Medicago truncatula]
Length=456

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 130/180 (72%), Gaps = 7/180 (4%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            K IGS+++SGHKF+GCP PCGV LTRL+HIN L  +VE + SRD TI GSR+GHA IF+W
Sbjct  283  KSIGSITISGHKFLGCPIPCGVLLTRLEHINTLCKDVEVIGSRDTTISGSRSGHASIFIW  342

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L +KG  G + EV KC+ NA YLK KLR AGI  MLNE S+TVVFE+P D EF+R+W 
Sbjct  343  YALQKKGLLGLENEVHKCIMNACYLKRKLRDAGICTMLNEYSNTVVFEKPLDCEFIRKWN  402

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LA E +++HVVVM  VTVE LD F+DE I+ R         KP CLA+ +G  NC C+LH
Sbjct  403  LAYEGDIAHVVVMQHVTVEMLDSFVDEFIKTRL-------RKPLCLADKIGAENCTCILH  455



>gb|EEE60437.1| hypothetical protein OsJ_13648 [Oryza sativa Japonica Group]
Length=334

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 6/181 (3%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSRNGHAPIFL  565
            KPIGS+ +SGHKF+GCP PCGV +TRL  IN  +S+N+EY++S D TI GSRNGHAPIFL
Sbjct  151  KPIGSICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSRNGHAPIFL  210

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WY L R GY G  K V+ CL+NA YL  +LR  G+S  LN LS TVVFERP DE FVR+W
Sbjct  211  WYALKRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPNDETFVRKW  270

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            QLAC+  ++HVVVMP+V++E+++ FL+E  ++R   ++       C+A DV   NC C L
Sbjct  271  QLACQGKIAHVVVMPNVSLERINMFLEEFTKSRIALHQ-----DKCVAGDVSQENCLCSL  325

Query  204  H  202
            H
Sbjct  326  H  326



>ref|XP_004245146.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=444

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            K IGS+SVSGHKF+GC  PCGVQ+T+  +I  +S  VEY+AS D TI GSRNG APIFLW
Sbjct  263  KSIGSISVSGHKFLGCSMPCGVQITKRTYITTISKQVEYIASIDNTISGSRNGLAPIFLW  322

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+ + C  NA YLKD+L  AGISAMLNE S+ VVFERP D +F+RRWQ
Sbjct  323  YSLSMKGNAGLQKDAKICYENARYLKDRLHKAGISAMLNEFSNIVVFERPCDNKFIRRWQ  382

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCC  211
            L+C R+ +HVVVMP  T E +D F  +L+Q R  W   G +  PCLA+D+G  NC C
Sbjct  383  LSCARDTAHVVVMPGTTKEIIDNFFKDLVQEREKW--CGITLGPCLADDIGSQNCLC  437



>ref|XP_004245145.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=443

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 128/177 (72%), Gaps = 1/177 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+SVSGHKF+GCP PCG+Q+TR  +++ LS  +EY+AS D TI GSR G  PIFLW
Sbjct  261  KPIGSISVSGHKFLGCPMPCGIQITRKTYVSTLSK-IEYIASIDTTISGSRYGLTPIFLW  319

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y LN KG+ G Q++   C+ NA YLKDKL  AGI AMLNE S  VVFERP D +F+ RWQ
Sbjct  320  YYLNMKGHAGLQQDSITCIENARYLKDKLVKAGIGAMLNEFSIIVVFERPCDHKFILRWQ  379

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCC  211
            L     ++H+VVMP +T E ++ F +EL+Q R  W++ G +KPPCLA++ G  NC C
Sbjct  380  LCYLSGLAHIVVMPGITREIINSFFNELMQERKRWFQDGKTKPPCLADEFGSQNCMC  436



>ref|XP_005646136.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
 gb|EIE21592.1| serine decarboxylase [Coccomyxa subellipsoidea C-169]
Length=377

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKF+G P PCGV +TR  ++ ALS++VEYL SRDATIMGSRNGHAPI++W
Sbjct  200  KPIGSVSVSGHKFIGAPVPCGVVITRQKYVAALSNDVEYLNSRDATIMGSRNGHAPIYMW  259

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            +TL RKGY+G +K+V++CLRNA  LK  L  AG+  MLNELSSTVVFERP++E FVR+WQ
Sbjct  260  FTLTRKGYEGMRKDVERCLRNALVLKSMLEQAGVKVMLNELSSTVVFERPREEAFVRKWQ  319

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            LACE  ++HVVVMP+V +  L+ F+ +LI +R+
Sbjct  320  LACEGEVAHVVVMPNVHMAILEEFVADLIASRT  352



>ref|XP_003592132.1| FAR1-related protein [Medicago truncatula]
Length=1272

 Score =   229 bits (584),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 134/180 (74%), Gaps = 0/180 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGV +TRL +++A+S +V  +ASRDATI GSR GHAPIFLW
Sbjct  285  KPIGSVTISGHKFLGCPSPCGVVITRLKYMSAISRDVGIIASRDATITGSRCGHAPIFLW  344

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L ++G  G + EV +C+  AHYL + LR AGI AMLNE S+ VVFERP D++F R W 
Sbjct  345  YALKKRGLIGLENEVHECIMKAHYLLNLLRDAGIGAMLNEFSNIVVFERPLDDDFNRSWN  404

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC  N++HVVV+  V+VE LD F+ E I+ RS+W +    KP C+A DVG  NC C++H
Sbjct  405  LACSGNIAHVVVLQHVSVEMLDTFVHEFIEKRSIWSKDEQFKPLCIANDVGSKNCACLMH  464



>sp|Q7X8D4.2|SDC3_ORYSJ RecName: Full=Serine decarboxylase 3 [Oryza sativa Japonica Group]
 emb|CAE05435.2| OSJNBa0059H15.18 [Oryza sativa Japonica Group]
 emb|CAE04954.2| OSJNBa0070D17.5 [Oryza sativa Japonica Group]
Length=446

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 6/181 (3%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSRNGHAPIFL  565
            KPIGS+ +SGHKF+GCP PCGV +TRL  IN  +S+N+EY++S D TI GSRNGHAPIFL
Sbjct  263  KPIGSICISGHKFIGCPIPCGVLITRLMDINHVMSTNIEYISSNDTTIAGSRNGHAPIFL  322

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WY L R GY G  K V+ CL+NA YL  +LR  G+S  LN LS TVVFERP DE FVR+W
Sbjct  323  WYALKRIGYNGLCKTVENCLKNAQYLALRLREMGVSVFLNALSITVVFERPNDETFVRKW  382

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            QLAC+  ++HVVVMP+V++E+++ FL+E  ++R   ++       C+A DV   NC C L
Sbjct  383  QLACQGKIAHVVVMPNVSLERINMFLEEFTKSRIALHQ-----DKCVAGDVSQENCLCSL  437

Query  204  H  202
            H
Sbjct  438  H  438



>ref|XP_006663420.1| PREDICTED: histidine decarboxylase-like [Oryza brachyantha]
Length=446

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHIN-ALSSNVEYLASRDATIMGSRNGHAPIFL  565
            K IGS+SVSGHK +GCP PCGV + RL  IN  +S+N+EY+ASRDATI GSRNGHAPI +
Sbjct  259  KSIGSISVSGHKLLGCPTPCGVVVNRLKDINLVMSTNIEYVASRDATITGSRNGHAPIIM  318

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WYTL   GY G + +V  C+R A YL+  L+  G+S +LN  SSTV+FERPKDE FVR+W
Sbjct  319  WYTLKCLGYNGIRMKVTTCIRKAEYLEFLLKKKGVSTLLNPGSSTVIFERPKDEVFVRKW  378

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVL  205
            QLACE N++HVVVMP+V++  L  F+DEL + R +         PC+A D+G  NC C L
Sbjct  379  QLACEGNLAHVVVMPNVSIRHLFRFVDELAENRYIMLHDKEISTPCVAADIGPGNCMCNL  438

Query  204  H  202
            H
Sbjct  439  H  439



>ref|XP_002456988.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
 gb|EES02108.1| hypothetical protein SORBIDRAFT_03g046840 [Sorghum bicolor]
Length=480

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 136/181 (75%), Gaps = 4/181 (2%)
 Frame = -1

Query  741  KP-IGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFL  565
            KP IGSVSVSGHKF+GCP PCGV +TR +H   LS++V+Y++SRDATI GSRNGHAP+FL
Sbjct  290  KPGIGSVSVSGHKFLGCPVPCGVVITRREHAAVLSTDVDYISSRDATITGSRNGHAPLFL  349

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAM-LNELSSTVVFERPKDEEFVRR  388
            W  LN KG +G + +V +CLRNA +L  +LR AG+SA  LN LS TVV ERP+DE FVR+
Sbjct  350  WCALNAKGRRGIRDDVHRCLRNARFLARRLRDAGVSAARLNPLSITVVLERPRDEAFVRK  409

Query  387  WQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNS--KPPCLAEDVGVSNCC  214
            WQL+C+  ++HVVVMP+V V+K+  F+++L   R +WY  G      PC+A+D+G  NC 
Sbjct  410  WQLSCQGGVAHVVVMPNVGVDKIASFVEDLAAKRRIWYPHGEGLRVGPCVAKDIGQENCL  469

Query  213  C  211
            C
Sbjct  470  C  470



>ref|XP_004245144.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=444

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 129/181 (71%), Gaps = 1/181 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+S+SGHKF+GCP PCG+Q+TR  +++   S +EY+ S DATI GSRNG  PIFLW
Sbjct  262  KPIGSISISGHKFLGCPMPCGIQITRKTYVST-HSKIEYINSTDATISGSRNGFTPIFLW  320

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L++KG+   Q++   C+ NA YLKD+L  AGIS MLNE S TV+FER  D +F+ RW 
Sbjct  321  YCLSKKGHARLQQDSITCIENARYLKDRLLEAGISVMLNEFSITVIFERSCDHKFIHRWN  380

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            L   R M+HVVVMP +T E +D F  +L+Q R  W++ G ++PPCLA++ G  NC C  +
Sbjct  381  LCYLRGMAHVVVMPGITRETIDSFFKDLMQERKRWFQDGKTQPPCLADEFGSQNCMCSHN  440

Query  201  K  199
            K
Sbjct  441  K  441



>ref|NP_001234136.1| histidine decarboxylase [Solanum lycopersicum]
 sp|P54772.1|DCHS_SOLLC RecName: Full=Histidine decarboxylase; Short=HDC; AltName: Full=TOM92 
[Solanum lycopersicum]
 emb|CAA50719.1| histidine decarboxylase [Solanum lycopersicum]
Length=413

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 130/178 (73%), Gaps = 3/178 (2%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+S+SGHKF+GCP  CGVQ+TR  +++ LS  +EY+ S DATI GSRNG  PIFLW
Sbjct  231  KPIGSISISGHKFLGCPMSCGVQITRRSYVSTLSK-IEYINSADATISGSRNGFTPIFLW  289

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L++KG+   Q++   C+ NA YLKD+L  AGIS MLN+ S TVVFERP D +F+RRW 
Sbjct  290  YCLSKKGHARLQQDSITCIENARYLKDRLLEAGISVMLNDFSITVVFERPCDHKFIRRWN  349

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSV-WYEGGNSKPPCLAEDVGVSNCCC  211
            L C R M+HVV+MP +T E +D F  +L+Q R+  WY+   + PPCLA+D+ + NC C
Sbjct  350  LCCLRGMAHVVIMPGITRETIDSFFKDLMQERNYKWYQDVKALPPCLADDLAL-NCMC  406



>gb|AEW07461.1| hypothetical protein 0_2106_01, partial [Pinus radiata]
 gb|AFG54678.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54680.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54681.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54683.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54684.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54685.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54688.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54689.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54690.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54691.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54692.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54693.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54694.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
Length=150

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HINALS +VEYLASRDATIMGSRNGHAPIFLW
Sbjct  46   KPIGSVSVSGHKFVGCPMPCGVQITRIEHINALSRDVEYLASRDATIMGSRNGHAPIFLW  105

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTV  427
            YTLNRKGY+GFQKEVQKCLRNAHYLK + R AGISAMLNELSSTV
Sbjct  106  YTLNRKGYRGFQKEVQKCLRNAHYLKGRFRSAGISAMLNELSSTV  150



>gb|AFG54679.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54682.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54686.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
 gb|AFG54687.1| hypothetical protein 0_2106_01, partial [Pinus taeda]
Length=150

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVGCP PCGVQ+TR++HINALS +VEYLASRDATIMGSRNGHAPIFLW
Sbjct  46   KPIGSVSVSGHKFVGCPMPCGVQITRIEHINALSRDVEYLASRDATIMGSRNGHAPIFLW  105

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTV  427
            YTLNRKGY+GFQKEVQKCLRNAHYLK + R  GISAMLNELSSTV
Sbjct  106  YTLNRKGYRGFQKEVQKCLRNAHYLKGRFRSVGISAMLNELSSTV  150



>ref|XP_007159060.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 ref|XP_007159061.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31054.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31055.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=454

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 121/181 (67%), Gaps = 34/181 (19%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVG                                  SRNGHAPIFLW
Sbjct  308  KPIGSVSVSGHKFVG----------------------------------SRNGHAPIFLW  333

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+LN KGY+G QKEVQKCLRNAHY K +L  AGI AM+NELSSTVVFERP DEEFV +WQ
Sbjct  334  YSLNMKGYRGLQKEVQKCLRNAHYFKGQLVEAGIGAMVNELSSTVVFERPHDEEFVHKWQ  393

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKL  FL+EL+Q R  W+  G  +P C+A  VG  NC C +H
Sbjct  394  LACQGNIAHVVVMPNVTIEKLHDFLNELLQKRQEWFRDGKCQPRCIASAVGHENCLCFIH  453

Query  201  K  199
            +
Sbjct  454  R  454



>ref|XP_009609584.1| PREDICTED: histidine decarboxylase-like, partial [Nicotiana tomentosiformis]
Length=269

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSV++SGHKF+GCP PCGVQ+TR  +IN LS NVEY+AS DATI GSRNG  PIFLW
Sbjct  137  KPIGSVTISGHKFLGCPMPCGVQITRKSYINNLSRNVEYIASVDATISGSRNGLTPIFLW  196

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L+ KG  G QK+V++CL NA YLKD+L+ AGIS MLNELS  VV ERP+D EFVRRWQ
Sbjct  197  YSLSAKGQIGLQKDVKRCLDNAIYLKDRLQQAGISVMLNELSIIVVLERPRDHEFVRRWQ  256

Query  381  LACERNMSHVVVM  343
            L+C ++M+HV+VM
Sbjct  257  LSCMKDMAHVIVM  269



>ref|XP_007159059.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
 gb|ESW31053.1| hypothetical protein PHAVU_002G204900g [Phaseolus vulgaris]
Length=494

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 121/181 (67%), Gaps = 34/181 (19%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSVSGHKFVG                                  SRNGHAPIFLW
Sbjct  348  KPIGSVSVSGHKFVG----------------------------------SRNGHAPIFLW  373

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+LN KGY+G QKEVQKCLRNAHY K +L  AGI AM+NELSSTVVFERP DEEFV +WQ
Sbjct  374  YSLNMKGYRGLQKEVQKCLRNAHYFKGQLVEAGIGAMVNELSSTVVFERPHDEEFVHKWQ  433

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCVLH  202
            LAC+ N++HVVVMP+VT+EKL  FL+EL+Q R  W+  G  +P C+A  VG  NC C +H
Sbjct  434  LACQGNIAHVVVMPNVTIEKLHDFLNELLQKRQEWFRDGKCQPRCIASAVGHENCLCFIH  493

Query  201  K  199
            +
Sbjct  494  R  494



>ref|XP_002292250.1| histidine decarboxylase [Thalassiosira pseudonana CCMP1335]
 gb|EED90225.1| histidine decarboxylase, partial [Thalassiosira pseudonana CCMP1335]
Length=369

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI S++VSGHK +GCP PCG+ LTR +H+  +   ++YL S D TIMGSRNG A ++LW
Sbjct  215  KPIDSIAVSGHKMLGCPMPCGIALTRKEHVKKVEQKIDYLNSVDTTIMGSRNGQAALYLW  274

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L +KG  G +++V  C+  A YL+DK+  AG++  LN+LSSTVV ERP D+ F++RWQ
Sbjct  275  YSLRKKGIAGIKRDVVHCMETAQYLRDKITEAGLTCRLNDLSSTVVLERPMDDAFIKRWQ  334

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVW  277
            LACE +++HVVVMP+VT  K+D F++EL++ ++V+
Sbjct  335  LACEEDIAHVVVMPNVTRFKIDKFVEELVECKNVY  369



>ref|XP_002178784.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49482.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=364

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 114/150 (76%), Gaps = 0/150 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI S++VSGHK +GCP PCGV L+R +H+  L  +++YL S D TIMGSRNG A ++LW
Sbjct  215  KPIDSIAVSGHKMLGCPMPCGVALSRKEHVKNLEQHIDYLNSVDTTIMGSRNGQAALYLW  274

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y+L +KG  G +++V  C+  A YLKD L   G++  LN+LSSTVV ERP D++ V+RWQ
Sbjct  275  YSLRKKGIGGIKRDVMHCMETARYLKDALTAKGLTCRLNDLSSTVVLERPMDDDLVKRWQ  334

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQ  292
            LACE +++HVVVMP+VT  K+D F++EL+Q
Sbjct  335  LACEEDIAHVVVMPNVTRYKIDLFVEELMQ  364



>ref|XP_002679079.1| predicted protein [Naegleria gruberi]
 gb|EFC46335.1| predicted protein [Naegleria gruberi]
Length=441

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 128/179 (72%), Gaps = 9/179 (5%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+SVSGHKF+GCP PCGV +TR  ++  L S+++YL S D TIMGSRNG A ++LW
Sbjct  261  KPIGSISVSGHKFMGCPMPCGVTITRKRYVETLKSHIDYLNSVDTTIMGSRNGQASLYLW  320

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
             TL +KG +GF  + +KCL NA Y+   L+ AG+  +LN+ S+T+V ERP DEEFV++WQ
Sbjct  321  LTLRKKGTEGFASDARKCLENAKYMIKLLKEAGVGCLLNDHSNTIVLERPMDEEFVKKWQ  380

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPP--CLAEDVGVSNCCC  211
            LACE  ++H +VMP+V+ +K++ F+++ +++R        S P   C+A+ +G  +C C
Sbjct  381  LACEGTVAHCIVMPNVSKQKIEDFVNDYLESRK-------SHPADLCIAKHIGPVHCLC  432



>ref|XP_004364837.2| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=692

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 124/178 (70%), Gaps = 4/178 (2%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            +PI S+SVSGHKF+GCP P GV + R D++  +  ++ YL S+D TIMGSRNG AP+F+W
Sbjct  508  RPIDSMSVSGHKFMGCPMPAGVVICRKDNVKKVEQHIAYLNSKDTTIMGSRNGQAPLFMW  567

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
             T+  KG  GF K+  +CL  A  L  +LR AG+S+MLN +S+TVVFERP +  FV++WQ
Sbjct  568  NTIQLKGKSGFAKDTHQCLTRAALLNKRLRDAGVSSMLNPMSNTVVFERPDEHAFVKKWQ  627

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCV  208
            LACE N++H +VMP++T EK+  F+ EL+ +R    +G   K  C+A  +G +NC C 
Sbjct  628  LACEGNIAHAIVMPNITEEKIVVFVTELLASRKA--QGTCDK--CVAMHIGRANCLCT  681



>gb|KJE90702.1| serine decarboxylase [Capsaspora owczarzaki ATCC 30864]
Length=683

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 124/178 (70%), Gaps = 4/178 (2%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            +PI S+SVSGHKF+GCP P GV + R D++  +  ++ YL S+D TIMGSRNG AP+F+W
Sbjct  499  RPIDSMSVSGHKFMGCPMPAGVVICRKDNVKKVEQHIAYLNSKDTTIMGSRNGQAPLFMW  558

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
             T+  KG  GF K+  +CL  A  L  +LR AG+S+MLN +S+TVVFERP +  FV++WQ
Sbjct  559  NTIQLKGKSGFAKDTHQCLTRAALLNKRLRDAGVSSMLNPMSNTVVFERPDEHAFVKKWQ  618

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNCCCV  208
            LACE N++H +VMP++T EK+  F+ EL+ +R    +G   K  C+A  +G +NC C 
Sbjct  619  LACEGNIAHAIVMPNITEEKIVVFVTELLASRKA--QGTCDK--CVAMHIGRANCLCT  672



>ref|XP_003593127.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63378.1| serine decarboxylase [Medicago truncatula]
Length=124

 Score =   163 bits (413),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -1

Query  534  GFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLACERNMSH  355
             F+KEVQKCLRNAHY KD+L  AGI AMLNELSSTVVFERP DEEF+R+WQLAC+ N++H
Sbjct  7    SFEKEVQKCLRNAHYFKDRLIEAGIGAMLNELSSTVVFERPHDEEFIRKWQLACKGNIAH  66

Query  354  VVVMPSVTVEKLDCFLDELIQARSVWYEGGNSKPPCLAEDVGVSNC  217
            VVVMP+VT+EKLD FL+EL+Q R+ W+E G  +P C+A DVG ++C
Sbjct  67   VVVMPNVTIEKLDDFLNELVQKRATWFEYGTFQPYCIASDVGENSC  112



>ref|WP_026730962.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=363

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI S+++SGHKF+G P  CGV LTR + +N + ++++Y+ S+D TI+GSRNGHAP+FLW
Sbjct  210  KPISSIAISGHKFIGSPLVCGVVLTRKEFVNKIETSIDYIGSKDTTILGSRNGHAPLFLW  269

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L +K Y+G  KEV+ CL N+ YL + L+      MLN  S+TVVF++P   + V++WQ
Sbjct  270  YALKKKDYQGLAKEVEFCLENSQYLFNNLQLLNYPCMLNNFSNTVVFKKPP-IQLVKKWQ  328

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDEL  298
            LA + + +H+VVM ++   K+D F+ +L
Sbjct  329  LATQGDWAHMVVMQNINRHKIDTFITDL  356



>ref|WP_040468965.1| histidine decarboxylase, partial [Fischerella thermalis]
Length=165

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWY  559
            PIGS+SVSGHKF+G P   G+ LTR  ++  + ++VEY+ S+D TI+GSR+G A +FLWY
Sbjct  7    PIGSISVSGHKFIGSPVTYGIVLTRQPYVKKIETSVEYIGSKDMTILGSRSGLAALFLWY  66

Query  558  TLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQL  379
             +  +  + F KEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E  R+WQL
Sbjct  67   AIQTRS-QHFHKEVANCLQNARYLRDRLLELDYHPLLNDFSTTVVFDKPA-IELCRKWQL  124

Query  378  ACERNMSHVVVMPSVTVEKLDCFLDELI  295
            A + N++H+VVM  ++ +K+D F+D L+
Sbjct  125  ATQGNIAHIVVMQHISTQKIDQFIDNLL  152



>ref|WP_017312078.1| histidine decarboxylase [Fischerella sp. PCC 9339]
Length=391

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 111/168 (66%), Gaps = 5/168 (3%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWY  559
            PIGS+SVSGHKF+G P   G+ LTR  ++N + ++VEY+ S+D TI+GSR+G A + LWY
Sbjct  222  PIGSISVSGHKFIGSPITYGIVLTRQPYVNKIETSVEYIGSQDTTILGSRSGIAALLLWY  281

Query  558  TLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQL  379
             +  + +  FQKEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E  R+WQL
Sbjct  282  AIQTRSHH-FQKEVASCLQNARYLRDRLLEINYHPLLNDFSTTVVFDKPGI-ELCRKWQL  339

Query  378  ACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYE---GGNSKPPCL  244
            A E N +HVVVM  ++ +K+D F+  L+  + +  E    GN K  C+
Sbjct  340  ATEENFAHVVVMQHISTQKIDLFIQNLLVNKEIENEKVLTGNRKTMCV  387



>gb|ABA93664.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1040

 Score =   163 bits (413),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 103/153 (67%), Gaps = 18/153 (12%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINAL-SSNVEYLASRDATIMGSRNGHAPIFL  565
            KPIGS+SVSGHK +GCP PCGV + RL  I+ L S+N+EY+AS D TI GSRNG +PIFL
Sbjct  839  KPIGSISVSGHKLLGCPTPCGVVINRLKDIDVLKSTNIEYIASNDVTISGSRNGQSPIFL  898

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WY L   GY     EV            +LR  GISA +N  S  V+FE+PKDE F+++W
Sbjct  899  WYKLKSMGY-----EV------------RLRNVGISAFMNSKSIIVIFEKPKDEMFMQKW  941

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
            QLAC  N++HVVVMP V+ E L  F++EL + R
Sbjct  942  QLACAGNVAHVVVMPHVSFEMLGIFVEELAEKR  974



>ref|WP_015112001.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
 gb|AFY41767.1| Histidine decarboxylase [Nostoc sp. PCC 7107]
Length=383

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI SV++SG KF+G P PCGV LT+   +  + + +EY+ S+D TI+GSRNGH P+ LW
Sbjct  218  KPIDSVAISG-KFIGSPIPCGVVLTKKKWVEKVETMIEYIGSKDTTILGSRNGHTPLILW  276

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y L  KGY+GF +E + C++NA YL  +L+      MLN+ S+TVVF++P ++  +++WQ
Sbjct  277  YALKTKGYEGFAQEAKTCIQNAQYLFQQLQLREYPCMLNKFSNTVVFQKP-NQVLIKKWQ  335

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELI  295
            LA   N +H++VM ++  +K+D F++EL+
Sbjct  336  LATLDNFAHLIVMQNIDRQKIDTFVNELV  364



>ref|WP_016859640.1| histidine decarboxylase [Fischerella muscicola]
Length=391

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWY  559
            PIGS+SVSGHKF+G P   G+ LTR  ++N + ++VEY+ S+D TI+GSR+G   + LWY
Sbjct  222  PIGSISVSGHKFIGSPITYGIVLTRQPYVNKIETSVEYIGSQDTTILGSRSGITALLLWY  281

Query  558  TLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQL  379
             +  +  + FQKEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E  R+WQL
Sbjct  282  AIQTRS-QHFQKEVASCLQNARYLRDRLLERNYHPLLNDFSTTVVFDKP-GIELCRKWQL  339

Query  378  ACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGG---NSKPPCLAEDV  232
            A E+N++H+VVM  ++ +K+D F+  L+  + +  E     N K  C+   V
Sbjct  340  ATEQNLAHIVVMQHISTQKIDLFIQNLLVNKEIGNEKALTENRKTICVINSV  391



>ref|WP_016870188.1| histidine decarboxylase [Fischerella muscicola]
Length=380

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWY  559
            PIGS+SVSGHKF+G P   G+ LTR  ++  + ++VEY+ S+D TI+GSR+G A + LWY
Sbjct  222  PIGSISVSGHKFIGSPITYGIVLTRQPYVKKIETSVEYIGSKDMTILGSRSGLAALLLWY  281

Query  558  TLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQL  379
             +  +  + F +EV  CL+NA YL+D+L       +LN+ S+TVVF++P D E  R+WQL
Sbjct  282  AIQTRN-QQFHREVATCLQNARYLRDRLLEINYHPLLNDFSTTVVFDKP-DIELCRKWQL  339

Query  378  ACERNMSHVVVMPSVTVEKLDCFLDELI  295
            A E N++H+VVM  ++ +K+D F+D L+
Sbjct  340  ATEGNLAHIVVMQHISTQKIDQFIDNLL  367



>ref|WP_026721610.1| histidine decarboxylase [Fischerella sp. PCC 9431]
Length=391

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 108/161 (67%), Gaps = 6/161 (4%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWY  559
            PIGS+SVSGHKF+G P   G+ LTR  ++N + +++EY+ S+D TI+GSR+G A + LWY
Sbjct  222  PIGSISVSGHKFIGSPITYGIVLTRQPYVNKIETSIEYIGSQDTTILGSRSGIAALLLWY  281

Query  558  TLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQL  379
             + R   + FQKEV  CL+NA YL+D+L       +LN+ S TVVF++P   E  R+WQL
Sbjct  282  AI-RTRSQHFQKEVASCLQNARYLRDRLLEINYHPLLNDFSITVVFDKPGI-ELCRKWQL  339

Query  378  ACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWYEGGNSK  256
            A E N++HVVVM  ++ +K+D F+  L+  + +    GN K
Sbjct  340  ATEENLAHVVVMQHISSQKIDLFIRNLLVNKEI----GNEK  376



>ref|WP_009455225.1| histidine decarboxylase [Fischerella sp. JSC-11]
 gb|EHC17883.1| Histidine decarboxylase [Fischerella sp. JSC-11]
Length=380

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWY  559
            PIGS+SVSGHKF+G P   G+ LTR  ++  + ++VEY+ S+D TI+GSR+G A +FLWY
Sbjct  222  PIGSISVSGHKFIGSPVTYGIVLTRQPYVKKIETSVEYIGSKDMTILGSRSGLAALFLWY  281

Query  558  TLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQL  379
             +  +  + F KEV  CL+NA YL+D+L       +LN+ S+TVVF++P   E  R+WQL
Sbjct  282  AIQTRS-QHFHKEVANCLQNARYLRDRLLEINYHPLLNDFSTTVVFDKPAI-ELCRKWQL  339

Query  378  ACERNMSHVVVMPSVTVEKLDCFLDELI  295
            A + N++H+VVM  ++ +K+D F+D L+
Sbjct  340  ATQGNIAHIVVMQHISTQKIDQFIDNLL  367



>ref|WP_012408195.1| histidine decarboxylase [Nostoc punctiforme]
 gb|ACC80176.1| Pyridoxal-dependent decarboxylase [Nostoc punctiforme PCC 73102]
Length=384

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 100/149 (67%), Gaps = 2/149 (1%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPI SV++S  KF+G P PCGV LT+   +  + + +EY+ S+D TI+GSRNGH P+ LW
Sbjct  218  KPIDSVAISA-KFIGSPLPCGVVLTKKKWVEKVETEIEYIGSKDTTILGSRNGHTPLILW  276

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQ  382
            Y +  +GY G  KE + C+ NA YL  +L+      MLN  S+TVVF++P  +  +++WQ
Sbjct  277  YAVQTRGYDGLAKEAKTCIHNAQYLFQQLQIREYPCMLNNFSNTVVFQKP-SQRLIKKWQ  335

Query  381  LACERNMSHVVVMPSVTVEKLDCFLDELI  295
            LA   N +H++VM ++  EK+D F++EL+
Sbjct  336  LAVFENWAHMIVMQNIVREKIDIFINELL  364



>ref|XP_005840580.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
 gb|EKX53600.1| hypothetical protein GUITHDRAFT_156940 [Guillardia theta CCMP2712]
Length=338

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = -1

Query  735  IGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYT  556
            I S+++SGHKF+G P PCGV +T     + + + ++Y+ S D TI+GSRNGHAP+FL + 
Sbjct  187  INSIAISGHKFLGTPFPCGVFVTEKKFRSLIENRIDYIDSVDDTILGSRNGHAPLFLKHI  246

Query  555  LNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLA  376
            +  K  KGF+++V +CL  A +L ++++  GI A +N+LS TV+F RP  E  V+RWQLA
Sbjct  247  ITVKQNKGFKEDVFRCLYLAQWLVNRMQSLGIDAWMNDLSITVIFPRPA-EIVVKRWQLA  305

Query  375  CERNMSHVVVMPSVTVEKLDCFLDELI  295
               N+SHVVVMP VT E L+ FL E +
Sbjct  306  SNGNLSHVVVMPHVTQEMLEVFLKEYL  332



>ref|WP_026731780.1| histidine decarboxylase [Fischerella sp. PCC 9605]
Length=364

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWY  559
            PIGS++VSGHKF+G P   G+ LTR +++  +   +EYL + D TI GSR G   +FLWY
Sbjct  215  PIGSIAVSGHKFIGSPIHFGIVLTRREYVQKIGKRIEYLGTDDTTITGSRCGLNALFLWY  274

Query  558  TLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQL  379
             +  +G K F +EV  CL NA YL+D+L+  G + +LN+ S TV F++P   +   +WQL
Sbjct  275  AIATRGQK-FAREVVTCLENAQYLRDRLQQIGYNPLLNDFSITVAFKKPP-AKVCDKWQL  332

Query  378  ACERNMSHVVVMPSVTVEKLDCFLDELIQARS  283
            A E N++HVVVM  ++ +K++  +D+L+QA++
Sbjct  333  AIEGNLAHVVVMQHISTQKINELIDDLLQAQA  364



>ref|NP_001176002.1| Os10g0105700 [Oryza sativa Japonica Group]
 dbj|BAH94730.1| Os10g0105700 [Oryza sativa Japonica Group]
Length=219

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGS+SVSGHKF+GCP PCGV +TRL+H   LS+++EY+ASRD+TI GSRNGHAPIFLW
Sbjct  122  KPIGSISVSGHKFLGCPMPCGVVITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPIFLW  181

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLK  484
            YTL++KGYKG  KEV  C+ NA YL+
Sbjct  182  YTLSKKGYKGLLKEVHICMGNARYLE  207



>gb|KCW71157.1| hypothetical protein EUGRSUZ_F04254 [Eucalyptus grandis]
Length=85

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -1

Query  453  MLNELSSTVVFERPKDEEFVRRWQLACERNMSHVVVMPSVTVEKLDCFLDELIQARSVWY  274
            MLNELSSTVVFERP +EEFVRRWQLA E N++HVVVMPSV++EKLD F++ELI+ RS WY
Sbjct  1    MLNELSSTVVFERPSEEEFVRRWQLAFEGNIAHVVVMPSVSIEKLDVFVNELIEKRSTWY  60

Query  273  EGGNSKPPCLAEDVGVSNCCCVLHK  199
              G  + PCLA D+G  NCCC LHK
Sbjct  61   RDGTVQSPCLAVDIGAENCCCALHK  85



>ref|WP_025665600.1| histidine decarboxylase [Aquimarina megaterium]
Length=373

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = -1

Query  735  IGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYT  556
            I S+S+SGHKF+G P P GV + + D+ + ++  + Y+ S DATI GSRNGH P+FLWY 
Sbjct  222  IDSISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGHTPLFLWYA  281

Query  555  LNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLA  376
            + + G +GF+K  +  L  A Y ++KL+  GI A  N  + T+VF  P   E + +WQLA
Sbjct  282  IKKLGVEGFKKRTEHSLGVASYTENKLKDLGIEAWRNPNAITIVFPAPS-TEIIDKWQLA  340

Query  375  CERNMSHVVVMPSVTVEKLDCFLDEL  298
             E   SH++ MP+V+ E++D F+ ++
Sbjct  341  TENGQSHIICMPNVSYEQIDSFIADI  366



>ref|WP_003514849.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 gb|EFB37130.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
JW20]
Length=398

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 101/153 (66%), Gaps = 3/153 (2%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINAL--SSNVEYLASRDATIMGSRNGHAPIFL  565
            PI S+++SGHKFVGCP P G+ LTR  +I  +  +S+V Y+ ++D TI G RNG + + L
Sbjct  243  PIDSIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISGCRNGLSALLL  302

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WY +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++P D      W
Sbjct  303  WYQINRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDKPND-AICNYW  361

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
             LACE + +H+++M  VT E +D F++ L+ ++
Sbjct  362  SLACEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|WP_003516909.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 gb|EEU01894.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
DSM 2360]
 gb|ADU73661.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
DSM 1313]
 gb|EIC03488.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
YS]
 gb|EIC11668.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
AD2]
Length=398

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 101/153 (66%), Gaps = 3/153 (2%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINAL--SSNVEYLASRDATIMGSRNGHAPIFL  565
            PI S+++SGHKFVGCP P G+ LTR  +I  +  +S+V Y+ ++D TI G RNG + + L
Sbjct  243  PIDSIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISGCRNGLSALLL  302

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WY +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++P D      W
Sbjct  303  WYQINRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDKPND-AICNYW  361

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
             LACE + +H+++M  VT E +D F++ L+ ++
Sbjct  362  SLACEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|WP_034238501.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=373

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = -1

Query  735  IGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYT  556
            I S+S+SGHKF+G P P GV + + D+ + ++  + Y+ S DATI GSRNGH P+FLWY 
Sbjct  222  IDSISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGHTPLFLWYA  281

Query  555  LNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLA  376
            + + G +GF+K  +  L  A Y ++KL+  GI A  N  + T+VF  P   E + +WQLA
Sbjct  282  IKKLGVEGFKKRTEHSLGVASYTENKLKNLGIEAWRNPNAITIVFPAPS-TEIIDKWQLA  340

Query  375  CERNMSHVVVMPSVTVEKLDCFLDEL  298
             E   SH++ MP+V+ E++D F+ ++
Sbjct  341  TENGQSHIICMPNVSYEQIDNFIADI  366



>ref|WP_023062889.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 emb|CDG37515.1| histidine decarboxylase [Ruminiclostridium thermocellum BC1]
Length=398

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 101/153 (66%), Gaps = 3/153 (2%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINAL--SSNVEYLASRDATIMGSRNGHAPIFL  565
            PI S+++SGHKFVGCP P G+ LTR  +I  +  +S+V Y+ ++D TI G RNG + + L
Sbjct  243  PIDSIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISGCRNGLSALLL  302

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WY +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++P D      W
Sbjct  303  WYQINRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDKPND-AICNYW  361

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
             LACE + +H+++M  VT E +D F++ L+ ++
Sbjct  362  SLACEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>ref|WP_020457998.1| histidine decarboxylase [Ruminiclostridium thermocellum]
 gb|ABN54224.1| Pyridoxal-dependent decarboxylase [Ruminiclostridium thermocellum 
ATCC 27405]
Length=398

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 101/153 (66%), Gaps = 3/153 (2%)
 Frame = -1

Query  738  PIGSVSVSGHKFVGCPXPCGVQLTRLDHINAL--SSNVEYLASRDATIMGSRNGHAPIFL  565
            PI S+++SGHKFVGCP P G+ LTR  +I  +  +S+V Y+ ++D TI G RNG + + L
Sbjct  243  PIDSIAISGHKFVGCPMPAGIFLTRKKYIQKILENSDVSYVGTKDTTISGCRNGLSALLL  302

Query  564  WYTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRW  385
            WY +NRKG +GF+++V++C+    Y K +L   G +  +N  S+T+V ++P D      W
Sbjct  303  WYQINRKGVEGFKQDVRQCMEVTAYAKARLDSIGWNNFVNPWSNTIVIDKPND-AICNYW  361

Query  384  QLACERNMSHVVVMPSVTVEKLDCFLDELIQAR  286
             LACE + +H+++M  VT E +D F++ L+ ++
Sbjct  362  SLACEGDKAHIIIMQHVTKEHIDLFIEHLLNSK  394



>gb|EZH75803.1| histidine decarboxylase [Aquimarina sp. 22II-S11-z7]
Length=377

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = -1

Query  735  IGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYT  556
            I S+S+SGHKF+G P P GV + + D+ + ++  + Y+ S DATI GSRNGH P+FLWY 
Sbjct  226  IDSISISGHKFIGSPMPSGVVIVKKDNRDRIARRIAYIGSSDATITGSRNGHTPLFLWYA  285

Query  555  LNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLA  376
            + + G +GF+K  +  L  A Y ++KL+  GI A  N  + T+VF  P   E + +WQLA
Sbjct  286  IKKLGVEGFKKRTEHSLGVASYTENKLKNLGIEAWRNPNAITIVFPAPS-TEIIDKWQLA  344

Query  375  CERNMSHVVVMPSVTVEKLDCFLDEL  298
             E   SH++ MP+V+ E++D F+ ++
Sbjct  345  TENGQSHIICMPNVSYEQIDNFIADI  370



>gb|EYU24758.1| hypothetical protein MIMGU_mgv1a026373mg, partial [Erythranthe 
guttata]
Length=282

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -1

Query  741  KPIGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLW  562
            KPIGSVSV  HK +G   PCGV ++R  H    S+N+EY+A+ D TI GS+NGH PIF+W
Sbjct  171  KPIGSVSVLAHKLLGSSMPCGVLISRKMHPTNFSTNIEYIAALDTTISGSQNGHTPIFIW  230

Query  561  YTLNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKD  406
            Y LN KG  G QKEV  CL NA YL+D L  A  SAMLNE S  VVFERP D
Sbjct  231  YGLNMKGRTGLQKEVSNCLTNAKYLRDGLNKATSSAMLNESSIVVVFERPLD  282



>ref|WP_008878268.1| Pyridoxal-dependent decarboxylase [Mesorhizobium metallidurans]
 emb|CCV09416.1| Pyridoxal-dependent decarboxylase [Mesorhizobium metallidurans 
STM 2683]
Length=366

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 95/145 (66%), Gaps = 1/145 (1%)
 Frame = -1

Query  735  IGSVSVSGHKFVGCPXPCGVQLTRLDHINALSSNVEYLASRDATIMGSRNGHAPIFLWYT  556
            I S+S SGHK +G P PCG+ + R +H+N ++S++ YL S D T+MGSRNGHA I +W  
Sbjct  203  IDSISASGHKMIGTPMPCGILVARRNHVNRIASSISYLRSNDTTLMGSRNGHASIAIWER  262

Query  555  LNRKGYKGFQKEVQKCLRNAHYLKDKLRGAGISAMLNELSSTVVFERPKDEEFVRRWQLA  376
            +   G  GFQ+E Q CL  A  L  +LR  G+  + N+ S T+VF +P D + V+ +QLA
Sbjct  263  IVELGEDGFQRETQACLARATRLAQRLRQMGVPVLQNKHSLTLVFPKPND-DIVKMYQLA  321

Query  375  CERNMSHVVVMPSVTVEKLDCFLDE  301
            C+  ++H +VMP+V  E ++ F+ +
Sbjct  322  CDGELAHAIVMPNVNDELINRFIHD  346



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210