BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF021L24

Length=782
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002269355.1|  PREDICTED: serine/threonine-protein kinase 16      349   2e-116   Vitis vinifera
emb|CAN66918.1|  hypothetical protein VITISV_043041                     349   2e-116   Vitis vinifera
ref|XP_009766540.1|  PREDICTED: probable serine/threonine-protein...    349   3e-116   Nicotiana sylvestris
ref|XP_010031327.1|  PREDICTED: serine/threonine-protein kinase 16      348   4e-116   Eucalyptus grandis [rose gum]
gb|ABK92466.1|  unknown                                                 349   4e-116   Populus trichocarpa [western balsam poplar]
ref|XP_004241617.1|  PREDICTED: probable serine/threonine-protein...    348   5e-116   Solanum lycopersicum
ref|XP_003609185.1|  Serine/threonine protein kinase                    348   6e-116   Medicago truncatula
ref|XP_010099029.1|  Serine/threonine-protein kinase 16                 347   2e-115   Morus notabilis
ref|XP_009607782.1|  PREDICTED: probable serine/threonine-protein...    347   2e-115   Nicotiana tomentosiformis
ref|XP_006374373.1|  hypothetical protein POPTR_0015s06550g             347   3e-115   Populus trichocarpa [western balsam poplar]
ref|XP_002317918.2|  hypothetical protein POPTR_0012s05390g             346   7e-115   
dbj|BAJ53163.1|  JHL10I11.9                                             345   1e-114   Jatropha curcas
ref|XP_006354740.1|  PREDICTED: serine/threonine-protein kinase 1...    345   1e-114   Solanum tuberosum [potatoes]
ref|XP_004299264.1|  PREDICTED: serine/threonine-protein kinase 16      345   1e-114   Fragaria vesca subsp. vesca
ref|XP_011011304.1|  PREDICTED: serine/threonine-protein kinase 1...    343   5e-114   Populus euphratica
ref|XP_007209310.1|  hypothetical protein PRUPE_ppa008104mg             343   6e-114   Prunus persica
ref|XP_008240053.1|  PREDICTED: serine/threonine-protein kinase 16      343   6e-114   Prunus mume [ume]
ref|XP_002512018.1|  serine/threonine protein kinase, putative          343   7e-114   Ricinus communis
ref|XP_007037717.1|  Serine/threonine protein kinase 3 isoform 1        343   7e-114   
emb|CDO98513.1|  unnamed protein product                                342   1e-113   Coffea canephora [robusta coffee]
ref|XP_004508637.1|  PREDICTED: serine/threonine-protein kinase 1...    342   2e-113   Cicer arietinum [garbanzo]
ref|XP_010522295.1|  PREDICTED: serine/threonine-protein kinase 1...    342   2e-113   Tarenaya hassleriana [spider flower]
ref|XP_006345079.1|  PREDICTED: serine/threonine-protein kinase 1...    341   3e-113   Solanum tuberosum [potatoes]
ref|XP_010257846.1|  PREDICTED: serine/threonine-protein kinase 16      341   5e-113   Nelumbo nucifera [Indian lotus]
ref|XP_008453329.1|  PREDICTED: serine/threonine-protein kinase 1...    340   7e-113   Cucumis melo [Oriental melon]
ref|XP_003524500.1|  PREDICTED: probable serine/threonine-protein...    340   8e-113   Glycine max [soybeans]
ref|XP_004236087.1|  PREDICTED: probable serine/threonine-protein...    340   9e-113   Solanum lycopersicum
gb|EYU19016.1|  hypothetical protein MIMGU_mgv1a009372mg                340   1e-112   Erythranthe guttata [common monkey flower]
ref|XP_008455005.1|  PREDICTED: serine/threonine-protein kinase 16      340   1e-112   Cucumis melo [Oriental melon]
ref|XP_006399302.1|  hypothetical protein EUTSA_v10013995mg             339   2e-112   Eutrema salsugineum [saltwater cress]
ref|XP_011005497.1|  PREDICTED: serine/threonine-protein kinase 1...    339   2e-112   Populus euphratica
ref|XP_004138208.1|  PREDICTED: probable serine/threonine-protein...    339   2e-112   Cucumis sativus [cucumbers]
gb|KHG15042.1|  Serine/threonine-protein kinase 16                      339   3e-112   Gossypium arboreum [tree cotton]
gb|AIZ68208.1|  Serine/threonine-protein kinase 16                      338   3e-112   Ornithogalum longebracteatum [sea-onion]
gb|AAZ39949.1|  serine/threonine protein kinase                         338   3e-112   Gossypium hirsutum [American cotton]
ref|XP_010547731.1|  PREDICTED: serine/threonine-protein kinase 16      339   4e-112   Tarenaya hassleriana [spider flower]
gb|KHN15181.1|  Serine/threonine-protein kinase 16                      339   5e-112   Glycine soja [wild soybean]
ref|XP_010491440.1|  PREDICTED: probable serine/threonine-protein...    338   5e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002873344.1|  hypothetical protein ARALYDRAFT_487651             338   5e-112   
ref|NP_196433.1|  serine/threonine protein kinase 3                     338   5e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009415450.1|  PREDICTED: probable serine/threonine-protein...    338   6e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG05751.1|  Serine/threonine-protein kinase 16                      332   6e-112   Gossypium arboreum [tree cotton]
ref|XP_006288089.1|  hypothetical protein CARUB_v10001319mg             338   6e-112   Capsella rubella
ref|NP_850792.1|  serine/threonine protein kinase 3                     337   7e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006600612.1|  PREDICTED: serine/threonine-protein kinase 16      338   7e-112   Glycine max [soybeans]
ref|XP_010452793.1|  PREDICTED: probable serine/threonine-protein...    338   8e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010423128.1|  PREDICTED: probable serine/threonine-protein...    338   9e-112   Camelina sativa [gold-of-pleasure]
ref|XP_009395860.1|  PREDICTED: probable serine/threonine-protein...    338   1e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK25181.1|  hypothetical protein AALP_AA8G077200                    337   1e-111   Arabis alpina [alpine rockcress]
gb|KJB06908.1|  hypothetical protein B456_001G066000                    337   1e-111   Gossypium raimondii
ref|XP_011072928.1|  PREDICTED: probable serine/threonine-protein...    337   1e-111   Sesamum indicum [beniseed]
ref|NP_001267650.1|  serine/threonine-protein kinase 16-like            337   2e-111   Cucumis sativus [cucumbers]
gb|KJB51100.1|  hypothetical protein B456_008G201200                    337   2e-111   Gossypium raimondii
gb|AAM65833.1|  serine/threonine protein kinase                         336   4e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396202.1|  PREDICTED: probable serine/threonine-protein...    336   4e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155191.1|  hypothetical protein PHAVU_003G181000g             336   4e-111   Phaseolus vulgaris [French bean]
ref|XP_009346448.1|  PREDICTED: serine/threonine-protein kinase 1...    335   6e-111   Pyrus x bretschneideri [bai li]
ref|XP_008356645.1|  PREDICTED: serine/threonine-protein kinase 1...    335   7e-111   Malus domestica [apple tree]
ref|XP_008367568.1|  PREDICTED: serine/threonine-protein kinase 1...    335   1e-110   
ref|XP_008393382.1|  PREDICTED: serine/threonine-protein kinase 16      334   1e-110   
emb|CDY21515.1|  BnaC09g47770D                                          334   2e-110   Brassica napus [oilseed rape]
ref|XP_010261723.1|  PREDICTED: serine/threonine-protein kinase 1...    334   2e-110   Nelumbo nucifera [Indian lotus]
ref|XP_006485732.1|  PREDICTED: serine/threonine-protein kinase 1...    334   2e-110   Citrus sinensis [apfelsine]
emb|CDX69971.1|  BnaA10g23200D                                          333   4e-110   
ref|XP_008360890.1|  PREDICTED: serine/threonine-protein kinase 1...    333   6e-110   
ref|XP_009337751.1|  PREDICTED: serine/threonine-protein kinase 1...    330   6e-109   Pyrus x bretschneideri [bai li]
emb|CDY67889.1|  BnaAnng25480D                                          330   1e-108   Brassica napus [oilseed rape]
emb|CDY70989.1|  BnaC03g71390D                                          330   1e-108   Brassica napus [oilseed rape]
ref|XP_009131040.1|  PREDICTED: probable serine/threonine-protein...    330   1e-108   Brassica rapa
emb|CDY44759.1|  BnaC02g01280D                                          328   4e-108   Brassica napus [oilseed rape]
ref|XP_008797567.1|  PREDICTED: probable serine/threonine-protein...    328   5e-108   Phoenix dactylifera
gb|EPS69990.1|  hypothetical protein M569_04770                         328   6e-108   Genlisea aurea
ref|XP_009125719.1|  PREDICTED: serine/threonine-protein kinase 1...    327   1e-107   Brassica rapa
ref|XP_010678394.1|  PREDICTED: probable serine/threonine-protein...    327   2e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009597332.1|  PREDICTED: serine/threonine-protein kinase 1...    325   4e-107   Nicotiana tomentosiformis
ref|XP_010929080.1|  PREDICTED: probable serine/threonine-protein...    325   5e-107   Elaeis guineensis
gb|KJB19470.1|  hypothetical protein B456_003G104700                    325   7e-107   Gossypium raimondii
ref|XP_010942233.1|  PREDICTED: serine/threonine-protein kinase 1...    324   2e-106   Elaeis guineensis
ref|XP_009798655.1|  PREDICTED: serine/threonine-protein kinase 1...    323   6e-106   Nicotiana sylvestris
ref|XP_006661175.1|  PREDICTED: serine/threonine-protein kinase 1...    320   1e-105   
ref|XP_008804427.1|  PREDICTED: probable serine/threonine-protein...    318   3e-104   Phoenix dactylifera
ref|XP_008804428.1|  PREDICTED: probable serine/threonine-protein...    318   4e-104   Phoenix dactylifera
ref|NP_001063027.1|  Os09g0372800                                       317   5e-104   
ref|XP_008783057.1|  PREDICTED: probable serine/threonine-protein...    318   6e-104   Phoenix dactylifera
ref|XP_008783056.1|  PREDICTED: probable serine/threonine-protein...    317   8e-104   Phoenix dactylifera
ref|XP_004956690.1|  PREDICTED: probable serine/threonine-protein...    317   9e-104   Setaria italica
gb|ADE75600.1|  unknown                                                 311   9e-104   Picea sitchensis
ref|XP_004956689.1|  PREDICTED: probable serine/threonine-protein...    317   1e-103   Setaria italica
ref|XP_006844169.1|  hypothetical protein AMTR_s00006p00262500          315   4e-103   Amborella trichopoda
ref|XP_006345347.1|  PREDICTED: serine/threonine-protein kinase 1...    314   9e-103   Solanum tuberosum [potatoes]
ref|XP_010905766.1|  PREDICTED: probable serine/threonine-protein...    314   1e-102   Elaeis guineensis
ref|XP_010905763.1|  PREDICTED: probable serine/threonine-protein...    314   1e-102   Elaeis guineensis
ref|XP_004252263.1|  PREDICTED: probable serine/threonine-protein...    312   5e-102   Solanum lycopersicum
gb|EMS68366.1|  Serine/threonine-protein kinase 16                      309   9e-101   Triticum urartu
ref|XP_008650962.1|  PREDICTED: LOC100194392 isoform X1                 308   4e-100   Zea mays [maize]
ref|NP_001132895.1|  LOC100194392                                       308   4e-100   Zea mays [maize]
gb|ACG33051.1|  serine/threonine-protein kinase 16                      307   4e-100   Zea mays [maize]
ref|XP_010238122.1|  PREDICTED: serine/threonine-protein kinase 1...    306   1e-99    Brachypodium distachyon [annual false brome]
ref|XP_010238123.1|  PREDICTED: serine/threonine-protein kinase 1...    306   1e-99    Brachypodium distachyon [annual false brome]
gb|KHG26284.1|  Serine/threonine-protein kinase ppk13                   300   1e-99    Gossypium arboreum [tree cotton]
gb|EPS73700.1|  hypothetical protein M569_01056                         305   2e-99    Genlisea aurea
ref|XP_008783059.1|  PREDICTED: probable serine/threonine-protein...    303   2e-98    Phoenix dactylifera
gb|ABB72838.1|  serine/threonine kinase                                 291   2e-93    Elaeis guineensis
ref|XP_010237321.1|  PREDICTED: probable serine/threonine-protein...    281   1e-89    Brachypodium distachyon [annual false brome]
gb|EMS65453.1|  Serine/threonine-protein kinase 16                      277   1e-88    Triticum urartu
dbj|BAJ95332.1|  predicted protein                                      277   5e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87464.1|  predicted protein                                      276   1e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004956402.1|  PREDICTED: probable serine/threonine-protein...    276   1e-87    Setaria italica
ref|XP_006661044.1|  PREDICTED: serine/threonine-protein kinase 1...    280   2e-87    
ref|NP_001062642.1|  Os09g0237600                                       275   5e-87    
gb|EMT14968.1|  Serine/threonine-protein kinase 16                      274   1e-86    
gb|EAZ08255.1|  hypothetical protein OsI_30510                          273   2e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_001779469.1|  predicted protein                                  266   6e-84    
ref|XP_008668044.1|  PREDICTED: serine/threonine-protein kinase 1...    267   6e-84    Zea mays [maize]
ref|NP_001149977.1|  serine/threonine-protein kinase 16                 267   6e-84    Zea mays [maize]
ref|XP_002991279.1|  hypothetical protein SELMODRAFT_185952             247   2e-76    
ref|XP_002991218.1|  hypothetical protein SELMODRAFT_133041             245   1e-75    
gb|ACN26380.1|  unknown                                                 216   9e-65    Zea mays [maize]
ref|XP_007037719.1|  Serine/threonine protein kinase 3 isoform 3        214   2e-64    
ref|XP_007037718.1|  Serine/threonine protein kinase 3 isoform 2        213   3e-64    
ref|XP_008453331.1|  PREDICTED: serine/threonine-protein kinase 1...    213   8e-64    Cucumis melo [Oriental melon]
ref|XP_008453330.1|  PREDICTED: serine/threonine-protein kinase 1...    212   3e-63    Cucumis melo [Oriental melon]
gb|KJB19474.1|  hypothetical protein B456_003G104700                    209   1e-62    Gossypium raimondii
ref|XP_008351873.1|  PREDICTED: serine/threonine-protein kinase 1...    209   1e-62    
emb|CDH56229.1|  serine threonine protein                               169   6e-46    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS09297.1|  hypothetical protein LRAMOSA10657                      169   7e-46    Lichtheimia ramosa
gb|KJE97963.1|  NAK protein kinase                                      161   8e-44    Capsaspora owczarzaki ATCC 30864
ref|XP_004342629.1|  serine/threonine protein kinase                    162   1e-43    Capsaspora owczarzaki ATCC 30864
emb|CEP11100.1|  hypothetical protein                                   159   9e-43    Parasitella parasitica
gb|EPB91820.1|  NAK protein kinase                                      158   5e-42    Mucor circinelloides f. circinelloides 1006PhL
gb|EPB88047.1|  NAK protein kinase                                      157   7e-42    Mucor circinelloides f. circinelloides 1006PhL
gb|ESA00209.1|  hypothetical protein GLOINDRAFT_338668                  156   2e-41    
dbj|GAN07621.1|  pkinase-domain-containing protein                      152   7e-40    Mucor ambiguus
gb|KFM72644.1|  Serine/threonine-protein kinase 16                      147   4e-38    Stegodyphus mimosarum
ref|XP_004348721.1|  serine/threonine protein kinase                    146   4e-38    Acanthamoeba castellanii str. Neff
gb|KFH73600.1|  NAK protein kinase                                      148   5e-38    Mortierella verticillata NRRL 6337
emb|CEG84388.1|  Putative NAK protein kinase                            143   1e-37    Rhizopus microsporus
ref|XP_004622575.1|  PREDICTED: serine/threonine-protein kinase 1...    141   2e-37    Sorex araneus [Eurasian shrew]
ref|XP_500508.1|  YALI0B04840p                                          145   3e-37    Yarrowia lipolytica CLIB122
dbj|GAM27617.1|  hypothetical protein SAMD00019534_107930               143   6e-37    Acytostelium subglobosum LB1
ref|XP_005096441.1|  PREDICTED: serine/threonine-protein kinase 1...    142   1e-36    Aplysia californica
dbj|GAA94070.1|  hypothetical protein E5Q_00717                         144   3e-36    Mixia osmundae IAM 14324
dbj|GAN03135.1|  Ser/Thr protein kinase                                 142   6e-36    Mucor ambiguus
ref|XP_009045048.1|  hypothetical protein LOTGIDRAFT_223991             140   9e-36    Lottia gigantea
gb|ENN77639.1|  hypothetical protein YQE_05933                          139   2e-35    Dendroctonus ponderosae
emb|CEP08159.1|  hypothetical protein                                   138   4e-35    Parasitella parasitica
emb|CEP18224.1|  hypothetical protein                                   144   4e-35    Parasitella parasitica
ref|XP_011273085.1|  SNF1-related protein kinase catalytic subuni...    140   5e-35    Wickerhamomyces ciferrii
gb|EFA83040.1|  putative protein serine/threonine kinase                138   6e-35    Heterostelium album PN500
ref|XP_002504178.1|  serine/threonine-protein kinase                    139   7e-35    Micromonas commoda
dbj|GAN05866.1|  pkinase-domain-containing protein                      138   9e-35    Mucor ambiguus
ref|XP_002838172.1|  hypothetical protein                               139   1e-34    Tuber melanosporum Mel28
gb|KIY64992.1|  Pkinase-domain-containing protein                       138   2e-34    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_006563128.1|  PREDICTED: serine/threonine-protein kinase 1...    135   6e-34    Apis mellifera [bee]
gb|KJA16857.1|  hypothetical protein HYPSUDRAFT_46891                   137   7e-34    Hypholoma sublateritium FD-334 SS-4
gb|KIO15191.1|  hypothetical protein M404DRAFT_991904                   137   7e-34    Pisolithus tinctorius Marx 270
ref|XP_003485183.1|  PREDICTED: serine/threonine-protein kinase 1...    135   7e-34    Bombus impatiens
gb|ACU19230.1|  unknown                                                 133   8e-34    Glycine max [soybeans]
ref|XP_007402665.1|  hypothetical protein PHACADRAFT_266143             135   1e-33    Phanerochaete carnosa HHB-10118-sp
gb|KHJ34990.1|  putative serine threonine protein kinase                136   1e-33    Erysiphe necator
ref|XP_006440850.1|  hypothetical protein CICLE_v10021674mg             132   1e-33    
gb|EWM24320.1|  serine threonine protein kinase                         136   1e-33    Nannochloropsis gaditana
ref|XP_006440851.1|  hypothetical protein CICLE_v10021674mg             134   1e-33    
gb|EPB88470.1|  NAK protein kinase                                      135   1e-33    Mucor circinelloides f. circinelloides 1006PhL
gb|EIE83144.1|  hypothetical protein RO3G_07849                         130   1e-33    Rhizopus delemar RA 99-880
ref|XP_008543942.1|  PREDICTED: serine/threonine-protein kinase 16      134   1e-33    Microplitis demolitor
ref|XP_006616705.1|  PREDICTED: serine/threonine-protein kinase 1...    134   1e-33    Apis dorsata [rock honeybee]
ref|XP_004358442.1|  putative protein serine/threonine kinase           134   2e-33    Cavenderia fasciculata
ref|XP_003694450.1|  PREDICTED: serine/threonine-protein kinase 1...    134   2e-33    Apis florea [dwarf honeybee]
gb|KIK66664.1|  hypothetical protein GYMLUDRAFT_157468                  136   2e-33    Gymnopus luxurians FD-317 M1
ref|XP_003708300.1|  PREDICTED: serine/threonine-protein kinase 1...    134   2e-33    Megachile rotundata
ref|XP_426593.1|  PREDICTED: serine/threonine-protein kinase 16 i...    133   3e-33    Gallus gallus [bantam]
ref|XP_005848000.1|  hypothetical protein CHLNCDRAFT_145529             135   4e-33    Chlorella variabilis
ref|XP_007777376.1|  NAK protein kinase                                 135   4e-33    Coniosporium apollinis CBS 100218
ref|XP_011140913.1|  PREDICTED: serine/threonine-protein kinase 1...    133   5e-33    Harpegnathos saltator
ref|XP_011140914.1|  PREDICTED: serine/threonine-protein kinase 1...    133   5e-33    Harpegnathos saltator
ref|XP_006884670.1|  PREDICTED: serine/threonine-protein kinase 1...    131   5e-33    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KFW80140.1|  Serine/threonine-protein kinase 16                      132   5e-33    Manacus vitellinus
ref|XP_008076868.1|  Protein kinase-like (PK-like)                      134   5e-33    Glarea lozoyensis ATCC 20868
gb|EPS96122.1|  hypothetical protein FOMPIDRAFT_1167839                 135   6e-33    Fomitopsis pinicola FP-58527 SS1
ref|XP_003287685.1|  hypothetical protein DICPUDRAFT_78515              132   6e-33    Dictyostelium purpureum
ref|XP_001231623.1|  PREDICTED: serine/threonine-protein kinase 1...    132   7e-33    
gb|KDQ19325.1|  hypothetical protein BOTBODRAFT_184376                  135   7e-33    Botryobasidium botryosum FD-172 SS1
ref|XP_008921223.1|  PREDICTED: serine/threonine-protein kinase 16      132   7e-33    
ref|XP_010128957.1|  PREDICTED: serine/threonine-protein kinase 16      130   7e-33    Chlamydotis macqueenii
gb|KDR78818.1|  hypothetical protein GALMADRAFT_1271408                 134   7e-33    Galerina marginata CBS 339.88
gb|KIY43898.1|  kinase-like protein                                     133   7e-33    Fistulina hepatica ATCC 64428
gb|KFP39383.1|  Serine/threonine-protein kinase 16                      129   7e-33    Chlamydotis macqueenii
gb|KDN40698.1|  Pkinase-domain-containing protein                       134   8e-33    Tilletiaria anomala UBC 951
ref|XP_007263188.1|  other/NAK protein kinase                           134   8e-33    Fomitiporia mediterranea MF3/22
ref|XP_011456099.1|  PREDICTED: serine/threonine-protein kinase 1...    132   9e-33    Crassostrea gigas
gb|KDR07799.1|  Serine/threonine-protein kinase 16                      132   9e-33    Zootermopsis nevadensis
ref|XP_007393556.1|  hypothetical protein PHACADRAFT_252405             133   1e-32    Phanerochaete carnosa HHB-10118-sp
ref|XP_003031576.1|  hypothetical protein SCHCODRAFT_76377              134   1e-32    Schizophyllum commune H4-8
emb|CDH53858.1|  other nak protein kinase                               133   1e-32    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001732295.1|  hypothetical protein MGL_0070                      132   1e-32    Malassezia globosa CBS 7966
gb|KFO72172.1|  Serine/threonine-protein kinase 16                      131   1e-32    Cuculus canorus
ref|XP_011049589.1|  PREDICTED: serine/threonine-protein kinase 1...    130   1e-32    Acromyrmex echinatior
gb|KIJ52504.1|  hypothetical protein M422DRAFT_223049                   134   1e-32    Sphaerobolus stellatus SS14
emb|CDR44020.1|  CYFA0S13e01706g1_1                                     133   1e-32    Cyberlindnera fabianii
gb|ACO15455.1|  Serine/threonine-protein kinase 16                      132   2e-32    Caligus clemensi
ref|XP_009553933.1|  PREDICTED: serine/threonine-protein kinase 16      130   2e-32    Cuculus canorus
ref|XP_007362345.1|  Pkinase-domain-containing protein                  133   2e-32    Dichomitus squalens LYAD-421 SS1
gb|KIO26332.1|  hypothetical protein M407DRAFT_15093                    133   3e-32    Tulasnella calospora MUT 4182
ref|XP_008467843.1|  PREDICTED: serine/threonine-protein kinase 16      131   3e-32    Diaphorina citri
emb|CDH51862.1|  serine threonine protein kinase                        132   3e-32    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_782009.2|  PREDICTED: serine/threonine-protein kinase 16-like    127   4e-32    
ref|XP_003060182.1|  predicted protein                                  132   4e-32    Micromonas pusilla CCMP1545
ref|XP_004617190.1|  PREDICTED: serine/threonine-protein kinase 16      130   4e-32    Sorex araneus [Eurasian shrew]
ref|XP_011049586.1|  PREDICTED: serine/threonine-protein kinase 1...    130   4e-32    Acromyrmex echinatior
gb|KIM36166.1|  hypothetical protein M413DRAFT_449359                   132   4e-32    Hebeloma cylindrosporum h7
gb|EJU04981.1|  Pkinase-domain-containing protein                       132   4e-32    Dacryopinax primogenitus
gb|KIN04003.1|  hypothetical protein OIDMADRAFT_143466                  132   5e-32    Oidiodendron maius Zn
ref|XP_007383154.1|  Pkinase-domain-containing protein                  132   5e-32    Punctularia strigosozonata HHB-11173 SS5
gb|KII85212.1|  hypothetical protein PLICRDRAFT_166831                  132   5e-32    Plicaturopsis crispa FD-325 SS-3
ref|XP_006955764.1|  kinase-like protein                                130   5e-32    Wallemia mellicola CBS 633.66
gb|EMD31340.1|  hypothetical protein CERSUDRAFT_119907                  132   5e-32    Gelatoporia subvermispora B
ref|XP_007880653.1|  hypothetical protein PFL1_04932                    132   6e-32    Anthracocystis flocculosa PF-1
gb|KIJ13415.1|  hypothetical protein PAXINDRAFT_170488                  132   6e-32    Paxillus involutus ATCC 200175
gb|KIY96099.1|  serine/threonine kinase 16                              132   6e-32    Monoraphidium neglectum
gb|EST04777.1|  Protein kinase                                          132   6e-32    Kalmanozyma brasiliensis GHG001
gb|ETS59570.1|  hypothetical protein PaG_06492                          132   6e-32    Moesziomyces aphidis DSM 70725
dbj|GAC72100.1|  serine/threonine protein kinase                        132   6e-32    Moesziomyces antarcticus T-34
ref|XP_001836285.1|  other/NAK protein kinase                           131   7e-32    Coprinopsis cinerea okayama7#130
gb|AEE60827.1|  serine/threonine kinase                                 129   8e-32    Haemaphysalis longicornis
gb|EMS19970.1|  serine/threonine-protein kinase                         131   9e-32    Rhodotorula toruloides NP11
emb|CCA71061.1|  related to Prk1p                                       131   1e-31    Serendipita indica DSM 11827
ref|XP_796127.2|  PREDICTED: serine/threonine-protein kinase 16-like    129   1e-31    
ref|XP_003377990.1|  serine/threonine-protein kinase 16                 129   1e-31    Trichinella spiralis
dbj|GAK65304.1|  pkinase-domain-containing protein                      131   1e-31    Moesziomyces antarcticus
gb|KFU88495.1|  Serine/threonine-protein kinase 16                      128   1e-31    Chaetura pelagica
ref|XP_001795102.1|  hypothetical protein SNOG_04689                    130   2e-31    Parastagonospora nodorum SN15
gb|KIK16096.1|  hypothetical protein PISMIDRAFT_277244                  130   2e-31    Pisolithus microcarpus 441
gb|KJB19471.1|  hypothetical protein B456_003G104700                    127   2e-31    Gossypium raimondii
ref|XP_004196658.1|  Piso0_003883                                       129   2e-31    
ref|XP_005676997.1|  PREDICTED: serine/threonine-protein kinase 1...    127   2e-31    
emb|CCM04252.1|  predicted protein                                      130   2e-31    Fibroporia radiculosa
emb|CDS07418.1|  hypothetical protein LRAMOSA01367                      130   2e-31    Lichtheimia ramosa
gb|KIK10008.1|  hypothetical protein K443DRAFT_136030                   130   2e-31    Laccaria amethystina LaAM-08-1
gb|KDQ24429.1|  hypothetical protein PLEOSDRAFT_1094292                 130   2e-31    Pleurotus ostreatus PC15
ref|XP_009994572.1|  PREDICTED: serine/threonine-protein kinase 16      128   2e-31    Chaetura pelagica
ref|XP_007846682.1|  nak protein kinase                                 130   2e-31    
dbj|GAC94527.1|  likely protein kinase                                  130   2e-31    Pseudozyma hubeiensis SY62
ref|XP_007677906.1|  hypothetical protein BAUCODRAFT_541809             130   2e-31    Baudoinia panamericana UAMH 10762
ref|XP_010582413.1|  PREDICTED: serine/threonine-protein kinase 16      128   3e-31    Haliaeetus leucocephalus
gb|KDE05248.1|  NAK protein kinase                                      130   3e-31    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_009080397.1|  PREDICTED: serine/threonine-protein kinase 16      127   3e-31    Acanthisitta chloris
ref|XP_007300066.1|  Pkinase-domain-containing protein                  130   3e-31    Stereum hirsutum FP-91666 SS1
gb|KIW07925.1|  hypothetical protein PV09_01833                         129   3e-31    Verruconis gallopava
gb|EMC84229.1|  Serine/threonine-protein kinase 16                      127   3e-31    
gb|EEQ47177.1|  conserved hypothetical protein                          129   4e-31    Candida albicans WO-1
ref|XP_006459060.1|  hypothetical protein AGABI2DRAFT_191128            129   4e-31    Agaricus bisporus var. bisporus H97
ref|XP_007331420.1|  hypothetical protein AGABI1DRAFT_114902            129   4e-31    Agaricus bisporus var. burnettii JB137-S8
ref|XP_005498658.1|  PREDICTED: serine/threonine-protein kinase 16      127   4e-31    
gb|KIM84342.1|  hypothetical protein PILCRDRAFT_6588                    129   4e-31    Piloderma croceum F 1598
ref|XP_011255230.1|  PREDICTED: serine/threonine-protein kinase 16      128   4e-31    Camponotus floridanus
gb|KHC45647.1|  serine/threonine kinase 16                              129   4e-31    Candida albicans P60002
gb|KGU03752.1|  serine/threonine kinase 16                              129   4e-31    Candida albicans 19F
gb|KGQ83728.1|  serine/threonine kinase 16                              129   4e-31    Candida albicans P37005
ref|XP_715213.1|  potential protein kinase                              129   4e-31    Candida albicans SC5314
ref|NP_001039720.1|  serine/threonine-protein kinase 16                 127   4e-31    Bos taurus [bovine]
gb|KIK42062.1|  hypothetical protein CY34DRAFT_84225                    129   4e-31    Suillus luteus UH-Slu-Lm8-n1
ref|XP_011496748.1|  PREDICTED: serine/threonine-protein kinase 16      128   5e-31    Ceratosolen solmsi marchali
ref|XP_001561379.1|  hypothetical protein BC1G_00464                    129   5e-31    Botrytis cinerea B05.10
gb|KHJ43806.1|  kinase domain protein                                   128   5e-31    Trichuris suis
gb|KIL64445.1|  hypothetical protein M378DRAFT_78338                    129   5e-31    Amanita muscaria Koide BX008
ref|XP_002111200.1|  hypothetical protein TRIADDRAFT_54919              127   5e-31    Trichoplax adhaerens
ref|XP_006168692.1|  PREDICTED: serine/threonine-protein kinase 1...    127   5e-31    Tupaia chinensis
ref|XP_005153910.1|  PREDICTED: serine/threonine-protein kinase 16      127   6e-31    Melopsittacus undulatus
ref|XP_007408730.1|  hypothetical protein MELLADRAFT_47963              129   6e-31    Melampsora larici-populina 98AG31
ref|XP_003485184.1|  PREDICTED: serine/threonine-protein kinase 1...    127   6e-31    
gb|KHC30713.1|  serine/threonine kinase 16                              128   6e-31    Candida albicans P76067
ref|XP_007765994.1|  other/NAK protein kinase                           129   6e-31    Coniophora puteana RWD-64-598 SS2
gb|KGR02488.1|  serine/threonine kinase 16                              128   6e-31    Candida albicans P57072
ref|XP_006890368.1|  PREDICTED: serine/threonine-protein kinase 16      127   6e-31    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003400721.1|  PREDICTED: serine/threonine-protein kinase 1...    127   7e-31    
emb|CDS03107.1|  hypothetical protein LRAMOSA00509                      128   7e-31    Lichtheimia ramosa
ref|XP_003299571.1|  hypothetical protein PTT_10595                     129   7e-31    
ref|XP_011297504.1|  PREDICTED: serine/threonine-protein kinase 16      127   7e-31    Fopius arisanus
gb|KEQ83345.1|  kinase-like protein                                     129   8e-31    
gb|EME38432.1|  hypothetical protein DOTSEDRAFT_181583                  129   8e-31    
ref|XP_007188026.1|  PREDICTED: serine/threonine-protein kinase 1...    127   8e-31    
ref|XP_007582065.1|  putative serine threonine protein                  128   8e-31    
ref|XP_010207916.1|  PREDICTED: serine/threonine-protein kinase 16      126   1e-30    
gb|KFV07253.1|  Serine/threonine-protein kinase 16                      126   1e-30    
gb|KIW55799.1|  hypothetical protein PV05_04522                         129   1e-30    
gb|KIM33499.1|  hypothetical protein M408DRAFT_155596                   129   1e-30    
ref|XP_008143361.1|  PREDICTED: serine/threonine-protein kinase 16      126   1e-30    
ref|XP_001605375.1|  PREDICTED: serine/threonine-protein kinase 16      127   1e-30    
ref|XP_007122498.1|  PREDICTED: serine/threonine-protein kinase 1...    126   1e-30    
ref|XP_007867650.1|  Pkinase-domain-containing protein                  128   1e-30    
ref|XP_005330559.1|  PREDICTED: serine/threonine-protein kinase 1...    126   1e-30    
ref|XP_974511.1|  PREDICTED: serine/threonine-protein kinase 16         127   1e-30    
ref|XP_004997989.1|  NAK/MPSK protein kinase                            126   1e-30    
gb|KIK99586.1|  hypothetical protein PAXRUDRAFT_30412                   128   1e-30    
ref|XP_001594653.1|  hypothetical protein SS1G_04461                    128   1e-30    
gb|ESW97552.1|  serine/threonine protein kinase                         129   1e-30    
gb|KFY18925.1|  hypothetical protein V491_04657                         128   1e-30    
gb|KIJ66924.1|  hypothetical protein HYDPIDRAFT_150022                  128   1e-30    
ref|XP_002421585.1|  protein kinase, putative                           127   1e-30    
emb|CDO74993.1|  hypothetical protein BN946_scf184945.g65               128   1e-30    
emb|CDI53247.1|  related to Prk1p                                       128   1e-30    
ref|XP_009943589.1|  PREDICTED: serine/threonine-protein kinase 1...    123   1e-30    
ref|XP_011388521.1|  hypothetical protein UMAG_02168                    128   1e-30    
ref|XP_006207296.1|  PREDICTED: serine/threonine-protein kinase 16      126   1e-30    
ref|XP_006186928.1|  PREDICTED: serine/threonine-protein kinase 16      126   1e-30    
ref|XP_005883518.1|  PREDICTED: serine/threonine-protein kinase 1...    126   1e-30    
ref|XP_006763422.1|  PREDICTED: serine/threonine-protein kinase 1...    126   1e-30    
gb|KFQ84876.1|  Serine/threonine-protein kinase 16                      125   1e-30    
ref|XP_006272740.1|  PREDICTED: serine/threonine-protein kinase 16      124   1e-30    
ref|XP_010986670.1|  PREDICTED: serine/threonine-protein kinase 1...    126   2e-30    
ref|XP_008290775.1|  PREDICTED: serine/threonine-protein kinase 16      126   2e-30    
ref|XP_006082607.1|  PREDICTED: serine/threonine-protein kinase 1...    126   2e-30    
gb|KGQ82356.1|  serine/threonine kinase 16                              127   2e-30    
gb|KJB19472.1|  hypothetical protein B456_003G104700                    124   2e-30    
ref|XP_010297114.1|  PREDICTED: serine/threonine-protein kinase 16      125   2e-30    
emb|CCF52278.1|  related to Prk1p                                       128   2e-30    
ref|XP_009159379.1|  serine/threonine kinase 16                         128   2e-30    
ref|XP_011347896.1|  PREDICTED: serine/threonine-protein kinase 1...    125   2e-30    
gb|KFP03300.1|  Serine/threonine-protein kinase 16                      125   2e-30    
ref|XP_003838791.1|  similar to serine/threonine protein kinase         127   2e-30    
gb|KIP04401.1|  hypothetical protein PHLGIDRAFT_31384                   128   2e-30    
ref|XP_007319103.1|  protein kinase                                     127   2e-30    
gb|KEQ67082.1|  kinase-like protein                                     127   2e-30    
gb|KIM67589.1|  hypothetical protein SCLCIDRAFT_107618                  127   2e-30    
ref|XP_008023611.1|  hypothetical protein SETTUDRAFT_176381             127   2e-30    
ref|XP_001928241.1|  PREDICTED: serine/threonine-protein kinase 1...    125   2e-30    
gb|EGN98856.1|  hypothetical protein SERLA73DRAFT_181545                127   2e-30    
ref|XP_011347895.1|  PREDICTED: serine/threonine-protein kinase 1...    126   2e-30    
gb|KFQ21980.1|  Serine/threonine-protein kinase 16                      125   2e-30    
ref|XP_010022965.1|  PREDICTED: serine/threonine-protein kinase 16      125   2e-30    
ref|XP_005485280.1|  PREDICTED: serine/threonine-protein kinase 1...    125   2e-30    
ref|XP_007689020.1|  hypothetical protein COCMIDRAFT_6255               127   2e-30    
ref|XP_009990823.1|  PREDICTED: serine/threonine-protein kinase 16      125   3e-30    
gb|ELT94510.1|  hypothetical protein CAPTEDRAFT_162050                  125   3e-30    
gb|KIW47890.1|  hypothetical protein PV06_00544                         127   3e-30    
ref|XP_005889744.1|  PREDICTED: serine/threonine-protein kinase 16      125   3e-30    
ref|XP_005447410.1|  PREDICTED: serine/threonine-protein kinase 1...    125   3e-30    
ref|XP_002195709.1|  PREDICTED: serine/threonine-protein kinase 16      125   3e-30    
ref|XP_002549719.1|  hypothetical protein CTRG_04016                    126   3e-30    
ref|XP_004005479.1|  PREDICTED: serine/threonine-protein kinase 16      125   3e-30    
ref|XP_010859537.1|  PREDICTED: serine/threonine-protein kinase 1...    125   3e-30    
ref|XP_005702234.1|  PREDICTED: serine/threonine-protein kinase 16      125   3e-30    
ref|XP_008495252.1|  PREDICTED: serine/threonine-protein kinase 16      125   3e-30    
ref|XP_007344791.1|  other/NAK protein kinase                           127   3e-30    
ref|XP_001162451.1|  PREDICTED: serine/threonine-protein kinase 1...    125   3e-30    
gb|KFP54820.1|  Serine/threonine-protein kinase 16                      124   3e-30    
ref|XP_002619831.1|  hypothetical protein CLUG_00990                    126   3e-30    
ref|XP_003818698.1|  PREDICTED: serine/threonine-protein kinase 1...    125   3e-30    
ref|XP_002954912.1|  hypothetical protein VOLCADRAFT_118882             127   3e-30    
emb|CCU78988.1|  serine/threonine protein kinase                        126   3e-30    
gb|KEQ91137.1|  hypothetical protein AUEXF2481DRAFT_70276               127   4e-30    
ref|XP_004262741.1|  PREDICTED: serine/threonine-protein kinase 16      125   4e-30    
emb|CDK27022.1|  unnamed protein product                                126   4e-30    
ref|XP_009909459.1|  PREDICTED: serine/threonine-protein kinase 16      124   4e-30    
gb|EKG22262.1|  hypothetical protein MPH_00441                          127   4e-30    
ref|XP_005794443.1|  hypothetical protein EMIHUDRAFT_431902             125   4e-30    
ref|XP_005234412.1|  PREDICTED: serine/threonine-protein kinase 16      125   4e-30    
gb|EMD94299.1|  hypothetical protein COCHEDRAFT_1130806                 126   4e-30    
ref|XP_009086158.1|  PREDICTED: serine/threonine-protein kinase 16      125   4e-30    
ref|XP_007701506.1|  hypothetical protein COCSADRAFT_120619             126   4e-30    
emb|CBQ72723.1|  related to Prk1p                                       127   4e-30    
dbj|GAD94105.1|  serine/threonine protein kinase, putative              130   4e-30    
gb|KFV63390.1|  Serine/threonine-protein kinase 16                      124   4e-30    
gb|KFW67669.1|  Serine/threonine-protein kinase 16                      124   5e-30    
gb|KIW16851.1|  hypothetical protein PV08_04041                         127   5e-30    
ref|XP_003765963.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    124   5e-30    
gb|KFP21606.1|  Serine/threonine-protein kinase 16                      124   5e-30    
gb|KFQ18225.1|  Serine/threonine-protein kinase 16                      124   5e-30    
gb|KEY78331.1|  serine threoninee protein kinase                        126   6e-30    
ref|XP_747273.1|  serine/threonine protein kinase                       126   6e-30    
ref|XP_008714211.1|  hypothetical protein HMPREF1541_01631              126   6e-30    
gb|KFQ94697.1|  Serine/threonine-protein kinase 16                      124   6e-30    
ref|XP_002431917.1|  serine/threonine-protein kinase, putative          125   6e-30    
ref|XP_010180444.1|  PREDICTED: serine/threonine-protein kinase 16      124   6e-30    
gb|EPS31343.1|  hypothetical protein PDE_06298                          126   6e-30    
ref|XP_005416123.1|  PREDICTED: serine/threonine-protein kinase 16      124   6e-30    
ref|XP_008039622.1|  Pkinase-domain-containing protein                  126   6e-30    
gb|ACN94704.1|  GA11523                                                 125   6e-30    
ref|XP_009442628.1|  PREDICTED: serine/threonine-protein kinase 1...    125   7e-30    
gb|KFM04617.1|  Serine/threonine-protein kinase 16                      124   7e-30    
ref|XP_001359753.1|  GA11523                                            124   7e-30    
ref|XP_003784978.1|  PREDICTED: serine/threonine-protein kinase 16      124   7e-30    
ref|XP_007501739.1|  PREDICTED: serine/threonine-protein kinase 1...    124   7e-30    
ref|XP_007068750.1|  PREDICTED: serine/threonine-protein kinase 16      125   7e-30    
emb|CCX16347.1|  Similar to Serine/threonine-protein kinase ppk13...    125   8e-30    
ref|XP_003341897.1|  PREDICTED: serine/threonine-protein kinase 1...    124   8e-30    
ref|XP_006684319.1|  kinase-like protein                                125   8e-30    
ref|XP_009273290.1|  PREDICTED: serine/threonine-protein kinase 16      124   8e-30    
gb|ESZ99238.1|  serine/threonine protein kinase                         125   8e-30    
ref|XP_008906617.1|  NAK/MPSK protein kinase                            125   9e-30    
ref|XP_008936789.1|  PREDICTED: serine/threonine-protein kinase 16      124   9e-30    
ref|XP_009323148.1|  PREDICTED: serine/threonine-protein kinase 16      124   9e-30    
ref|XP_007279829.1|  serine threonine protein                           125   9e-30    
ref|XP_002129344.2|  PREDICTED: serine/threonine-protein kinase 1...    124   9e-30    
gb|KGL86421.1|  Serine/threonine-protein kinase 16                      123   9e-30    
gb|EPQ64769.1|  protein kinase                                          125   9e-30    
ref|XP_009545416.1|  hypothetical protein HETIRDRAFT_316384             125   9e-30    
gb|EMP27432.1|  Serine/threonine-protein kinase 16                      124   9e-30    
ref|XP_007735266.1|  NAK protein kinase                                 125   9e-30    
ref|XP_006059051.1|  PREDICTED: serine/threonine-protein kinase 1...    124   1e-29    
ref|XP_004662965.1|  PREDICTED: serine/threonine-protein kinase 16      124   1e-29    
gb|KFY73016.1|  hypothetical protein V499_06873                         125   1e-29    
ref|XP_003852606.1|  hypothetical protein MYCGRDRAFT_72191              125   1e-29    
gb|EHK15647.1|  hypothetical protein TRIVIDRAFT_38891                   125   1e-29    
gb|KEQ69246.1|  kinase-like protein                                     125   1e-29    
ref|XP_006679528.1|  hypothetical protein BATDEDRAFT_33346              125   1e-29    
ref|XP_006059053.1|  PREDICTED: serine/threonine-protein kinase 1...    123   1e-29    
emb|CDW55328.1|  Cullin Nedd8 and Glyco transf 25 and Pkinase and...    129   1e-29    
gb|KFY24413.1|  hypothetical protein V493_05252                         125   1e-29    
gb|KFV05926.1|  Serine/threonine-protein kinase 16                      122   1e-29    
ref|XP_002749858.1|  PREDICTED: serine/threonine-protein kinase 1...    124   1e-29    
gb|EQB48009.1|  hypothetical protein CGLO_12786                         125   1e-29    
ref|XP_001938210.1|  serine/threonine kinase 16                         125   1e-29    
ref|XP_005985203.1|  PREDICTED: serine/threonine-protein kinase 1...    124   1e-29    
ref|XP_001953233.1|  GF17312                                            124   1e-29    
ref|XP_009643993.1|  PREDICTED: serine/threonine-protein kinase 16      123   1e-29    
ref|XP_005049571.1|  PREDICTED: serine/threonine-protein kinase 16      123   1e-29    
gb|KDD74513.1|  hypothetical protein H632_c1263p0                       125   2e-29    
ref|XP_004427642.1|  PREDICTED: serine/threonine-protein kinase 16      123   2e-29    
ref|XP_008823979.1|  PREDICTED: serine/threonine-protein kinase 1...    123   2e-29    
ref|XP_005070530.1|  PREDICTED: serine/threonine-protein kinase 1...    123   2e-29    
ref|XP_007913138.1|  putative serine threonine protein                  125   2e-29    
ref|NP_775165.1|  serine/threonine-protein kinase 16                    123   2e-29    
ref|XP_005519774.1|  PREDICTED: serine/threonine-protein kinase 16      123   2e-29    
ref|XP_007419861.1|  PREDICTED: serine/threonine-protein kinase 1...    122   2e-29    
gb|EMF10956.1|  serine/threonine protein kinase                         125   2e-29    
gb|KFO52754.1|  Serine/threonine-protein kinase 16                      122   2e-29    
ref|XP_009442627.1|  PREDICTED: serine/threonine-protein kinase 1...    124   2e-29    
ref|XP_008970245.1|  PREDICTED: serine/threonine-protein kinase 1...    124   2e-29    
ref|XP_007646375.1|  PREDICTED: serine/threonine-protein kinase 16      123   2e-29    
ref|XP_008626944.1|  PREDICTED: serine/threonine-protein kinase 16      122   2e-29    
ref|XP_003925562.1|  PREDICTED: serine/threonine-protein kinase 1...    123   2e-29    
gb|KFY01542.1|  hypothetical protein V490_00863                         124   2e-29    
gb|KFY49109.1|  hypothetical protein V495_00757                         124   3e-29    
ref|XP_010141236.1|  PREDICTED: serine/threonine-protein kinase 16      122   3e-29    
gb|KFR04467.1|  Serine/threonine-protein kinase 16                      122   3e-29    
ref|XP_004467828.1|  PREDICTED: serine/threonine-protein kinase 1...    122   3e-29    
ref|XP_001276576.1|  serine/threonine protein kinase, putative          124   3e-29    
ref|XP_001998688.1|  GI23494                                            123   3e-29    
ref|XP_009882411.1|  PREDICTED: serine/threonine-protein kinase 16      122   3e-29    
ref|XP_001262015.1|  serine/threonine protein kinase, putative          124   3e-29    
ref|XP_006008957.1|  PREDICTED: serine/threonine-protein kinase 16      122   3e-29    
ref|XP_007827188.1|  hypothetical protein PFICI_00416                   124   3e-29    
ref|XP_004376394.1|  PREDICTED: serine/threonine-protein kinase 16      122   3e-29    
ref|XP_003400720.1|  PREDICTED: serine/threonine-protein kinase 1...    122   3e-29    
ref|XP_005724188.1|  PREDICTED: serine/threonine-protein kinase 1...    122   3e-29    
gb|KFH47930.1|  Serine/threonine-protein kinase-like protein            124   3e-29    
ref|XP_006972221.1|  PREDICTED: serine/threonine-protein kinase 1...    122   3e-29    
ref|XP_011356864.1|  PREDICTED: serine/threonine-protein kinase 16      122   3e-29    
ref|XP_010728226.1|  PREDICTED: serine/threonine-protein kinase 16      122   3e-29    
ref|NP_001004792.1|  serine/threonine-protein kinase 16                 122   3e-29    
ref|XP_002070336.1|  GK11088                                            122   4e-29    
ref|XP_004674323.1|  PREDICTED: serine/threonine-protein kinase 16      122   4e-29    
ref|XP_005574406.1|  PREDICTED: serine/threonine-protein kinase 1...    122   4e-29    
ref|XP_006906757.1|  PREDICTED: serine/threonine-protein kinase 16      122   4e-29    
gb|ACO10919.1|  Serine/threonine-protein kinase 16                      122   4e-29    
ref|NP_001253902.1|  serine/threonine-protein kinase 16                 122   4e-29    
gb|KEF58800.1|  NAK protein kinase                                      124   4e-29    
ref|XP_010610139.1|  PREDICTED: serine/threonine-protein kinase 16      122   4e-29    
ref|XP_004876210.1|  PREDICTED: serine/threonine-protein kinase 1...    122   4e-29    
ref|NP_001008910.1|  serine/threonine-protein kinase 16                 122   4e-29    
ref|XP_006135689.1|  PREDICTED: serine/threonine-protein kinase 16      122   4e-29    
gb|AAV38392.1|  serine/threonine kinase 16                              122   4e-29    
ref|XP_009943604.1|  PREDICTED: serine/threonine-protein kinase 1...    122   4e-29    
ref|XP_002712533.1|  PREDICTED: serine/threonine-protein kinase 16      122   4e-29    
ref|XP_010884397.1|  PREDICTED: serine/threonine-protein kinase 16      122   4e-29    
gb|ERE86580.1|  serine/threonine-protein kinase 16-like protein         122   5e-29    
ref|XP_008528196.1|  PREDICTED: serine/threonine-protein kinase 1...    122   5e-29    
ref|XP_002056407.1|  GJ10245                                            122   5e-29    
ref|XP_009460438.1|  PREDICTED: serine/threonine-protein kinase 16      123   5e-29    
gb|KFQ05580.1|  Serine/threonine-protein kinase 16                      121   5e-29    
ref|XP_010405222.1|  PREDICTED: serine/threonine-protein kinase 16      122   5e-29    
ref|XP_001493234.1|  PREDICTED: serine/threonine-protein kinase 16      122   5e-29    
ref|XP_010148949.1|  PREDICTED: serine/threonine-protein kinase 16      120   5e-29    
gb|KFW04310.1|  Serine/threonine-protein kinase 16                      120   6e-29    
ref|XP_007519784.1|  PREDICTED: serine/threonine-protein kinase 16      122   6e-29    
tpe|CBF84937.1|  TPA: serine/threonine protein kinase, putative (...    123   6e-29    
ref|XP_004576867.1|  PREDICTED: serine/threonine-protein kinase 16      122   6e-29    
ref|XP_007419860.1|  PREDICTED: serine/threonine-protein kinase 1...    122   7e-29    
ref|XP_008308178.1|  PREDICTED: serine/threonine-protein kinase 16      122   7e-29    
ref|XP_010358600.1|  PREDICTED: serine/threonine-protein kinase 16      121   7e-29    
ref|XP_004529280.1|  PREDICTED: serine/threonine-protein kinase 1...    122   7e-29    
ref|XP_003445781.1|  PREDICTED: serine/threonine-protein kinase 1...    121   8e-29    
ref|NP_001087851.1|  serine/threonine kinase 16                         121   8e-29    
emb|CCF37894.1|  kinase                                                 119   8e-29    
ref|XP_007821888.1|  Protein kinase, ATP binding site                   123   8e-29    
ref|XP_009484253.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    119   8e-29    
gb|KFG80489.1|  putative serine/threonine protein kinase                123   8e-29    
gb|KID91187.1|  Protein kinase-like domain protein                      123   9e-29    
gb|KDQ59307.1|  hypothetical protein JAAARDRAFT_154656                  123   9e-29    
ref|XP_007807374.1|  serine/threonine protein kinase, putative          123   9e-29    
ref|XP_008688654.1|  PREDICTED: serine/threonine-protein kinase 1...    121   9e-29    
ref|XP_004762884.1|  PREDICTED: serine/threonine-protein kinase 1...    121   9e-29    
dbj|BAF85383.1|  unnamed protein product                                121   9e-29    
ref|XP_004638249.1|  PREDICTED: serine/threonine-protein kinase 16      121   9e-29    
gb|EMG47682.1|  hypothetical protein G210_1908                          122   9e-29    
gb|KFY08760.1|  hypothetical protein V492_05938                         126   9e-29    
ref|XP_007445878.1|  PREDICTED: serine/threonine-protein kinase 16      121   9e-29    
gb|KIR58761.1|  NAK protein kinase                                      122   1e-28    



>ref|XP_002269355.1| PREDICTED: serine/threonine-protein kinase 16 [Vitis vinifera]
 emb|CBI15371.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   349 bits (896),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ EP YAHNDVKPGNVLLTHRKGQPPLA+LMDFGSARPARKQIRSRSEA
Sbjct  162  RQLCAGLKHMHSLEPPYAHNDVKPGNVLLTHRKGQPPLAVLMDFGSARPARKQIRSRSEA  221

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  222  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  281

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQATVRP IDDI+IHVDKLI+KF 
Sbjct  282  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQATVRPRIDDIIIHVDKLIAKFL  340

Query  240  H  238
            H
Sbjct  341  H  341



>emb|CAN66918.1| hypothetical protein VITISV_043041 [Vitis vinifera]
Length=341

 Score =   349 bits (896),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ EP YAHNDVKPGNVLLTHRKGQPPLA+LMDFGSARPARKQIRSRSEA
Sbjct  162  RQLCAGLKHMHSLEPPYAHNDVKPGNVLLTHRKGQPPLAVLMDFGSARPARKQIRSRSEA  221

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  222  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  281

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQATVRP IDDI+IHVDKLI+KF 
Sbjct  282  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQATVRPRIDDIIIHVDKLIAKFL  340

Query  240  H  238
            H
Sbjct  341  H  341



>ref|XP_009766540.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Nicotiana sylvestris]
Length=342

 Score =   349 bits (895),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVLLTHRKGQPPLA+LMDFGS RPAR+QIRSRSEA
Sbjct  163  RQLCAGLKHMHSFDPPYAHNDVKPGNVLLTHRKGQPPLAVLMDFGSTRPARRQIRSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEHVSAPFRAPELWDCPS  DIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWASEHVSAPFRAPELWDCPSQCDIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQ TVRP IDDI+IHVDKLISKFS
Sbjct  283  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQGTVRPRIDDIIIHVDKLISKFS  341

Query  240  H  238
            H
Sbjct  342  H  342



>ref|XP_010031327.1| PREDICTED: serine/threonine-protein kinase 16 [Eucalyptus grandis]
 gb|KCW83786.1| hypothetical protein EUGRSUZ_B00658 [Eucalyptus grandis]
Length=345

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ EP YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPAR+QIRSRSEA
Sbjct  166  RQLCAGLKHMHSLEPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARRQIRSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQVKWP G  +P YPEALHQFVTWMLQPQA +RP IDD++IHVDKLISKFS
Sbjct  286  GSLQLAIVNAQVKWPAG-PNPPYPEALHQFVTWMLQPQAAIRPRIDDVIIHVDKLISKFS  344

Query  240  H  238
            H
Sbjct  345  H  345



>gb|ABK92466.1| unknown [Populus trichocarpa]
Length=350

 Score =   349 bits (895),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 172/181 (95%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNF+PSYAHNDVKPGNVLLTHR+G+ PLAILMDFGSARPA++QIRSRSEA
Sbjct  171  RQLCAGLKHMHNFDPSYAHNDVKPGNVLLTHRQGKSPLAILMDFGSARPAKRQIRSRSEA  230

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  231  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  290

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  291  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLISKFS  349

Query  240  H  238
            +
Sbjct  350  N  350



>ref|XP_004241617.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Solanum lycopersicum]
Length=342

 Score =   348 bits (893),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ +PSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPAR+QIRSRSEA
Sbjct  163  RQLCAGLKHMHSLDPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARRQIRSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EHVSAPFRAPELWDCPS  D+DERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWAAEHVSAPFRAPELWDCPSQCDVDERTDIWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWPT    P YPE LHQFVTWMLQPQATVRP IDDI+IHVDKLISKFS
Sbjct  283  GSLQLAIVNAQIKWPTKPKSP-YPEGLHQFVTWMLQPQATVRPRIDDILIHVDKLISKFS  341

Query  240  H  238
            H
Sbjct  342  H  342



>ref|XP_003609185.1| Serine/threonine protein kinase [Medicago truncatula]
 gb|AES91382.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=342

 Score =   348 bits (893),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHN +P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARK+I SRSEA
Sbjct  163  RQLCAGLKHMHNLDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKKISSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEHVSAPFRAPELWDCPSHADIDERTD+WSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDVWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQVKWP GL  P YPEALHQFV+WMLQPQA +RP IDDI+IHVDKLI+KFS
Sbjct  283  GSLQLAIVNAQVKWPAGLK-PSYPEALHQFVSWMLQPQAAMRPRIDDIIIHVDKLIAKFS  341

Query  240  H  238
             
Sbjct  342  Q  342



>ref|XP_010099029.1| Serine/threonine-protein kinase 16 [Morus notabilis]
 gb|EXB76387.1| Serine/threonine-protein kinase 16 [Morus notabilis]
Length=345

 Score =   347 bits (890),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHN +P YAHNDVKPGNVL+THRKGQPPLAILMDFGS RPARKQIRSRSEA
Sbjct  165  RQLCAGLKHMHNLDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSTRPARKQIRSRSEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  225  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+NAQVKWP    +P YPEALHQFVTWMLQPQA VRP I+DI+IHVDKLISK+S
Sbjct  285  GSLQLAIINAQVKWPATGPNPPYPEALHQFVTWMLQPQAAVRPRINDIIIHVDKLISKYS  344

Query  240  H  238
            H
Sbjct  345  H  345



>ref|XP_009607782.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Nicotiana tomentosiformis]
Length=342

 Score =   347 bits (889),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVLLTHRKGQPPLA+LMDFGS RPAR+QIRSRSEA
Sbjct  163  RQLCAGLKHMHSFDPPYAHNDVKPGNVLLTHRKGQPPLAVLMDFGSTRPARRQIRSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEHVSAPFRAPELWDCPS  DIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWASEHVSAPFRAPELWDCPSQCDIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQ TVRP IDDI+IHVDKLISKFS
Sbjct  283  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQGTVRPRIDDIIIHVDKLISKFS  341

Query  240  H  238
             
Sbjct  342  Q  342



>ref|XP_006374373.1| hypothetical protein POPTR_0015s06550g [Populus trichocarpa]
 gb|ERP52170.1| hypothetical protein POPTR_0015s06550g [Populus trichocarpa]
Length=350

 Score =   347 bits (889),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHN +PSYAHNDVKPGNVLLTHR+G+ PLAILMDFGSARPA++QIRSRSEA
Sbjct  171  RQLCAGLKHMHNLDPSYAHNDVKPGNVLLTHRQGKSPLAILMDFGSARPAKRQIRSRSEA  230

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  231  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  290

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  291  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLISKFS  349

Query  240  H  238
            +
Sbjct  350  N  350



>ref|XP_002317918.2| hypothetical protein POPTR_0012s05390g [Populus trichocarpa]
 gb|EEE96138.2| hypothetical protein POPTR_0012s05390g [Populus trichocarpa]
Length=352

 Score =   346 bits (887),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLK+MHN +P YAHNDVKPGNVLLTHRKG  PLAILMDFGSARPARKQIRSRSEA
Sbjct  173  RQLCAGLKNMHNLDPPYAHNDVKPGNVLLTHRKGHSPLAILMDFGSARPARKQIRSRSEA  232

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  233  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  292

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  293  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLISKFS  351

Query  240  H  238
            +
Sbjct  352  N  352



>dbj|BAJ53163.1| JHL10I11.9 [Jatropha curcas]
 gb|KDP20046.1| hypothetical protein JCGZ_05815 [Jatropha curcas]
Length=350

 Score =   345 bits (885),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+  P YAHNDVKPGNVLLTHRKGQ PLAILMDFGSARPARKQIRSRSEA
Sbjct  171  RQLCAGLKHMHSLNPPYAHNDVKPGNVLLTHRKGQSPLAILMDFGSARPARKQIRSRSEA  230

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAPFRAPELWDCPSHADIDERTD+WSLGCTLYAIMYGVSPFEYALGESG
Sbjct  231  LQLQEWAAEHCSAPFRAPELWDCPSHADIDERTDVWSLGCTLYAIMYGVSPFEYALGESG  290

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G + P YPEALHQFV WMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  291  GSLQLAIVNAQIKWPAGPNLP-YPEALHQFVNWMLQPQAAVRPRIDDIIIHVDKLISKFS  349

Query  240  H  238
            H
Sbjct  350  H  350



>ref|XP_006354740.1| PREDICTED: serine/threonine-protein kinase 16-like [Solanum tuberosum]
Length=339

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 169/180 (94%), Gaps = 1/180 (1%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            QLCAGLKHMH+ +P YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPAR+QIR RSEAL
Sbjct  161  QLCAGLKHMHSLDPPYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARRQIRFRSEAL  220

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            QLQEWA+EHVSAPFRAPELWDCPS  DIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG
Sbjct  221  QLQEWAAEHVSAPFRAPELWDCPSQCDIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  280

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH  238
            SLQLAIVNAQ+KWPTG   P YPE LHQFVTWMLQPQATVRP IDDIVIHVDKLISKFSH
Sbjct  281  SLQLAIVNAQIKWPTG-PKPPYPEGLHQFVTWMLQPQATVRPRIDDIVIHVDKLISKFSH  339



>ref|XP_004299264.1| PREDICTED: serine/threonine-protein kinase 16 [Fragaria vesca 
subsp. vesca]
Length=343

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNFEP YAHND+KPGNVL+THRKGQPPLAILMDFGSARPARKQIR+RSEA
Sbjct  164  RQLCAGLKHMHNFEPPYAHNDIKPGNVLITHRKGQPPLAILMDFGSARPARKQIRTRSEA  223

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTLYAI+YGVSPFEYALGESG
Sbjct  224  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDIWSLGCTLYAILYGVSPFEYALGESG  283

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G   P +P+ALHQF+TWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  284  GSLQLAIVNVQIKWPAG-PKPPFPDALHQFITWMLQPQAAVRPRIDDIIIHVDKLISKFS  342

Query  240  H  238
             
Sbjct  343  Q  343



>ref|XP_011011304.1| PREDICTED: serine/threonine-protein kinase 16-like [Populus euphratica]
Length=350

 Score =   343 bits (881),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHN +PSYAHNDVKPGNVLLTHR+G+ PLAILMDFGSARPA++QIRSRSEA
Sbjct  171  RQLCAGLKHMHNLDPSYAHNDVKPGNVLLTHRQGKSPLAILMDFGSARPAKRQIRSRSEA  230

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  231  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  290

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQ  VRP IDDI+IHVDKLISKFS
Sbjct  291  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQPAVRPRIDDIIIHVDKLISKFS  349

Query  240  H  238
            +
Sbjct  350  N  350



>ref|XP_007209310.1| hypothetical protein PRUPE_ppa008104mg [Prunus persica]
 gb|EMJ10509.1| hypothetical protein PRUPE_ppa008104mg [Prunus persica]
Length=345

 Score =   343 bits (880),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQ+CAGLKHMH+F+P YAHND+KPGNVL+THRKGQPPLAILMDFGSARPAR+QIRSRSEA
Sbjct  166  RQICAGLKHMHSFDPPYAHNDIKPGNVLITHRKGQPPLAILMDFGSARPARRQIRSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI+YGVSPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAILYGVSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G   P YP+ALHQF+TWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  286  GSLQLAIVNVQIKWPAG-PKPPYPDALHQFITWMLQPQAAVRPRIDDIIIHVDKLISKFS  344

Query  240  H  238
             
Sbjct  345  Q  345



>ref|XP_008240053.1| PREDICTED: serine/threonine-protein kinase 16 [Prunus mume]
Length=346

 Score =   343 bits (880),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQ+CAGLKHMH+F+P YAHND+KPGNVL+THRKGQPPLAILMDFGSARPAR+QIRSRSEA
Sbjct  167  RQICAGLKHMHSFDPPYAHNDIKPGNVLITHRKGQPPLAILMDFGSARPARRQIRSRSEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI+YGVSPFEYALGESG
Sbjct  227  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAILYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G   P YP+ALHQF+TWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  287  GSLQLAIVNVQIKWPAG-PKPPYPDALHQFITWMLQPQAAVRPRIDDIIIHVDKLISKFS  345

Query  240  H  238
             
Sbjct  346  Q  346



>ref|XP_002512018.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF50687.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=347

 Score =   343 bits (880),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ +P YAHNDVKPGN+LLT RKGQPPLAILMDFGSARPARKQIRSRSEA
Sbjct  168  RQLCAGLKHMHSLDPPYAHNDVKPGNILLTRRKGQPPLAILMDFGSARPARKQIRSRSEA  227

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  228  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  287

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G  +P YPEALHQFV WMLQPQA VRP IDDI+IHVDKLI KFS
Sbjct  288  GSLQLAIVNAQIKWPAG-PNPPYPEALHQFVIWMLQPQAAVRPRIDDIIIHVDKLILKFS  346

Query  240  H  238
            +
Sbjct  347  N  347



>ref|XP_007037717.1| Serine/threonine protein kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY22218.1| Serine/threonine protein kinase 3 isoform 1 [Theobroma cacao]
Length=345

 Score =   343 bits (880),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ EP YAHNDVKPGNVLLT RKGQPPL+ILMDFGSARPARKQI SRSEA
Sbjct  166  RQLCAGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLSILMDFGSARPARKQIHSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  286  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQAAVRPFIDDIIIHVDKLISKFS  344

Query  240  H  238
             
Sbjct  345  Q  345



>emb|CDO98513.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   342 bits (878),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 169/180 (94%), Gaps = 1/180 (1%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            QLCAGLKHMHNFEP YAHNDVK GNVLLTHRKGQ PLAILMDFGSARPARKQIRSRSEAL
Sbjct  167  QLCAGLKHMHNFEPPYAHNDVKAGNVLLTHRKGQAPLAILMDFGSARPARKQIRSRSEAL  226

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            QLQEWASEH SAP+RAPELWDCPSH DIDER+DIWSLGCTLYAIMYGVSPFEYALGESGG
Sbjct  227  QLQEWASEHCSAPYRAPELWDCPSHGDIDERSDIWSLGCTLYAIMYGVSPFEYALGESGG  286

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH  238
            SLQLAIVNAQ+KWP G  +P YPEALHQFVTWMLQPQ TVRP IDDI+IHVDKLI+KFS+
Sbjct  287  SLQLAIVNAQIKWPAG-PNPPYPEALHQFVTWMLQPQPTVRPRIDDIIIHVDKLIAKFSN  345



>ref|XP_004508637.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X1 
[Cicer arietinum]
 ref|XP_004508638.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X2 
[Cicer arietinum]
Length=342

 Score =   342 bits (877),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ +P YAHNDVKPGNVL+THRK QPPLAILMDFGSARPARKQI SRSEA
Sbjct  163  RQLCAGLKHMHSLDPPYAHNDVKPGNVLITHRKEQPPLAILMDFGSARPARKQISSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTD+WSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDVWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQVKWP GL  P YPEALHQFV+WMLQPQA +RP IDDI+IHVDKL++KFS
Sbjct  283  GSLQLAIVNAQVKWPAGLK-PSYPEALHQFVSWMLQPQAAMRPRIDDIIIHVDKLVAKFS  341

Query  240  H  238
             
Sbjct  342  Q  342



>ref|XP_010522295.1| PREDICTED: serine/threonine-protein kinase 16-like [Tarenaya 
hassleriana]
Length=349

 Score =   342 bits (876),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 168/183 (92%), Gaps = 2/183 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ +P YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSR EA
Sbjct  167  RQLCDGLKHMHSMDPPYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHAD+DERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWASEHCSAPFRAPELWDCPSHADVDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTG--LSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
            GSLQLAIVNAQ+KWPTG   S   YPEALHQFVTWMLQPQ  VRP IDDI+IHVDKLISK
Sbjct  287  GSLQLAIVNAQIKWPTGPKASSCPYPEALHQFVTWMLQPQPAVRPRIDDIIIHVDKLISK  346

Query  246  FSH  238
            F+ 
Sbjct  347  FTQ  349



>ref|XP_006345079.1| PREDICTED: serine/threonine-protein kinase 16-like [Solanum tuberosum]
Length=342

 Score =   341 bits (875),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVLLTH K QPPLA+LMDFGS RPARKQIRSR EA
Sbjct  163  RQLCAGLKHMHSFDPPYAHNDVKPGNVLLTHSKEQPPLAVLMDFGSTRPARKQIRSRQEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EHVSAPFRAPELWDCPS  DIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWAAEHVSAPFRAPELWDCPSQCDIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQ TVRP IDDI+IHVDKLISKFS
Sbjct  283  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQGTVRPRIDDIIIHVDKLISKFS  341

Query  240  H  238
            H
Sbjct  342  H  342



>ref|XP_010257846.1| PREDICTED: serine/threonine-protein kinase 16 [Nelumbo nucifera]
Length=344

 Score =   341 bits (874),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 171/180 (95%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH++EP YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARKQIRSR EA
Sbjct  165  RQLCAGLKHMHSYEPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKQIRSRQEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            +QLQEWA+EH SAPFRAPELWDCPSH+DIDERTDIWSLGCTLYAIMYG+SPFEYALGE+G
Sbjct  225  VQLQEWAAEHCSAPFRAPELWDCPSHSDIDERTDIWSLGCTLYAIMYGMSPFEYALGEAG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+NAQ+KWPTG  +P YPE LHQFVTWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  285  GSLQLAILNAQIKWPTG-PNPPYPEPLHQFVTWMLQPQAAVRPCIDDILIHVDKLISKFS  343



>ref|XP_008453329.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X1 
[Cucumis melo]
Length=346

 Score =   340 bits (873),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNF+P YAHND+KPGNVL+T RKGQPPLAILMDFGSARPAR+QI SRSEA
Sbjct  167  RQLCAGLKHMHNFDPPYAHNDIKPGNVLITRRKGQPPLAILMDFGSARPARRQISSRSEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDC SH+D+DERTDIWSLGCTLYAIMYGVSPFEY LGESG
Sbjct  227  LQLQEWASEHCSAPFRAPELWDCASHSDVDERTDIWSLGCTLYAIMYGVSPFEYVLGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G + P YPEALHQFV WMLQPQA VRPHIDDIVIHVDKLISKFS
Sbjct  287  GSLQLAIVNVQIKWPAGPT-PPYPEALHQFVKWMLQPQAAVRPHIDDIVIHVDKLISKFS  345

Query  240  H  238
            +
Sbjct  346  N  346



>ref|XP_003524500.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Glycine max]
Length=342

 Score =   340 bits (872),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARKQI SRSEA
Sbjct  163  RQLCAGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKQISSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQVKWP G   P YPEALHQFV+WMLQP A++RP IDDI+IHVDKL++KFS
Sbjct  283  GSLQLAIVNAQVKWPAG-PKPPYPEALHQFVSWMLQPTASMRPRIDDIIIHVDKLVAKFS  341

Query  240  H  238
             
Sbjct  342  Q  342



>ref|XP_004236087.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Solanum lycopersicum]
Length=342

 Score =   340 bits (872),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 167/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVLLTHR+ QPPLA+LMDFGS RPARKQIRSR EA
Sbjct  163  RQLCAGLKHMHSFDPPYAHNDVKPGNVLLTHRREQPPLAVLMDFGSTRPARKQIRSRQEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EHVSAPFRAPELWDCPS  DIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWAAEHVSAPFRAPELWDCPSQCDIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFVTWMLQPQ TVRP IDDI+IHVDKLISKFS
Sbjct  283  GSLQLAIVNAQIKWPAG-PKPPYPEALHQFVTWMLQPQGTVRPRIDDIIIHVDKLISKFS  341



>gb|EYU19016.1| hypothetical protein MIMGU_mgv1a009372mg [Erythranthe guttata]
Length=344

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 168/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHN +P YAHNDVKPGNVLLTHRKGQ PLA LMDFGSARPARKQIR+RSEA
Sbjct  165  RQLCAGLKHMHNSDPPYAHNDVKPGNVLLTHRKGQSPLATLMDFGSARPARKQIRTRSEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTL+AIMYG SPFEYALGESG
Sbjct  225  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLFAIMYGESPFEYALGESG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G  +P YPE LHQFVTWMLQPQATVRP IDDIVIHVDKLI+KFS
Sbjct  285  GSLQLAIVNAQIKWPAG-PNPPYPEPLHQFVTWMLQPQATVRPCIDDIVIHVDKLITKFS  343



>ref|XP_008455005.1| PREDICTED: serine/threonine-protein kinase 16 [Cucumis melo]
Length=344

 Score =   340 bits (871),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ EP YAHNDVKPGNVLLTHRKG+ PLAILMDFGSARPARK+IRSRSEA
Sbjct  165  RQLCAGLKHMHSNEPPYAHNDVKPGNVLLTHRKGKSPLAILMDFGSARPARKEIRSRSEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYG+SPFEYALGESG
Sbjct  225  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGLSPFEYALGESG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G S P YP+ALHQF+ WMLQPQA VRP IDDIVIHVDKLI+KFS
Sbjct  285  GSLQLAIVNAQIKWPAGPS-PPYPDALHQFIKWMLQPQAAVRPRIDDIVIHVDKLIAKFS  343

Query  240  H  238
            +
Sbjct  344  N  344



>ref|XP_006399302.1| hypothetical protein EUTSA_v10013995mg [Eutrema salsugineum]
 gb|ESQ40755.1| hypothetical protein EUTSA_v10013995mg [Eutrema salsugineum]
Length=347

 Score =   339 bits (870),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  167  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  287  GSLQLAIVNAQIKWPNAGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  346



>ref|XP_011005497.1| PREDICTED: serine/threonine-protein kinase 16-like [Populus euphratica]
 ref|XP_011005498.1| PREDICTED: serine/threonine-protein kinase 16-like [Populus euphratica]
Length=354

 Score =   339 bits (870),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLK+MHN +P YAHNDVKPGNVLLTHR+G+ PLAILMDFGSARPA++QIRSRSEA
Sbjct  175  RQLCAGLKNMHNLDPPYAHNDVKPGNVLLTHRQGKSPLAILMDFGSARPAKRQIRSRSEA  234

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  235  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  294

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P YPEALHQFV WMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  295  GSLQLAIVNAQIKWPAGPKAP-YPEALHQFVIWMLQPQAAVRPRIDDIIIHVDKLISKFS  353

Query  240  H  238
            +
Sbjct  354  N  354



>ref|XP_004138208.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Cucumis sativus]
 ref|XP_004154941.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Cucumis sativus]
 gb|KGN63753.1| Serine/threonine protein kinase [Cucumis sativus]
Length=346

 Score =   339 bits (870),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNF+P YAHND+KPGNVL+T RKGQPPLAILMDFGSARPAR+QI SRSEA
Sbjct  167  RQLCAGLKHMHNFDPPYAHNDIKPGNVLITRRKGQPPLAILMDFGSARPARRQISSRSEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDC SH+D+DERTDIWSLGCTLYAIMYGVSPF+Y LGESG
Sbjct  227  LQLQEWASEHCSAPFRAPELWDCASHSDVDERTDIWSLGCTLYAIMYGVSPFDYVLGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G + P YPEALHQFV WMLQPQA VRPHIDDIVIHVDKLISKFS
Sbjct  287  GSLQLAIVNVQIKWPAGPT-PPYPEALHQFVKWMLQPQAAVRPHIDDIVIHVDKLISKFS  345

Query  240  H  238
            +
Sbjct  346  N  346



>gb|KHG15042.1| Serine/threonine-protein kinase 16 [Gossypium arboreum]
Length=345

 Score =   339 bits (869),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH   P YAHNDVKPGNVLLT RKGQ PLAILMDFGSARPARKQIRSRSEA
Sbjct  166  RQLCAGLKHMHGLVPPYAHNDVKPGNVLLTRRKGQAPLAILMDFGSARPARKQIRSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSDADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+NAQ+KWP G   P YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  286  GSLQLAIINAQIKWPAG-PKPPYPEALHQFVTWMLQPQAAVRPQIDDIIIHVDKLISKFS  344

Query  240  H  238
             
Sbjct  345  Q  345



>gb|AIZ68208.1| Serine/threonine-protein kinase 16 [Ornithogalum saundersiae]
Length=341

 Score =   338 bits (868),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 168/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNF+PSYAHNDVKPGNVL+THRKGQPP+AILMDFGSARPA+++IRSRS+A
Sbjct  162  RQLCAGLKHMHNFDPSYAHNDVKPGNVLITHRKGQPPVAILMDFGSARPAKREIRSRSQA  221

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAPFRAPELWDCPSH DID RTDIWSLGCTLYAIMY VSPFEYALGESG
Sbjct  222  LQLQEWAAEHCSAPFRAPELWDCPSHTDIDARTDIWSLGCTLYAIMYSVSPFEYALGESG  281

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+NAQVKWP G  DP YPE LHQFV WMLQPQ  VRPHIDDI+IHVDKLISKFS
Sbjct  282  GSLQLAIMNAQVKWPAG-PDPPYPEPLHQFVMWMLQPQPAVRPHIDDIIIHVDKLISKFS  340



>gb|AAZ39949.1| serine/threonine protein kinase [Gossypium hirsutum]
Length=345

 Score =   338 bits (868),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGL+HMH+ EP YAHNDVKPGNVLLTHRKG+ PLAILMDFGSARPAR+QIRSRSEA
Sbjct  166  RQLCAGLEHMHSLEPPYAHNDVKPGNVLLTHRKGESPLAILMDFGSARPARRQIRSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH +APFRAPELWDCPSHAD+DERTDIW+LGCTLYAIMYGVSPFEYALGESG
Sbjct  226  LQLQEWASEHCAAPFRAPELWDCPSHADVDERTDIWALGCTLYAIMYGVSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G   P+YPEALHQFVTWMLQPQ +VRP IDDI+ HVDKLISKFS
Sbjct  286  GSLQLAIVNAQIKWPAG-PKPQYPEALHQFVTWMLQPQPSVRPRIDDIIFHVDKLISKFS  344

Query  240  H  238
             
Sbjct  345  Q  345



>ref|XP_010547731.1| PREDICTED: serine/threonine-protein kinase 16 [Tarenaya hassleriana]
Length=349

 Score =   339 bits (869),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 168/181 (93%), Gaps = 2/181 (1%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            QLC GLKHMH+ +P YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARP+RKQIRSR EAL
Sbjct  168  QLCDGLKHMHSLDPPYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPSRKQIRSRQEAL  227

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            QLQEWASEH SAPFRAPELWDCPSHAD+DERTDIWSLGCTLYA+MYGVSPFEYALGESGG
Sbjct  228  QLQEWASEHCSAPFRAPELWDCPSHADVDERTDIWSLGCTLYAMMYGVSPFEYALGESGG  287

Query  417  SLQLAIVNAQVKWP--TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            SLQLAIVNAQ+KWP  TG     YPEALHQFVTWMLQPQATVRP IDDI+IHVDKLI+KF
Sbjct  288  SLQLAIVNAQIKWPTTTGTKACPYPEALHQFVTWMLQPQATVRPRIDDIIIHVDKLIAKF  347

Query  243  S  241
            S
Sbjct  348  S  348



>gb|KHN15181.1| Serine/threonine-protein kinase 16 [Glycine soja]
Length=361

 Score =   339 bits (869),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARKQI SRSEA
Sbjct  182  RQLCAGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKQISSRSEA  241

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  242  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  301

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQVKWP G   P YPEALHQFV+WMLQP A++RP IDDI+IHVDKL++KFS
Sbjct  302  GSLQLAIVNAQVKWPAG-PKPPYPEALHQFVSWMLQPTASMRPRIDDIIIHVDKLVAKFS  360

Query  240  H  238
             
Sbjct  361  Q  361



>ref|XP_010491440.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Camelina sativa]
Length=347

 Score =   338 bits (867),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  167  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  287  GSLQLAIVNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  346



>ref|XP_002873344.1| hypothetical protein ARALYDRAFT_487651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49603.1| hypothetical protein ARALYDRAFT_487651 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   338 bits (867),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  167  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  287  GSLQLAIVNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  346



>ref|NP_196433.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
 gb|AAG40409.1|AF325057_1 AT5g08160 [Arabidopsis thaliana]
 gb|AAB69123.1| serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAB93717.1| serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAN60359.1| unknown [Arabidopsis thaliana]
 gb|ABF18990.1| At5g08160 [Arabidopsis thaliana]
 gb|AED91259.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
Length=347

 Score =   338 bits (867),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  167  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  287  GSLQLAIVNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  346



>ref|XP_009415450.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   338 bits (867),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 169/180 (94%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARK+IRSRSEA
Sbjct  163  RQLCAGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKEIRSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYG SPFEYALGESG
Sbjct  223  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGTSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLA++NAQ+KWP+G  +P YPE LHQFV WMLQPQ  +RP+IDDI+IHVDKLI KFS
Sbjct  283  GSLQLAVMNAQIKWPSG-HNPPYPENLHQFVLWMLQPQPAMRPNIDDIIIHVDKLILKFS  341



>gb|KHG05751.1| Serine/threonine-protein kinase 16 [Gossypium arboreum]
Length=197

 Score =   332 bits (852),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 169/183 (92%), Gaps = 5/183 (3%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGL+HMH+ EP YAHNDVKPGNVLLTHRKG+ PLAILMDFGSARPAR+QIRSRSEA
Sbjct  18   RQLCAGLEHMHSLEPPYAHNDVKPGNVLLTHRKGESPLAILMDFGSARPARRQIRSRSEA  77

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH +APFRAPELWDCPSHADIDERTDIW+LGCTLYAIMYGVSPFEYALGESG
Sbjct  78   LQLQEWASEHCAAPFRAPELWDCPSHADIDERTDIWALGCTLYAIMYGVSPFEYALGESG  137

Query  420  GSLQLAIVNAQVKWPTGLSDPK--YPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
            GSLQLAIVNAQ+KWP G   PK  YPEALHQFVTWMLQPQ +VRP IDDI+ HVDKLISK
Sbjct  138  GSLQLAIVNAQIKWPAG---PKLQYPEALHQFVTWMLQPQPSVRPCIDDIIFHVDKLISK  194

Query  246  FSH  238
            FS 
Sbjct  195  FSQ  197



>ref|XP_006288089.1| hypothetical protein CARUB_v10001319mg [Capsella rubella]
 gb|EOA20987.1| hypothetical protein CARUB_v10001319mg [Capsella rubella]
Length=347

 Score =   338 bits (867),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  167  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  287  GSLQLAIVNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  346



>ref|NP_850792.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
 gb|AED91260.1| serine/threonine protein kinase 3 [Arabidopsis thaliana]
Length=311

 Score =   337 bits (863),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  131  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  190

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  191  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  250

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  251  GSLQLAIVNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  310



>ref|XP_006600612.1| PREDICTED: serine/threonine-protein kinase 16 [Glycine max]
 gb|KHN18398.1| Serine/threonine-protein kinase 16 [Glycine soja]
Length=343

 Score =   338 bits (866),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P +AHNDVKPGNVL+THRKGQPPLAILMDFGSARPARKQI SRSEA
Sbjct  164  RQLCAGLKHMHSFDPPHAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKQIGSRSEA  223

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  224  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  283

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQVKWP G   P YPEALHQFV+WMLQP A++RP IDDI+IHVDKL++KFS
Sbjct  284  GSLQLAIVNAQVKWPAG-PKPPYPEALHQFVSWMLQPTASMRPRIDDIIIHVDKLVAKFS  342

Query  240  H  238
             
Sbjct  343  Q  343



>ref|XP_010452793.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Camelina sativa]
Length=347

 Score =   338 bits (866),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  167  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  287  GSLQLAIVNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  346



>ref|XP_010423128.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Camelina sativa]
Length=347

 Score =   338 bits (866),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  167  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  287  GSLQLAIVNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  346



>ref|XP_009395860.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Musa acuminata subsp. malaccensis]
Length=362

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 169/180 (94%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQ+C GLKHMH+F+P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARK+IRSRSEA
Sbjct  183  RQVCGGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKEIRSRSEA  242

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYG SPFEY LGESG
Sbjct  243  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGTSPFEYVLGESG  302

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLA++NAQVKWP+GL +P YPE+LHQFV WMLQPQ   RP+IDDI+IHVDKLI+K+S
Sbjct  303  GSLQLAVMNAQVKWPSGL-NPPYPESLHQFVVWMLQPQPAARPNIDDIIIHVDKLITKYS  361



>gb|KFK25181.1| hypothetical protein AALP_AA8G077200 [Arabis alpina]
Length=348

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  167  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPT-GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAIVNAQ+KWP  G     YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF
Sbjct  287  GSLQLAIVNAQIKWPNAGPKGSSYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKF  346

Query  243  S  241
            +
Sbjct  347  T  347



>gb|KJB06908.1| hypothetical protein B456_001G066000 [Gossypium raimondii]
Length=345

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH   P YAHNDVKPGNVLLT RKGQ PLAILMDFGSARPARKQIRSRS+A
Sbjct  166  RQLCAGLKHMHGLLPPYAHNDVKPGNVLLTRRKGQAPLAILMDFGSARPARKQIRSRSQA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSDADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+NAQ+KWP G   P YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  286  GSLQLAIINAQIKWPAG-PKPPYPEALHQFVTWMLQPQAAVRPQIDDIIIHVDKLISKFS  344

Query  240  H  238
             
Sbjct  345  Q  345



>ref|XP_011072928.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Sesamum indicum]
Length=344

 Score =   337 bits (864),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVL+T+RKGQ PLA LMDFGSARPARKQIR+RSEA
Sbjct  165  RQLCAGLKHMHSFDPPYAHNDVKPGNVLVTYRKGQAPLATLMDFGSARPARKQIRTRSEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHAD+DERTDIWSLGCTL+AIMYG SPFEYALGESG
Sbjct  225  LQLQEWASEHCSAPFRAPELWDCPSHADLDERTDIWSLGCTLFAIMYGESPFEYALGESG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP+G  +P YP+ALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KFS
Sbjct  285  GSLQLAIVNAQIKWPSG-PNPPYPDALHQFVTWMLQPQAAVRPRIDDIIIHVDKLITKFS  343

Query  240  H  238
            +
Sbjct  344  N  344



>ref|NP_001267650.1| serine/threonine-protein kinase 16-like [Cucumis sativus]
 ref|XP_004157430.1| PREDICTED: serine/threonine-protein kinase 16-like [Cucumis sativus]
 emb|CAI30891.1| somatic embryogenesis serine-threonine protein kinase 1 [Cucumis 
sativus]
 gb|KGN64092.1| hypothetical protein Csa_1G041540 [Cucumis sativus]
Length=344

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ EP YAHNDVKPGNVLLTHRKG  PLAILMDFGS RPARK+IRSRSEA
Sbjct  165  RQLCAGLKHMHSNEPPYAHNDVKPGNVLLTHRKGMSPLAILMDFGSTRPARKEIRSRSEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYG++PFEYALGESG
Sbjct  225  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGLTPFEYALGESG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP G  +P YP+ALHQF+ WMLQPQA VRP IDDIVIHVDKLI+KFS
Sbjct  285  GSLQLAIVNAQIKWPAG-PNPPYPDALHQFIKWMLQPQAAVRPQIDDIVIHVDKLIAKFS  343

Query  240  H  238
            +
Sbjct  344  N  344



>gb|KJB51100.1| hypothetical protein B456_008G201200 [Gossypium raimondii]
 gb|KJB51101.1| hypothetical protein B456_008G201200 [Gossypium raimondii]
Length=345

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGL+HMH+ EP YAHND+KPGNVLLTHRKG+ PLAILMDFGSARPAR+QIRSRSEA
Sbjct  166  RQLCAGLEHMHSLEPPYAHNDIKPGNVLLTHRKGESPLAILMDFGSARPARRQIRSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH +APFRAPELWDCPSHAD+DERTDIW+LGCTLYAIMYGVSPFEYALGESG
Sbjct  226  LQLQEWASEHCAAPFRAPELWDCPSHADVDERTDIWALGCTLYAIMYGVSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G   P+YPEALHQFVTWMLQPQ +VRP IDDI+ HVDKLISKFS
Sbjct  286  GSLQLAIVNVQIKWPAG-PKPQYPEALHQFVTWMLQPQPSVRPRIDDIIFHVDKLISKFS  344

Query  240  H  238
             
Sbjct  345  Q  345



>gb|AAM65833.1| serine/threonine protein kinase [Arabidopsis thaliana]
Length=347

 Score =   336 bits (862),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAH+DVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  167  RQLCDGLKHMHSLEPPYAHDDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  227  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  287  GSLQLAIVNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  346



>ref|XP_009396202.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Musa acuminata subsp. malaccensis]
Length=342

 Score =   336 bits (861),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 169/180 (94%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPP AILMDFGSARPARK+IRSRSEA
Sbjct  163  RQLCAGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPGAILMDFGSARPARKEIRSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQ+WASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYG SPFEYA+GESG
Sbjct  223  LQLQDWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGASPFEYAIGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLA++NAQ+KWP+G  DP YPE+LHQF+ WMLQPQ  VRP IDDI++HVDKLISK+S
Sbjct  283  GSLQLAVMNAQIKWPSG-PDPPYPESLHQFIVWMLQPQPAVRPKIDDIIVHVDKLISKYS  341



>ref|XP_007155191.1| hypothetical protein PHAVU_003G181000g [Phaseolus vulgaris]
 gb|ESW27185.1| hypothetical protein PHAVU_003G181000g [Phaseolus vulgaris]
Length=342

 Score =   336 bits (861),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARK+I +RSEA
Sbjct  163  RQLCAGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKKITNRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS +DIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWASEHCSAPFRAPELWDCPSQSDIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G   P YPEA HQFV+WMLQPQA +RP IDDI+IHVDKLI+KFS
Sbjct  283  GSLQLAIVNCQIKWPAG-PKPPYPEAFHQFVSWMLQPQAAMRPRIDDIIIHVDKLIAKFS  341

Query  240  H  238
             
Sbjct  342  Q  342



>ref|XP_009346448.1| PREDICTED: serine/threonine-protein kinase 16-like [Pyrus x bretschneideri]
Length=345

 Score =   335 bits (860),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 168/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH F+P YAHND+KPGNVL+THRKGQ PLAILMDFGSARPAR+QIRSR+EA
Sbjct  166  RQLCAGLKHMHTFDPPYAHNDIKPGNVLITHRKGQSPLAILMDFGSARPARRQIRSRTEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTD+WSLGCTLYAI+YG+SPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDVWSLGCTLYAILYGMSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G  +P YP+ALHQF+TWMLQPQA VRP IDDI+IHVDKLI+KFS
Sbjct  286  GSLQLAIVNVQIKWPAG-PNPPYPDALHQFITWMLQPQAAVRPRIDDILIHVDKLIAKFS  344



>ref|XP_008356645.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=345

 Score =   335 bits (860),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 168/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH F+P YAHND+KPGNVL+THRKGQ PLAILMDFGSARPAR+QIRSR+EA
Sbjct  166  RQLCAGLKHMHTFDPPYAHNDIKPGNVLITHRKGQSPLAILMDFGSARPARRQIRSRTEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTD+WSLGCTLYAI+YG+SPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDVWSLGCTLYAILYGMSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G  +P YP+ALHQF+TWMLQPQA VRP IDDI+IHVDKLI+KFS
Sbjct  286  GSLQLAIVNVQIKWPAG-PNPPYPDALHQFITWMLQPQAAVRPRIDDILIHVDKLIAKFS  344



>ref|XP_008367568.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=345

 Score =   335 bits (858),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH  +P YAHND+KPGNVL+THRKGQ PLAILMDFGSARPAR+QIRSR+EA
Sbjct  166  RQLCAGLKHMHTLDPPYAHNDIKPGNVLITHRKGQSPLAILMDFGSARPARRQIRSRTEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTD+WSLGCTLYAI+YG+SPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDVWSLGCTLYAILYGMSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G  +P YP+ALHQF+TWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  286  GSLQLAIVNVQIKWPAG-PNPPYPDALHQFITWMLQPQAAVRPRIDDILIHVDKLISKFS  344

Query  240  H  238
            +
Sbjct  345  N  345



>ref|XP_008393382.1| PREDICTED: serine/threonine-protein kinase 16, partial [Malus 
domestica]
Length=331

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 167/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH  +P YAHND+KPGNVL+THRKGQ PLAILMDFGSARPAR+QIRSR+EA
Sbjct  152  RQLCAGLKHMHTLDPPYAHNDIKPGNVLITHRKGQSPLAILMDFGSARPARRQIRSRTEA  211

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTD+WSLGCTLYAI+YG+SPFEYALGESG
Sbjct  212  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDVWSLGCTLYAILYGMSPFEYALGESG  271

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G  +P YP+ALHQF+TWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  272  GSLQLAIVNVQIKWPAG-PNPPYPDALHQFITWMLQPQAAVRPRIDDILIHVDKLISKFS  330



>emb|CDY21515.1| BnaC09g47770D [Brassica napus]
Length=343

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  163  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYG+SPFEYALGESG
Sbjct  223  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGMSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+NAQ+KWP       YPEALHQFVTWMLQPQA VRP I DI+IHVDKLI KF+
Sbjct  283  GSLQLAIMNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRIGDIIIHVDKLIEKFT  342



>ref|XP_010261723.1| PREDICTED: serine/threonine-protein kinase 16-like [Nelumbo nucifera]
Length=346

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 167/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNFEP YAHND+KPGNVL+THRKGQ PLAILMDFGSA+PARKQIRSR EA
Sbjct  167  RQLCAGLKHMHNFEPPYAHNDLKPGNVLITHRKGQSPLAILMDFGSAQPARKQIRSRQEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            +QLQEWA+EH +AP+RAPELWDCPSH DIDERTDIWSLGCTLYAIMYGVSPFEYALGE+G
Sbjct  227  VQLQEWAAEHCTAPYRAPELWDCPSHIDIDERTDIWSLGCTLYAIMYGVSPFEYALGEAG  286

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+N QVKWP G + P YPE LHQFVTWMLQPQA VRP IDDIVIHVDKLISKFS
Sbjct  287  GSLQLAILNGQVKWPQGPNRP-YPEPLHQFVTWMLQPQAAVRPCIDDIVIHVDKLISKFS  345



>ref|XP_006485732.1| PREDICTED: serine/threonine-protein kinase 16-like [Citrus sinensis]
Length=349

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            Q+CAGLKHMH+ EP YAHNDVKPGN+L+T RKGQPPLAILMDFGSARPARKQIRSRSEAL
Sbjct  167  QICAGLKHMHSLEPPYAHNDVKPGNILITRRKGQPPLAILMDFGSARPARKQIRSRSEAL  226

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            QLQEWA+EH SAPFRAPELWDCPSH DIDERTD+WSLGCTLYAIMYGVSPFEYALGESGG
Sbjct  227  QLQEWAAEHCSAPFRAPELWDCPSHTDIDERTDVWSLGCTLYAIMYGVSPFEYALGESGG  286

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH  238
            SLQLAI+NAQ+KWP G  +P YP+ALHQFV WMLQPQ  VRP IDDIVIHVDKLISKFS 
Sbjct  287  SLQLAILNAQIKWPAG-PNPPYPDALHQFVRWMLQPQPAVRPRIDDIVIHVDKLISKFSQ  345



>emb|CDX69971.1| BnaA10g23200D [Brassica napus]
Length=343

 Score =   333 bits (855),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT R GQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  163  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRTGQPPLAILMDFGSARPSRKQIRSRQEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYG+SPFEYALGESG
Sbjct  223  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGMSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQ+KWP       YPEALHQFVTWMLQPQA VRP I DI+IHVDKLI+KF+
Sbjct  283  GSLQLAIVNAQIKWPNAGPKASYPEALHQFVTWMLQPQAAVRPRIGDIIIHVDKLIAKFT  342



>ref|XP_008360890.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=345

 Score =   333 bits (853),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 167/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH  +P YAHND+KPGNVL+THRKGQ PLAILMDFGSARPAR+QIRSR+EA
Sbjct  166  RQLCAGLKHMHTLDPPYAHNDIKPGNVLITHRKGQSPLAILMDFGSARPARRQIRSRTEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTD+WSLGCTLYAI+YG+SPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDVWSLGCTLYAILYGMSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G  +P YP+ALHQF+TWMLQPQA VRP IDDI+IHVDKLI+KFS
Sbjct  286  GSLQLAIVNVQIKWPAG-PNPPYPDALHQFITWMLQPQAAVRPRIDDILIHVDKLIAKFS  344



>ref|XP_009337751.1| PREDICTED: serine/threonine-protein kinase 16-like [Pyrus x bretschneideri]
Length=345

 Score =   330 bits (847),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH  +P YAHND+KPGNVL+THRKGQ PLA+LMDFGSARPAR+QI SR+EA
Sbjct  166  RQLCAGLKHMHTLDPPYAHNDIKPGNVLITHRKGQSPLAMLMDFGSARPARRQIHSRTEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTD+WSLGCTLYAI+YG+SPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDVWSLGCTLYAILYGMSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G  +P YP+ALHQF+TWMLQPQA VRP IDDI+IHVDKLISKFS
Sbjct  286  GSLQLAIVNVQIKWPAG-PNPPYPDALHQFITWMLQPQAAVRPRIDDILIHVDKLISKFS  344



>emb|CDY67889.1| BnaAnng25480D [Brassica napus]
Length=345

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ +P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  164  RQLCDGLKHMHSLDPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  223

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  224  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  283

Query  420  GSLQLAIVNAQVKWPT-GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAIVNAQVKWP  G     YPEALHQFVTWMLQPQ  VRP ID I+IHVDKLI+KF
Sbjct  284  GSLQLAIVNAQVKWPNAGPKASSYPEALHQFVTWMLQPQPAVRPSIDAIIIHVDKLIAKF  343

Query  243  S  241
            +
Sbjct  344  T  344



>emb|CDY70989.1| BnaC03g71390D [Brassica napus]
Length=344

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ +P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  164  RQLCDGLKHMHSLDPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  223

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPS+ADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  224  LQLQEWTSEHCSAPFRAPELWDCPSNADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  283

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQVKWP       YPEALHQFVTWMLQPQ  VRP ID I+IHVDKLI+KF+
Sbjct  284  GSLQLAIVNAQVKWPNAGPKASYPEALHQFVTWMLQPQPAVRPSIDAIIIHVDKLIAKFT  343



>ref|XP_009131040.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Brassica rapa]
Length=345

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ +P YAHNDVKPGNVLLT RKGQPPLAILMDFGSARP+RKQIRSR EA
Sbjct  164  RQLCDGLKHMHSLDPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSRQEA  223

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  224  LQLQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  283

Query  420  GSLQLAIVNAQVKWPT-GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAIVNAQVKWP  G     YPEALHQFVTWMLQPQ  VRP ID I+IHVDKLI+KF
Sbjct  284  GSLQLAIVNAQVKWPNAGPKASSYPEALHQFVTWMLQPQPAVRPSIDAIIIHVDKLIAKF  343

Query  243  S  241
            +
Sbjct  344  T  344



>emb|CDY44759.1| BnaC02g01280D [Brassica napus]
Length=342

 Score =   328 bits (841),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQ PLAILMDFGSARPARKQIRSR EA
Sbjct  162  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQTPLAILMDFGSARPARKQIRSRQEA  221

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW SEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEY L ES 
Sbjct  222  LQLQEWTSEHSSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYVLEESD  281

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNA++KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  282  GSLQLAIVNAKIKWPKAGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  341



>ref|XP_008797567.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Phoenix dactylifera]
Length=347

 Score =   328 bits (841),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 167/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARK++RSR+EA
Sbjct  165  RQLCAGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKEVRSRAEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQ+QEWA+EH SAPFRAPELWDCPSHA+IDERTDIWSLGCTLYAIMYG SPFEY LGESG
Sbjct  225  LQIQEWAAEHCSAPFRAPELWDCPSHANIDERTDIWSLGCTLYAIMYGSSPFEYVLGESG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLA++NAQ+KWP+G   P YPE L QFV WMLQPQ  VRP+IDDI+IHVDKL+SK+S
Sbjct  285  GSLQLAVMNAQIKWPSGPDSP-YPEPLRQFVVWMLQPQPAVRPNIDDIIIHVDKLLSKYS  343



>gb|EPS69990.1| hypothetical protein M569_04770 [Genlisea aurea]
Length=341

 Score =   328 bits (840),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 166/181 (92%), Gaps = 4/181 (2%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGL+HMHNFEP YAHND+KPGNVL+T+RKG+PPLA LMDFGSARPAR+QIRSRSEA
Sbjct  165  RQLCAGLEHMHNFEPPYAHNDIKPGNVLVTYRKGRPPLATLMDFGSARPARRQIRSRSEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFR+PELWDCPSHADIDERTD+WSLGCTL+A+MYG SPFEYALGESG
Sbjct  225  LQLQEWASEHCSAPFRSPELWDCPSHADIDERTDVWSLGCTLFALMYGDSPFEYALGESG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNAQVKWP G     +PEAL QFVTWMLQPQ  +RP I DI+IHVDKLISKFS
Sbjct  285  GSLQLAIVNAQVKWPNG----PFPEALRQFVTWMLQPQTAIRPRIGDILIHVDKLISKFS  340

Query  240  H  238
            +
Sbjct  341  N  341



>ref|XP_009125719.1| PREDICTED: serine/threonine-protein kinase 16-like [Brassica 
rapa]
 emb|CDY40762.1| BnaAnng06250D [Brassica napus]
Length=342

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC GLKHMH+ EP YAHNDVKPGNVLLT RKGQ PLAILMDFGSARPARKQIRSR EA
Sbjct  162  RQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQTPLAILMDFGSARPARKQIRSRQEA  221

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEW +EH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEY L ES 
Sbjct  222  LQLQEWTAEHSSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYVLEESD  281

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVNA++KWP       YPEALHQFVTWMLQPQA VRP IDDI+IHVDKLI+KF+
Sbjct  282  GSLQLAIVNAKIKWPKAGPKASYPEALHQFVTWMLQPQAAVRPRIDDIIIHVDKLIAKFT  341



>ref|XP_010678394.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Beta vulgaris subsp. vulgaris]
Length=344

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGNVL+ HRKGQ PLA+LMDFGSARPAR+QI+SR+EA
Sbjct  165  RQLCAGLKHMHSFDPPYAHNDVKPGNVLIKHRKGQAPLAVLMDFGSARPARRQIQSRAEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAPFRAPE WDCPS ++IDERTDIWSLGCTLY IMYGVSPFEYALGE+G
Sbjct  225  LQLQEWAAEHCSAPFRAPEFWDCPSQSNIDERTDIWSLGCTLYGIMYGVSPFEYALGEAG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP G   P YP+ LHQFVTWMLQPQA VRP IDDI+IHVDKLISK+S
Sbjct  285  GSLQLAIVNVQIKWPAG-PKPPYPDTLHQFVTWMLQPQAAVRPRIDDIIIHVDKLISKYS  343

Query  240  H  238
            +
Sbjct  344  N  344



>ref|XP_009597332.1| PREDICTED: serine/threonine-protein kinase 16-like [Nicotiana 
tomentosiformis]
Length=343

 Score =   325 bits (834),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNF+P YAHNDVKP NVLLTHRKGQ PLA LMDFG+ARPAR+QIRSRSE 
Sbjct  163  RQLCAGLKHMHNFDPPYAHNDVKPANVLLTHRKGQTPLAKLMDFGNARPARRQIRSRSET  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEHV+APFRAPELWDCPS  DIDERTDIWSLGCTL+AIMYGVSPFEYA  ES 
Sbjct  223  LQLQEWASEHVAAPFRAPELWDCPSQCDIDERTDIWSLGCTLFAIMYGVSPFEYAFEESD  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GS QLAIVNAQ+KWPT   +  YP+ALHQFVTWMLQPQATVRP IDDIVIHVDKLISK+S
Sbjct  283  GSPQLAIVNAQIKWPTE-PNTSYPDALHQFVTWMLQPQATVRPRIDDIVIHVDKLISKYS  341



>ref|XP_010929080.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Elaeis guineensis]
Length=341

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 167/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGN+++THRKGQPPLAILMDFGS  PARK+I SRS+A
Sbjct  162  RQLCAGLKHMHSFDPPYAHNDVKPGNIMITHRKGQPPLAILMDFGSTCPARKEIHSRSQA  221

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAPFRAPELWDCPSHA+IDERTDIWSLGCTLYAIMYG SPFEY +GESG
Sbjct  222  LQLQEWAAEHCSAPFRAPELWDCPSHANIDERTDIWSLGCTLYAIMYGSSPFEYVVGESG  281

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLA++NAQ+KWP+G  DP+YPE+LHQFV WMLQPQ+ +RP+IDDI+ HVDKLISK S
Sbjct  282  GSLQLAVMNAQIKWPSG-PDPRYPESLHQFVVWMLQPQSAIRPNIDDIIFHVDKLISKHS  340



>gb|KJB19470.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=345

 Score =   325 bits (833),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHN  P YAHNDVKPGNVLL+HRKG+ PLAILMDFGSARPARKQIRSRSEA
Sbjct  166  RQLCAGLKHMHNLGPPYAHNDVKPGNVLLSHRKGKCPLAILMDFGSARPARKQIRSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTL+AIMYGVSPFEYALGESG
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSDADIDERTDIWSLGCTLFAIMYGVSPFEYALGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+NAQ+KWP G   P YPE  H FVTWMLQPQ  +RP IDDI+ HVDKL++KFS
Sbjct  286  GSLQLAIINAQIKWPAGPKQP-YPEEFHHFVTWMLQPQPALRPCIDDIIYHVDKLVTKFS  344

Query  240  H  238
             
Sbjct  345  Q  345



>ref|XP_010942233.1| PREDICTED: serine/threonine-protein kinase 16-like [Elaeis guineensis]
Length=344

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNF+P YAHNDVKPGNVL+THRKGQ PLAILMDFGSARPARK+IRSR+EA
Sbjct  165  RQLCAGLKHMHNFDPPYAHNDVKPGNVLITHRKGQQPLAILMDFGSARPARKEIRSRAEA  224

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQ+QEWA+EH SAPFRAPELWDCPS A+IDERTDIWSLGCTLYAIMYG SPFEY LGESG
Sbjct  225  LQIQEWATEHCSAPFRAPELWDCPSDANIDERTDIWSLGCTLYAIMYGSSPFEYVLGESG  284

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLA++NAQ+KW +G  DP YPE L QFV WMLQPQ  VRP+ID+I+IHVDKLISK+S
Sbjct  285  GSLQLAVMNAQIKWSSG-PDPPYPEPLRQFVVWMLQPQPAVRPNIDNIIIHVDKLISKYS  343



>ref|XP_009798655.1| PREDICTED: serine/threonine-protein kinase 16-like [Nicotiana 
sylvestris]
Length=343

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNF+P YAHNDVKP NVLLTH+KGQ PLA LMDFG+ARPAR+QI SRSEA
Sbjct  163  RQLCAGLKHMHNFDPPYAHNDVKPANVLLTHKKGQTPLAKLMDFGNARPARRQICSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEHV+APFRAPELWDCPS  DIDERTDIWSLGCTL+AIMYGVSPFEYA  ES 
Sbjct  223  LQLQEWASEHVAAPFRAPELWDCPSQCDIDERTDIWSLGCTLFAIMYGVSPFEYAFEESD  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
             SLQLAIVNAQ+KWPT   +  YP+ALHQFVTWMLQPQATVRP IDDIVIHVDKLISK+S
Sbjct  283  ESLQLAIVNAQIKWPTE-PNTSYPDALHQFVTWMLQPQATVRPRIDDIVIHVDKLISKYS  341



>ref|XP_006661175.1| PREDICTED: serine/threonine-protein kinase 16-like [Oryza brachyantha]
Length=305

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +QLC GL+HMHNF+P YAHNDVKPGNVL+TH+KGQ PLA LMDFGSARPARK IRSRSEA
Sbjct  126  QQLCEGLRHMHNFDPPYAHNDVKPGNVLITHQKGQAPLATLMDFGSARPARKTIRSRSEA  185

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            L+LQEWA+EH SAP+RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  186  LRLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  245

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN  +KWP G S P YP+ALHQFVTWMLQPQ  +RP IDDI++HV+KL+ K+S
Sbjct  246  GSLQLAIVNCTLKWPAGPS-PPYPDALHQFVTWMLQPQPAMRPQIDDIILHVEKLMEKYS  304



>ref|XP_008804427.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Phoenix dactylifera]
Length=347

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +QLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARK+IRSRSEA
Sbjct  164  QQLCAGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKEIRSRSEA  223

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAPFRAPELWDCPS+ DIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  224  LQLQEWAAEHCSAPFRAPELWDCPSYTDIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  283

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAI+NAQ+KWP    DP YP+AL QFV WMLQPQ  VRPHIDDI+IHVDKLISK+
Sbjct  284  GSLQLAIINAQIKWPP-GPDPPYPDALRQFVVWMLQPQPAVRPHIDDIIIHVDKLISKY  341



>ref|XP_008804428.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Phoenix dactylifera]
Length=346

 Score =   318 bits (815),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +QLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPLAILMDFGSARPARK+IRSRSEA
Sbjct  163  QQLCAGLKHMHSFDPPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKEIRSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAPFRAPELWDCPS+ DIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  223  LQLQEWAAEHCSAPFRAPELWDCPSYTDIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAI+NAQ+KWP    DP YP+AL QFV WMLQPQ  VRPHIDDI+IHVDKLISK+
Sbjct  283  GSLQLAIINAQIKWPP-GPDPPYPDALRQFVVWMLQPQPAVRPHIDDIIIHVDKLISKY  340



>ref|NP_001063027.1| Os09g0372800 [Oryza sativa Japonica Group]
 dbj|BAD26364.1| putative serine/threonine-protein kinase 16 [Oryza sativa Japonica 
Group]
 dbj|BAF24941.1| Os09g0372800 [Oryza sativa Japonica Group]
 gb|EAZ08870.1| hypothetical protein OsI_31131 [Oryza sativa Indica Group]
 gb|EAZ44518.1| hypothetical protein OsJ_29137 [Oryza sativa Japonica Group]
 dbj|BAG93927.1| unnamed protein product [Oryza sativa Japonica Group]
Length=337

 Score =   317 bits (813),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +QLC GLKHMH+F+P YAHNDVK GNVL+THRKGQ PLA LMDFGSARPARK+IRSR+EA
Sbjct  158  QQLCEGLKHMHSFDPPYAHNDVKTGNVLITHRKGQAPLATLMDFGSARPARKEIRSRAEA  217

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            L+LQEWA+EH SAP+RAPELWDCPSHADIDERTDIWSLGCTLYAIMY VSPFEYALGESG
Sbjct  218  LRLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWSLGCTLYAIMYNVSPFEYALGESG  277

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN  +KWP G S P YP+ALHQF+TWMLQPQ  +RPHIDDI++HV+KL+ K+S
Sbjct  278  GSLQLAIVNCTLKWPAGPS-PPYPDALHQFITWMLQPQPAMRPHIDDIILHVEKLMEKYS  336



>ref|XP_008783057.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Phoenix dactylifera]
 ref|XP_008783058.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Phoenix dactylifera]
Length=341

 Score =   318 bits (814),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGN+++THRKGQPPLAILMDFGS  PARK+IRS +EA
Sbjct  162  RQLCAGLKHMHSFDPPYAHNDVKPGNIMITHRKGQPPLAILMDFGSTCPARKEIRSPAEA  221

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQ+QEWA+EH SAPFRAPELWDCPSHA+IDERTDIWSLGCTLYAIMYG SPFEY LGESG
Sbjct  222  LQVQEWAAEHCSAPFRAPELWDCPSHANIDERTDIWSLGCTLYAIMYGSSPFEYVLGESG  281

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            G+LQLA +NAQ++WP+G  DP YPE LHQFV WMLQPQ  +RP+IDDI+ HVDKLISK+S
Sbjct  282  GNLQLAGMNAQIEWPSG-PDPPYPEPLHQFVVWMLQPQPAIRPNIDDIIFHVDKLISKYS  340



>ref|XP_008783056.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Phoenix dactylifera]
Length=345

 Score =   317 bits (813),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGN+++THRKGQPPLAILMDFGS  PARK+IRS +EA
Sbjct  166  RQLCAGLKHMHSFDPPYAHNDVKPGNIMITHRKGQPPLAILMDFGSTCPARKEIRSPAEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQ+QEWA+EH SAPFRAPELWDCPSHA+IDERTDIWSLGCTLYAIMYG SPFEY LGESG
Sbjct  226  LQVQEWAAEHCSAPFRAPELWDCPSHANIDERTDIWSLGCTLYAIMYGSSPFEYVLGESG  285

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            G+LQLA +NAQ++WP+G  DP YPE LHQFV WMLQPQ  +RP+IDDI+ HVDKLISK+S
Sbjct  286  GNLQLAGMNAQIEWPSG-PDPPYPEPLHQFVVWMLQPQPAIRPNIDDIIFHVDKLISKYS  344



>ref|XP_004956690.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
isoform X2 [Setaria italica]
Length=335

 Score =   317 bits (812),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQ+C GLKHMH+F+P YAHNDVKPGNVL+T RKGQ P+A LMDFGSARPARKQIRSRSEA
Sbjct  156  RQMCEGLKHMHSFDPPYAHNDVKPGNVLITRRKGQAPVATLMDFGSARPARKQIRSRSEA  215

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAP+RAPELWDCPSHADIDERTDIWSLGCTLYAIM+ VSPFEYALGESG
Sbjct  216  LQLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWSLGCTLYAIMFNVSPFEYALGESG  275

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAIVN Q+KWP G  +P YP+ L QFV WMLQPQA +RPHI D+V+HVDKLI+K+
Sbjct  276  GSLQLAIVNGQLKWPAG-PNPPYPDELRQFVIWMLQPQAAMRPHIGDVVLHVDKLITKY  333



>gb|ADE75600.1| unknown [Picea sitchensis]
Length=197

 Score =   311 bits (798),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 168/180 (93%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +QLCAGLKHMH+F+P YAHNDVKPGNVL+T RK QPPLA+LMDFGSA PA++++RSRS+A
Sbjct  18   KQLCAGLKHMHSFDPPYAHNDVKPGNVLITWRKSQPPLAVLMDFGSAAPAKREVRSRSQA  77

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQ+QEWA+EH SAP+RAPELWDCPS++DIDERTDIWSLGCTLYAIMYGVSPFEY+LG+SG
Sbjct  78   LQVQEWAAEHCSAPYRAPELWDCPSNSDIDERTDIWSLGCTLYAIMYGVSPFEYSLGDSG  137

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLA ++ QVKWP G ++P YP++L QFVTWMLQPQA +RPHIDD++IHVDKL++KFS
Sbjct  138  GSLQLAAMSGQVKWPPG-TNPPYPDSLRQFVTWMLQPQAAIRPHIDDVIIHVDKLLAKFS  196



>ref|XP_004956689.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
isoform X1 [Setaria italica]
Length=338

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQ+C GLKHMH+F+P YAHNDVKPGNVL+T RKGQ P+A LMDFGSARPARKQIRSRSEA
Sbjct  159  RQMCEGLKHMHSFDPPYAHNDVKPGNVLITRRKGQAPVATLMDFGSARPARKQIRSRSEA  218

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAP+RAPELWDCPSHADIDERTDIWSLGCTLYAIM+ VSPFEYALGESG
Sbjct  219  LQLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWSLGCTLYAIMFNVSPFEYALGESG  278

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAIVN Q+KWP G  +P YP+ L QFV WMLQPQA +RPHI D+V+HVDKLI+K+
Sbjct  279  GSLQLAIVNGQLKWPAG-PNPPYPDELRQFVIWMLQPQAAMRPHIGDVVLHVDKLITKY  336



>ref|XP_006844169.1| hypothetical protein AMTR_s00006p00262500 [Amborella trichopoda]
 gb|ERN05844.1| hypothetical protein AMTR_s00006p00262500 [Amborella trichopoda]
Length=338

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 169/180 (94%), Gaps = 1/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +QLCAGLKHMHNFEP+YAHNDVKPGNVL+T+RKGQPPLAILMDFGSA PA+++IRSRSEA
Sbjct  159  QQLCAGLKHMHNFEPAYAHNDVKPGNVLITNRKGQPPLAILMDFGSAGPAKREIRSRSEA  218

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAP+RAPELWDCPSHADIDERTDIW+LGCTLYAIMYG+SPFEYALGESG
Sbjct  219  LQLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWALGCTLYAIMYGMSPFEYALGESG  278

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAIVN Q+KWP    +P YP+ALHQFV WMLQPQ  +RPHI+D++IHVDKL++K+S
Sbjct  279  GSLQLAIVNGQIKWPP-GPNPPYPDALHQFVIWMLQPQVAMRPHIEDVIIHVDKLLAKYS  337



>ref|XP_006345347.1| PREDICTED: serine/threonine-protein kinase 16-like [Solanum tuberosum]
Length=335

 Score =   314 bits (805),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            QLCAGLKHMHNF+P YAHNDVK GNVLLTHRKGQ PLA LMDFG+A PAR+QIRSRSEAL
Sbjct  155  QLCAGLKHMHNFDPPYAHNDVKSGNVLLTHRKGQAPLAKLMDFGNAHPARRQIRSRSEAL  214

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            QLQEWASEH+SAPFRAPELWDC S  DIDERTDIWSLGCTL+AIMYGVSPFEYAL ES  
Sbjct  215  QLQEWASEHISAPFRAPELWDCASQCDIDERTDIWSLGCTLFAIMYGVSPFEYALEESDE  274

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            S QLAIVNAQ+KWPT   + +YP  L+QFVTWMLQPQATVRP IDDIVIHVDKLISK+S
Sbjct  275  SPQLAIVNAQIKWPTE-PNAQYPNDLNQFVTWMLQPQATVRPRIDDIVIHVDKLISKYS  332



>ref|XP_010905766.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X2 [Elaeis guineensis]
Length=346

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +QLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPL ILMDFGSARPARK+IRSRSEA
Sbjct  163  QQLCAGLKHMHSFDPPYAHNDVKPGNVLMTHRKGQPPLTILMDFGSARPARKEIRSRSEA  222

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAPFRAPELWDCPS+ DIDERTDIWSLGCTLYAIMYGV+PFEYALG+SG
Sbjct  223  LQLQEWAAEHCSAPFRAPELWDCPSYTDIDERTDIWSLGCTLYAIMYGVTPFEYALGDSG  282

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAI+NAQ+KWP    DP YP+AL QFV WMLQPQ  VRPHIDDI+IHVDKLISK+
Sbjct  283  GSLQLAIINAQIKWPP-GPDPPYPDALRQFVVWMLQPQPAVRPHIDDIIIHVDKLISKY  340



>ref|XP_010905763.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Elaeis guineensis]
 ref|XP_010905764.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Elaeis guineensis]
 ref|XP_010905765.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X1 [Elaeis guineensis]
Length=347

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +QLCAGLKHMH+F+P YAHNDVKPGNVL+THRKGQPPL ILMDFGSARPARK+IRSRSEA
Sbjct  164  QQLCAGLKHMHSFDPPYAHNDVKPGNVLMTHRKGQPPLTILMDFGSARPARKEIRSRSEA  223

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAPFRAPELWDCPS+ DIDERTDIWSLGCTLYAIMYGV+PFEYALG+SG
Sbjct  224  LQLQEWAAEHCSAPFRAPELWDCPSYTDIDERTDIWSLGCTLYAIMYGVTPFEYALGDSG  283

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAI+NAQ+KWP    DP YP+AL QFV WMLQPQ  VRPHIDDI+IHVDKLISK+
Sbjct  284  GSLQLAIINAQIKWPP-GPDPPYPDALRQFVVWMLQPQPAVRPHIDDIIIHVDKLISKY  341



>ref|XP_004252263.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Solanum lycopersicum]
Length=335

 Score =   312 bits (800),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            QLCAGLKHMH+F+P YAHNDVKPGNVLLTHRKGQ PLA LMDFG+A PAR+QIRSRSEAL
Sbjct  155  QLCAGLKHMHSFDPPYAHNDVKPGNVLLTHRKGQAPLAKLMDFGNACPARRQIRSRSEAL  214

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            QLQEWASEH+SAPFRAPELWDCPS  DIDERTDIWSLGCTL+AIMYGVSPFEYAL ES  
Sbjct  215  QLQEWASEHISAPFRAPELWDCPSQCDIDERTDIWSLGCTLFAIMYGVSPFEYALEESDE  274

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            S QLAIVNAQ+KWPT   + +YP  L+QFVTWMLQPQ TVRP IDDIVIHVDKLISK+S
Sbjct  275  SPQLAIVNAQIKWPTE-PNVQYPNDLNQFVTWMLQPQPTVRPCIDDIVIHVDKLISKYS  332



>gb|EMS68366.1| Serine/threonine-protein kinase 16 [Triticum urartu]
Length=336

 Score =   309 bits (792),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 162/180 (90%), Gaps = 2/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +Q+C GLKHMH+ +P YAHNDVKPGNVL+T RKGQ PLA LMDFGS+RPAR QIRSRSEA
Sbjct  158  QQICEGLKHMHSLDPPYAHNDVKPGNVLVTRRKGQAPLATLMDFGSSRPARNQIRSRSEA  217

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            L+LQEWA+EH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  218  LRLQEWAAEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  277

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+NAQ+KWP   S   YP+ALH+FVTWMLQPQ  +RP I+DI++HVDKL+ K+S
Sbjct  278  GSLQLAIMNAQLKWPALPS--TYPDALHKFVTWMLQPQPEMRPRINDILLHVDKLVEKYS  335



>ref|XP_008650962.1| PREDICTED: LOC100194392 isoform X1 [Zea mays]
 gb|ACF80463.1| unknown [Zea mays]
 tpg|DAA61225.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=335

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +Q+C GLKHMH+F+P YAHNDVKPGNVL+T RKGQ P+A LMDFGSARPARK+IRSRSEA
Sbjct  156  QQMCEGLKHMHSFDPPYAHNDVKPGNVLITWRKGQAPVATLMDFGSARPARKEIRSRSEA  215

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAP+RAPELWDCPSHADIDERTDIWSLGCTL+AIMY VSPFEYALGESG
Sbjct  216  LQLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWSLGCTLFAIMYNVSPFEYALGESG  275

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAIVN Q+KWP G   P YP+ L  FV WMLQP+A +RPHI D+V+HVDKLI+K+
Sbjct  276  GSLQLAIVNGQLKWPAG-PKPPYPDELRHFVIWMLQPEAVMRPHISDVVLHVDKLIAKY  333



>ref|NP_001132895.1| LOC100194392 [Zea mays]
 gb|ACF81929.1| unknown [Zea mays]
 tpg|DAA61226.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=338

 Score =   308 bits (788),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +Q+C GLKHMH+F+P YAHNDVKPGNVL+T RKGQ P+A LMDFGSARPARK+IRSRSEA
Sbjct  159  QQMCEGLKHMHSFDPPYAHNDVKPGNVLITWRKGQAPVATLMDFGSARPARKEIRSRSEA  218

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAP+RAPELWDCPSHADIDERTDIWSLGCTL+AIMY VSPFEYALGESG
Sbjct  219  LQLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWSLGCTLFAIMYNVSPFEYALGESG  278

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAIVN Q+KWP G   P YP+ L  FV WMLQP+A +RPHI D+V+HVDKLI+K+
Sbjct  279  GSLQLAIVNGQLKWPAG-PKPPYPDELRHFVIWMLQPEAVMRPHISDVVLHVDKLIAKY  336



>gb|ACG33051.1| serine/threonine-protein kinase 16 [Zea mays]
Length=335

 Score =   307 bits (787),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +Q+C GLKHMH+F+P YAHNDVKPGNVL+T RKGQ P+A LMDFGSARPARK+IRSRSEA
Sbjct  156  QQMCEGLKHMHSFDPPYAHNDVKPGNVLITWRKGQAPVATLMDFGSARPARKEIRSRSEA  215

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWA+EH SAP+RAPELWDCPSHADIDERTDIWSLGCTL+AIMY VSPFEYALGESG
Sbjct  216  LQLQEWAAEHCSAPYRAPELWDCPSHADIDERTDIWSLGCTLFAIMYNVSPFEYALGESG  275

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSLQLAIVN Q+KWP G   P YP+ L  FV WMLQP+A +RPHI D+V+HVDKLI+K+
Sbjct  276  GSLQLAIVNGQLKWPAG-PKPPYPDELRHFVIWMLQPEAAMRPHISDVVLHVDKLIAKY  333



>ref|XP_010238122.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Brachypodium 
distachyon]
Length=336

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 162/180 (90%), Gaps = 2/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQ+C G+KHMH+F+P YAHNDVKPGNVL+THRKGQ PLA LMDFGS+RPAR +IRSRSEA
Sbjct  158  RQICEGVKHMHSFDPPYAHNDVKPGNVLITHRKGQAPLATLMDFGSSRPARNKIRSRSEA  217

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            L+LQEWA+EH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  218  LRLQEWAAEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  277

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+N Q+KWP  L    YP++LH+F+TWML PQ  +RP I+DI++HVDKL+ ++S
Sbjct  278  GSLQLAIMNVQLKWP--LVPSPYPDSLHKFLTWMLHPQPAMRPRINDILLHVDKLVERYS  335



>ref|XP_010238123.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Brachypodium 
distachyon]
Length=333

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 162/180 (90%), Gaps = 2/180 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQ+C G+KHMH+F+P YAHNDVKPGNVL+THRKGQ PLA LMDFGS+RPAR +IRSRSEA
Sbjct  155  RQICEGVKHMHSFDPPYAHNDVKPGNVLITHRKGQAPLATLMDFGSSRPARNKIRSRSEA  214

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            L+LQEWA+EH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG
Sbjct  215  LRLQEWAAEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  274

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GSLQLAI+N Q+KWP  L    YP++LH+F+TWML PQ  +RP I+DI++HVDKL+ ++S
Sbjct  275  GSLQLAIMNVQLKWP--LVPSPYPDSLHKFLTWMLHPQPAMRPRINDILLHVDKLVERYS  332



>gb|KHG26284.1| Serine/threonine-protein kinase ppk13 [Gossypium arboreum]
Length=171

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 152/172 (88%), Gaps = 1/172 (1%)
 Frame = -3

Query  753  MHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASE  574
            MHN EP YAHNDVKPGNVLL+HRKG+ PLAILMDFGS RPARKQIRSRSEALQLQEWASE
Sbjct  1    MHNLEPPYAHNDVKPGNVLLSHRKGKCPLAILMDFGSTRPARKQIRSRSEALQLQEWASE  60

Query  573  HVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVN  394
            H SAPFRAPELWDC S ADIDERTDIWSLGCTL+AIMY VSPFEYALGESGGSLQLAI+N
Sbjct  61   HCSAPFRAPELWDCASDADIDERTDIWSLGCTLFAIMYEVSPFEYALGESGGSLQLAIIN  120

Query  393  AQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH  238
            AQ+KWP G   P YPE LH FVTWMLQPQ  +RP IDDI+ HVDKL++KFS 
Sbjct  121  AQIKWPAGPKQP-YPEELHHFVTWMLQPQPALRPRIDDIIYHVDKLVTKFSQ  171



>gb|EPS73700.1| hypothetical protein M569_01056 [Genlisea aurea]
Length=336

 Score =   305 bits (782),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 156/178 (88%), Gaps = 3/178 (2%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGL H+HN +P YAHN+VKPGNVLLT RKG PPLA LMDFGSARPAR+QIRSRSEA
Sbjct  161  RQLCAGLDHIHNLDPPYAHNNVKPGNVLLTFRKGHPPLATLMDFGSARPARRQIRSRSEA  220

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDCPSHADIDER+D+WSLGCTL+A+MYG SPFEY LGESG
Sbjct  221  LQLQEWASEHCSAPFRAPELWDCPSHADIDERSDVWSLGCTLFALMYGDSPFEYVLGESG  280

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
            GSLQLAI NA++KWP   S P YP+ L +FVTWMLQPQA  RP I DI+ HVDKLISK
Sbjct  281  GSLQLAIANARMKWP---SRPSYPDELRRFVTWMLQPQAAARPRIGDIITHVDKLISK  335



>ref|XP_008783059.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
isoform X3 [Phoenix dactylifera]
Length=341

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 160/180 (89%), Gaps = 5/180 (3%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHNDVKPGN+++THRKGQPPLAILMDFGS  PARK+IRS +EA
Sbjct  166  RQLCAGLKHMHSFDPPYAHNDVKPGNIMITHRKGQPPLAILMDFGSTCPARKEIRSPAEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQ+QEWA+EH SAPFRAPELWDCPSHA+IDERTDIWSLGCTL    YG SPFEY LGESG
Sbjct  226  LQVQEWAAEHCSAPFRAPELWDCPSHANIDERTDIWSLGCTL----YGSSPFEYVLGESG  281

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            G+LQLA +NAQ++WP+G  DP YPE LHQFV WMLQPQ  +RP+IDDI+ HVDKLISK+S
Sbjct  282  GNLQLAGMNAQIEWPSG-PDPPYPEPLHQFVVWMLQPQPAIRPNIDDIIFHVDKLISKYS  340



>gb|ABB72838.1| serine/threonine kinase [Elaeis guineensis]
Length=346

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 161/181 (89%), Gaps = 6/181 (3%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTH--RKGQPPLAILMDFGSARPARKQIRSRS  607
            +QLCAGLKHMH+F+P YAHNDV   N++++H  RKGQPPL ILMDFG ARPARK+IRSRS
Sbjct  164  QQLCAGLKHMHSFDPPYAHNDV---NLVISHAHRKGQPPLTILMDFGRARPARKEIRSRS  220

Query  606  EALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGE  427
            EALQLQEWA+EH SAPFRAPELWDCPS+ DIDERTDIWSLGCTLYAIMYGV+PFEYALG+
Sbjct  221  EALQLQEWAAEHCSAPFRAPELWDCPSYTDIDERTDIWSLGCTLYAIMYGVTPFEYALGD  280

Query  426  SGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
            SGGSLQLAI+NAQ+KW     DP YP+AL QFV WMLQPQ  VRPHIDDI+IHVDKLISK
Sbjct  281  SGGSLQLAIINAQIKW-PPGPDPPYPDALRQFVGWMLQPQPAVRPHIDDIIIHVDKLISK  339

Query  246  F  244
            +
Sbjct  340  Y  340



>ref|XP_010237321.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350 
[Brachypodium distachyon]
Length=362

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 153/181 (85%), Gaps = 2/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+FEP YAHN VKP NVL+T RK QP LAILMDF SARPAR+ IRS++EA
Sbjct  182  RQLCAGLKHMHSFEPPYAHNGVKPDNVLITLRKEQPHLAILMDFESARPARRAIRSQAEA  241

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SA +RAPELW+CPSHADIDERTD+WSLGCTLYA+MYG SPF+Y L ES 
Sbjct  242  LQLQEWASEHCSAHYRAPELWECPSHADIDERTDVWSLGCTLYAMMYGKSPFDYELDESA  301

Query  420  G-SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            G +L   I +AQVKW T  +   YP+AL QFVTWMLQPQ TVRPHIDDI+ HVDKLI+K+
Sbjct  302  GETLVKVIKSAQVKWSTE-TGSSYPDALRQFVTWMLQPQPTVRPHIDDIIFHVDKLIAKY  360

Query  243  S  241
            S
Sbjct  361  S  361



>gb|EMS65453.1| Serine/threonine-protein kinase 16 [Triticum urartu]
Length=306

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 150/181 (83%), Gaps = 2/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+FEP YAHN VKP NVL+T RK QP LAILMDF SARPAR+ IRS++EA
Sbjct  126  RQLCAGLKHMHSFEPPYAHNGVKPDNVLITQRKEQPHLAILMDFESARPARRAIRSQAEA  185

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SA FRAPELW+CP HADIDERTD+WSLGCTLYA+MYG SPF+Y L ES 
Sbjct  186  LQLQEWASEHCSAHFRAPELWECPPHADIDERTDVWSLGCTLYAMMYGKSPFDYELDESA  245

Query  420  G-SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            G SL   I +AQVKWPT  +   YP+ L QFVTWMLQP   VRP+IDDI+IHVDKLI+K 
Sbjct  246  GESLVTVIKSAQVKWPTE-TGSSYPDTLRQFVTWMLQPHPAVRPNIDDIIIHVDKLIAKH  304

Query  243  S  241
            S
Sbjct  305  S  305



>dbj|BAJ95332.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 150/183 (82%), Gaps = 6/183 (3%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+FEP YAHN VKP NVL+T RK QP LAILMDF SARPAR+ IRS++EA
Sbjct  161  RQLCAGLKHMHSFEPPYAHNGVKPDNVLITQRKEQPHLAILMDFESARPARRAIRSQAEA  220

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SA FRAPELW+CP HADIDERTD+WSLGCTLYA+MYG SPF+Y L ES 
Sbjct  221  LQLQEWASEHCSAHFRAPELWECPPHADIDERTDVWSLGCTLYAMMYGKSPFDYELDESA  280

Query  420  G-SLQLAIVNAQVKWP--TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLIS  250
            G SL     +AQVKWP  TG S   YP+ L QFVTWMLQP   VRPHIDDI+IHVDKLI+
Sbjct  281  GESLVTVTKSAQVKWPAETGSS---YPDTLRQFVTWMLQPHPAVRPHIDDIIIHVDKLIA  337

Query  249  KFS  241
            K S
Sbjct  338  KHS  340



>dbj|BAJ87464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 150/183 (82%), Gaps = 6/183 (3%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+FEP YAHN VKP NVL+T RK QP LAILMDF SARPAR+ IRS++EA
Sbjct  177  RQLCAGLKHMHSFEPPYAHNGVKPDNVLITQRKEQPHLAILMDFESARPARRAIRSQAEA  236

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SA FRAPELW+CP HADIDERTD+WSLGCTLYA+MYG SPF+Y L ES 
Sbjct  237  LQLQEWASEHCSAHFRAPELWECPPHADIDERTDVWSLGCTLYAMMYGKSPFDYELDESA  296

Query  420  G-SLQLAIVNAQVKWP--TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLIS  250
            G SL     +AQVKWP  TG S   YP+ L QFVTWMLQP   VRPHIDDI+IHVDKLI+
Sbjct  297  GESLVTVTKSAQVKWPAETGSS---YPDTLRQFVTWMLQPHPAVRPHIDDIIIHVDKLIA  353

Query  249  KFS  241
            K S
Sbjct  354  KHS  356



>ref|XP_004956402.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350-like 
[Setaria italica]
Length=358

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 151/181 (83%), Gaps = 2/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P YAHN VKP NVL+THRK  P LAILMDF SA PAR+ IRS++EA
Sbjct  178  RQLCAGLKHMHSFDPPYAHNAVKPDNVLITHRKELPHLAILMDFESAGPARRAIRSQAEA  237

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH S  +RAPELW+CPSHADIDERTDIWSLGCTLYA+MYG SPF+Y L ES 
Sbjct  238  LQLQEWASEHCSDQYRAPELWECPSHADIDERTDIWSLGCTLYAMMYGKSPFDYQLDESA  297

Query  420  G-SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            G SL   I +AQ+KWPT  +   YP++L QF+TWMLQP   VRPHIDDI+IHVDKLI+K+
Sbjct  298  GESLHTVIRSAQIKWPTE-AGSSYPDSLRQFITWMLQPHPAVRPHIDDIIIHVDKLITKY  356

Query  243  S  241
            S
Sbjct  357  S  357



>ref|XP_006661044.1| PREDICTED: serine/threonine-protein kinase 16-like [Oryza brachyantha]
Length=477

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P Y+HN VKP NVL+T RK QP LAILMDF SARPAR  IRS +EA
Sbjct  297  RQLCAGLKHMHSFDPPYSHNGVKPDNVLITQRKDQPHLAILMDFESARPARIVIRSEAEA  356

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SA +RAPELW+CPSH DIDERTDIWSLGCTLYA+MYG SPFEY L ES 
Sbjct  357  LQLQEWASEHCSAHYRAPELWECPSHLDIDERTDIWSLGCTLYAMMYGKSPFEYELDESA  416

Query  420  G-SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
              +LQ    NAQ+KWPT  +   YP++L QFVTWMLQP   VRPHIDDI+IHVDKLI+K+
Sbjct  417  DETLQSVTKNAQIKWPTE-AGATYPDSLRQFVTWMLQPHPAVRPHIDDIIIHVDKLIAKY  475

Query  243  S  241
            S
Sbjct  476  S  476



>ref|NP_001062642.1| Os09g0237600 [Oryza sativa Japonica Group]
 dbj|BAD33903.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF24556.1| Os09g0237600 [Oryza sativa Japonica Group]
 gb|EAZ43874.1| hypothetical protein OsJ_28494 [Oryza sativa Japonica Group]
Length=358

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 152/181 (84%), Gaps = 2/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P Y+HN VKP NVL+T RK QP LAILMDF SARPAR  IRS+++A
Sbjct  178  RQLCAGLKHMHSFDPPYSHNGVKPDNVLITQRKDQPHLAILMDFESARPARIAIRSQADA  237

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            +QLQEWASEH SA +RAPELW+CP+HADIDERTDIWSLGC LYA+MYG SPF+Y L E+ 
Sbjct  238  MQLQEWASEHCSAHYRAPELWECPTHADIDERTDIWSLGCCLYAMMYGKSPFDYELDEAA  297

Query  420  G-SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            G SLQ    +AQ+KWPT  + P YP++L QFVTWMLQP   VRPHIDDI+IHVDKLI+K+
Sbjct  298  GESLQSVTKSAQIKWPTE-AGPSYPDSLRQFVTWMLQPHPAVRPHIDDIIIHVDKLIAKY  356

Query  243  S  241
            S
Sbjct  357  S  357



>gb|EMT14968.1| Serine/threonine-protein kinase 16 [Aegilops tauschii]
Length=350

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+FEP YAHN VKP NVL+T RK QP LAILMDF SA PAR+ IRS++EA
Sbjct  170  RQLCAGLKHMHSFEPPYAHNGVKPDNVLITQRKEQPHLAILMDFESACPARRAIRSQAEA  229

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SA FRAPELW+CP HADIDERTD+WSLGCTLYA+MYG SPF+Y L ES 
Sbjct  230  LQLQEWASEHCSAHFRAPELWECPPHADIDERTDVWSLGCTLYAMMYGKSPFDYELDESA  289

Query  420  G-SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            G SL   I +AQVKWPT  +   YP+ L QFVTWMLQP   VRP+IDDI+IHVDKLI+K 
Sbjct  290  GESLVTVIKSAQVKWPTE-TGSSYPDTLRQFVTWMLQPHPAVRPNIDDIIIHVDKLIAKH  348

Query  243  S  241
            S
Sbjct  349  S  349



>gb|EAZ08255.1| hypothetical protein OsI_30510 [Oryza sativa Indica Group]
Length=358

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 151/181 (83%), Gaps = 2/181 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P Y+HN VKP NVL+T RK QP LAILMDF SARPAR  IRS+++A
Sbjct  178  RQLCAGLKHMHSFDPPYSHNGVKPDNVLITQRKDQPHLAILMDFESARPARIAIRSQADA  237

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            +QLQEWASEH SA +RAPELW+CP+HADIDERTDIWSLGC LYA+MYG SPF+Y L E+ 
Sbjct  238  MQLQEWASEHCSAHYRAPELWECPTHADIDERTDIWSLGCCLYAMMYGKSPFDYELDEAA  297

Query  420  G-SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            G SLQ    +AQ+KWP   + P YP++L QFVTWMLQP   VRPHIDDI+IHVDKLI+K+
Sbjct  298  GESLQSVTKSAQIKWPNE-AGPSYPDSLRQFVTWMLQPHPAVRPHIDDIIIHVDKLIAKY  356

Query  243  S  241
            S
Sbjct  357  S  357



>ref|XP_001779469.1| predicted protein [Physcomitrella patens]
 gb|EDQ55747.1| predicted protein [Physcomitrella patens]
Length=350

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 146/179 (82%), Gaps = 1/179 (1%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQ+CAGLKHMH   P YAHND+KPGNVL++  K  PP+A++MD GSARPAR+++R+R EA
Sbjct  161  RQICAGLKHMHTHGPPYAHNDIKPGNVLVSLPKNAPPVAVIMDMGSARPARRELRNRKEA  220

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            L LQEWAS+H +AP+RAPELWD PS A +DERTDIW+LGCTLYA+MYG+SPFEYALGE G
Sbjct  221  LALQEWASQHCTAPYRAPELWDAPSDAILDERTDIWALGCTLYALMYGISPFEYALGEQG  280

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GSL LA ++  +KWP G  +P YP++LHQFV WML P    RP I D+ IHVDKLISKF
Sbjct  281  GSLHLAAMSGVLKWPPG-PNPSYPDSLHQFVKWMLTPSVASRPFIQDVCIHVDKLISKF  338



>ref|XP_008668044.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Zea 
mays]
 tpg|DAA39534.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=354

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 3/182 (2%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC+GLKHMH+F+P YAHN VKP NVL+T RK Q  LAILMDF SA PARK IRS++EA
Sbjct  175  RQLCSGLKHMHSFDPPYAHNGVKPDNVLITQRK-QSHLAILMDFESAGPARKTIRSQAEA  233

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH S+ +RAPELW+CPSHADIDERTDIWSLGCTLYA+MYG SPF+Y L ES 
Sbjct  234  LQLQEWASEHCSSHYRAPELWECPSHADIDERTDIWSLGCTLYAMMYGKSPFDYELDESS  293

Query  420  G-SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            G SL   I N Q+KWP   +   YP++L QF+TWMLQP   VRPHIDDI+IHVDKL+ K+
Sbjct  294  GESLHSVIKNVQIKWPEE-AGSTYPDSLRQFITWMLQPHPAVRPHIDDIIIHVDKLVMKY  352

Query  243  SH  238
            S+
Sbjct  353  SN  354



>ref|NP_001149977.1| serine/threonine-protein kinase 16 [Zea mays]
 gb|ACF85515.1| unknown [Zea mays]
 gb|ACG37388.1| serine/threonine-protein kinase 16 [Zea mays]
 tpg|DAA39536.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=357

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 3/182 (2%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLC+GLKHMH+F+P YAHN VKP NVL+T RK Q  LAILMDF SA PARK IRS++EA
Sbjct  178  RQLCSGLKHMHSFDPPYAHNGVKPDNVLITQRK-QSHLAILMDFESAGPARKTIRSQAEA  236

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH S+ +RAPELW+CPSHADIDERTDIWSLGCTLYA+MYG SPF+Y L ES 
Sbjct  237  LQLQEWASEHCSSHYRAPELWECPSHADIDERTDIWSLGCTLYAMMYGKSPFDYELDESS  296

Query  420  G-SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            G SL   I N Q+KWP   +   YP++L QF+TWMLQP   VRPHIDDI+IHVDKL+ K+
Sbjct  297  GESLHSVIKNVQIKWPEE-AGSTYPDSLRQFITWMLQPHPAVRPHIDDIIIHVDKLVMKY  355

Query  243  SH  238
            S+
Sbjct  356  SN  357



>ref|XP_002991279.1| hypothetical protein SELMODRAFT_185952 [Selaginella moellendorffii]
 gb|EFJ07707.1| hypothetical protein SELMODRAFT_185952 [Selaginella moellendorffii]
Length=342

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 144/180 (80%), Gaps = 4/180 (2%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQ-PPLAILMDFGSARPARKQIRSRSE  604
            +Q+C  LK MH  +PSY+HNDVKPGNVLL+    Q PP A++MDFGSA  ARK++RSRSE
Sbjct  157  QQICQALKQMHKHDPSYSHNDVKPGNVLLSKSSNQDPPKAVVMDFGSATLARKRVRSRSE  216

Query  603  ALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGES  424
            AL +QEWA+EH SAP+RAPELWDCPS ADIDER D+WSLGCTL+AIMY VSPFE++LGE+
Sbjct  217  ALAIQEWAAEHCSAPYRAPELWDCPSIADIDERVDVWSLGCTLFAIMYCVSPFEHSLGEA  276

Query  423  GGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GGSLQLA ++ Q+KWP   S P YP + H+ V+WM++P+   RP ++ ++  V K++SKF
Sbjct  277  GGSLQLASMSGQIKWP---STPPYPRSFHKLVSWMVEPRVANRPDVEAVIAVVTKMLSKF  333



>ref|XP_002991218.1| hypothetical protein SELMODRAFT_133041 [Selaginella moellendorffii]
 gb|EFJ07762.1| hypothetical protein SELMODRAFT_133041 [Selaginella moellendorffii]
Length=342

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 143/180 (79%), Gaps = 4/180 (2%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQ-PPLAILMDFGSARPARKQIRSRSE  604
            +Q+C  LK MH  +PSY+HNDVKPGNVLL+    Q PP A++MDFGSA  ARK++RSRSE
Sbjct  157  QQICQALKQMHKHDPSYSHNDVKPGNVLLSKSSNQDPPKAVVMDFGSATLARKRVRSRSE  216

Query  603  ALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGES  424
            AL +QEWA+EH SAP+RAPELWDCPS ADIDER D+WSLGCTL+AIMY VSPFE++L E+
Sbjct  217  ALAIQEWAAEHCSAPYRAPELWDCPSIADIDERVDVWSLGCTLFAIMYCVSPFEHSLSEA  276

Query  423  GGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            GGSLQLA ++ Q+KWP   S P YP + H+ V+WM++P+   RP ++ ++  V K++SKF
Sbjct  277  GGSLQLASMSGQIKWP---STPPYPRSFHKLVSWMVEPRVANRPDVEAVIAVVTKMLSKF  333



>gb|ACN26380.1| unknown [Zea mays]
 tpg|DAA39535.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=328

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 122/151 (81%), Gaps = 2/151 (1%)
 Frame = -3

Query  687  RKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE  508
            ++ Q  LAILMDF SA PARK IRS++EALQLQEWASEH S+ +RAPELW+CPSHADIDE
Sbjct  179  QRKQSHLAILMDFESAGPARKTIRSQAEALQLQEWASEHCSSHYRAPELWECPSHADIDE  238

Query  507  RTDIWSLGCTLYAIMYGVSPFEYALGESGG-SLQLAIVNAQVKWPTGLSDPKYPEALHQF  331
            RTDIWSLGCTLYA+MYG SPF+Y L ES G SL   I N Q+KWP   +   YP++L QF
Sbjct  239  RTDIWSLGCTLYAMMYGKSPFDYELDESSGESLHSVIKNVQIKWPEE-AGSTYPDSLRQF  297

Query  330  VTWMLQPQATVRPHIDDIVIHVDKLISKFSH  238
            +TWMLQP   VRPHIDDI+IHVDKL+ K+S+
Sbjct  298  ITWMLQPHPAVRPHIDDIIIHVDKLVMKYSN  328



>ref|XP_007037719.1| Serine/threonine protein kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY22220.1| Serine/threonine protein kinase 3 isoform 3 [Theobroma cacao]
Length=279

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ EP YAHNDVKPGNVLLT RKGQPPL+ILMDFGSARPARKQI SRSEA
Sbjct  166  RQLCAGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLSILMDFGSARPARKQIHSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMY  460
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAI+Y
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIIY  272



>ref|XP_007037718.1| Serine/threonine protein kinase 3 isoform 2 [Theobroma cacao]
 gb|EOY22219.1| Serine/threonine protein kinase 3 isoform 2 [Theobroma cacao]
Length=271

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/106 (93%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+ EP YAHNDVKPGNVLLT RKGQPPL+ILMDFGSARPARKQI SRSEA
Sbjct  166  RQLCAGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLSILMDFGSARPARKQIHSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIM  463
            LQLQEWASEH SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIM
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIM  271



>ref|XP_008453331.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X3 
[Cucumis melo]
Length=288

 Score =   213 bits (542),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNF+P YAHND+KPGNVL+T RKGQPPLAILMDFGSARPAR+QI SRSEA
Sbjct  167  RQLCAGLKHMHNFDPPYAHNDIKPGNVLITRRKGQPPLAILMDFGSARPARRQISSRSEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIM  463
            LQLQEWASEH SAPFRAPELWDC SH+D+DERTDIWSLGCTLYAIM
Sbjct  227  LQLQEWASEHCSAPFRAPELWDCASHSDVDERTDIWSLGCTLYAIM  272



>ref|XP_008453330.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X2 
[Cucumis melo]
Length=311

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHNF+P YAHND+KPGNVL+T RKGQPPLAILMDFGSARPAR+QI SRSEA
Sbjct  167  RQLCAGLKHMHNFDPPYAHNDIKPGNVLITRRKGQPPLAILMDFGSARPARRQISSRSEA  226

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            LQLQEWASEH SAPFRAPELWDC SH+D+DERTDIWSLGCTLYAI   +   E A+G + 
Sbjct  227  LQLQEWASEHCSAPFRAPELWDCASHSDVDERTDIWSLGCTLYAI---IITLEMAVGPTE  283

Query  420  GSLQ  409
             SL 
Sbjct  284  KSLN  287



>gb|KJB19474.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=271

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHN  P YAHNDVKPGNVLL+HRKG+ PLAILMDFGSARPARKQIRSRSEA
Sbjct  166  RQLCAGLKHMHNLGPPYAHNDVKPGNVLLSHRKGKCPLAILMDFGSARPARKQIRSRSEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIM  463
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTDIWSLGCTL+AIM
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSDADIDERTDIWSLGCTLFAIM  271



>ref|XP_008351873.1| PREDICTED: serine/threonine-protein kinase 16-like [Malus domestica]
Length=271

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH  +P YAHND+KPGNVL+THRKGQ PLAILMDFGSARPAR+QIRSR+EA
Sbjct  166  RQLCAGLKHMHTLDPPYAHNDIKPGNVLITHRKGQSPLAILMDFGSARPARRQIRSRTEA  225

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIM  463
            LQLQEWASEH SAPFRAPELWDCPS ADIDERTD+WSLGCTLYAI+
Sbjct  226  LQLQEWASEHCSAPFRAPELWDCPSQADIDERTDVWSLGCTLYAIL  271



>emb|CDH56229.1| serine threonine protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=375

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 113/162 (70%), Gaps = 6/162 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KPGN++L    G+ P  +LMDFGSA PAR ++ +R EAL+ Q+ A+EH + P+R
Sbjct  212  WAHRDIKPGNIMLMD-DGETP--VLMDFGSACPARVEVHNRQEALKQQDIAAEHSTMPYR  268

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  +   +DE+ DIWSLGCTL+A+ YG SPFE  L E+GGS+ LA++NAQ K+P 
Sbjct  269  APELFDVKTETTLDEKVDIWSLGCTLFAMAYGQSPFEVNLNENGGSVALAVLNAQFKFP-  327

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
              +DP+Y +     ++WML    + RP I ++   +D L+S+
Sbjct  328  --NDPEYSQEFKDLISWMLTADPSTRPDIHEVSTKIDSLLSR  367



>emb|CDS09297.1| hypothetical protein LRAMOSA10657 [Absidia idahoensis var. thermophila]
Length=376

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 112/162 (69%), Gaps = 6/162 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KPGN++L    G+ P  +LMDFGSA PAR +I +R EAL+ Q+ A+EH + P+R
Sbjct  212  WAHRDIKPGNIMLMD-DGETP--VLMDFGSACPARAEIHNRQEALKQQDIAAEHSTMPYR  268

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  +   +DE+ DIWSLGCTL+A+ YG SPFE  L E+GGS+ LA++NAQ K+P 
Sbjct  269  APELFDVKTETILDEKVDIWSLGCTLFAMAYGQSPFEVNLNENGGSVALAVLNAQFKFP-  327

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
              SDP+Y +     ++WML    + RP I  +   +D L+S+
Sbjct  328  --SDPEYSQEFKDLISWMLTADPSSRPDIHQVSTRIDSLLSR  367



>gb|KJE97963.1| NAK protein kinase [Capsaspora owczarzaki ATCC 30864]
Length=288

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 117/207 (57%), Gaps = 32/207 (15%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPS-------YAHNDVKPGNVLLT-HRKGQPPLA-------------  664
            R +C G+K +H + P        YAH D+KPGNVLL  H +   P A             
Sbjct  85   RGICLGVKALHQYTPPMRNNRMPYAHRDLKPGNVLLADHAESGAPFARSASASVPAGMAD  144

Query  663  --------ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE  508
                    ILMDFGS  PAR +I SR EALQLQ+ A+E  + P+RAPEL+D PS   IDE
Sbjct  145  TPLDRLTPILMDFGSMAPARVKITSRLEALQLQDLAAEKCTMPYRAPELFDVPSDTTIDE  204

Query  507  RTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFV  328
            R DIW+LGC LY++MY  SPFE A  E GGS+ LA+++ +V +   L    +  +L   V
Sbjct  205  RVDIWALGCILYSLMYLQSPFESAANEQGGSIALAVISGRVNF---LPQFNHSASLQNLV  261

Query  327  TWMLQPQATVRPHIDDIVIHVDKLISK  247
             +ML      RPHID ++  +D + S+
Sbjct  262  KFMLVVSHEARPHIDQVIEEIDAISSR  288



>ref|XP_004342629.1| serine/threonine protein kinase [Capsaspora owczarzaki ATCC 30864]
Length=340

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 117/207 (57%), Gaps = 32/207 (15%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPS-------YAHNDVKPGNVLLT-HRKGQPPLA-------------  664
            R +C G+K +H + P        YAH D+KPGNVLL  H +   P A             
Sbjct  137  RGICLGVKALHQYTPPMRNNRMPYAHRDLKPGNVLLADHAESGAPFARSASASVPAGMAD  196

Query  663  --------ILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDE  508
                    ILMDFGS  PAR +I SR EALQLQ+ A+E  + P+RAPEL+D PS   IDE
Sbjct  197  TPLDRLTPILMDFGSMAPARVKITSRLEALQLQDLAAEKCTMPYRAPELFDVPSDTTIDE  256

Query  507  RTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFV  328
            R DIW+LGC LY++MY  SPFE A  E GGS+ LA+++ +V +   L    +  +L   V
Sbjct  257  RVDIWALGCILYSLMYLQSPFESAANEQGGSIALAVISGRVNF---LPQFNHSASLQNLV  313

Query  327  TWMLQPQATVRPHIDDIVIHVDKLISK  247
             +ML      RPHID ++  +D + S+
Sbjct  314  KFMLVVSHEARPHIDQVIEEIDAISSR  340



>emb|CEP11100.1| hypothetical protein [Parasitella parasitica]
Length=332

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            Q+ A  K+       +AH D+KP N+LL+   G+ P  ILMDFGSAR AR +I +R  A+
Sbjct  158  QVLATYKNRAGVSIPWAHRDIKPANILLSD-DGKTP--ILMDFGSARLARVEITNRQTAM  214

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            + Q+ A+E+ S P+RAPEL+D  S   + E+ DIWSLGCTL+ + YG SPFE  + + GG
Sbjct  215  KQQDDAAENCSMPYRAPELFDVKSGTTLTEKVDIWSLGCTLFTMAYGTSPFEMTINQQGG  274

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLIS  250
            ++ LA++N Q  +P    D  Y + L   ++WML      RP+ID+++  +D++IS
Sbjct  275  TIALAVLNKQFSFPNSKKDV-YSQKLKDLISWMLNIDPDARPNIDEVIFAIDQVIS  329



>gb|EPB91820.1| NAK protein kinase [Mucor circinelloides f. circinelloides 1006PhL]
Length=364

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 109/164 (66%), Gaps = 7/164 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KPGNVL++   G+ P  ILMDFGSA  AR Q+ +R EALQ Q+ A+E  + P+R
Sbjct  206  WAHRDIKPGNVLISD-DGETP--ILMDFGSACAARIQVNTRQEALQQQDLAAEQCTMPYR  262

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  +   +DE+ DIWSLGCTLYA+ YG SPFE  + + GGS+ LA++N Q K+P 
Sbjct  263  APELFDVKTGTTLDEKVDIWSLGCTLYAMAYGQSPFEVNM-DQGGSVALAVLNNQYKFP-  320

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
               D +Y + L++ + WML      RP I  ++  +D L+ K S
Sbjct  321  --EDSQYSKELNETIRWMLTANPATRPSIQQVIAKLDDLLKKSS  362



>gb|EPB88047.1| NAK protein kinase [Mucor circinelloides f. circinelloides 1006PhL]
Length=329

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 110/176 (63%), Gaps = 4/176 (2%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            Q+ A  K+       +AH D+KP NVLL+   G+ P  +LMDFGSARPAR  I  R  A+
Sbjct  158  QVLASYKNRAGVSIPWAHRDIKPANVLLSD-DGKTP--VLMDFGSARPARVDIVDRQTAM  214

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            + Q+ A+E+ S P+RAPEL+D  +   + E+ D+WSLGCTL+A+ YG SPFE  + + GG
Sbjct  215  KQQDDAAENCSMPYRAPELFDVKTGTTLTEKVDVWSLGCTLFAMAYGESPFEMTVNQQGG  274

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLIS  250
            ++ LA++N Q  +P    D  Y   L   ++WML      RP+ID ++  V+K+IS
Sbjct  275  TMALAVLNRQFYFPHAKKD-MYSRTLQDLISWMLNTDPNTRPNIDKVISAVNKVIS  329



>gb|ESA00209.1| hypothetical protein GLOINDRAFT_338668 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX74430.1| Env7p [Rhizophagus irregularis DAOM 197198w]
Length=361

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 108/164 (66%), Gaps = 3/164 (2%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KPGN+LLT      P  ILMDFGS   AR +I++R+EAL  Q+ AS+H + P+R
Sbjct  200  FAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYR  257

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  ++ +++E+ DIWSLGCTLYA+ YG SPF+  + E GGS+ LA++NAQ ++P 
Sbjct  258  APELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPP  317

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
               D KY       +++ML+     RP I  ++  VD  + + S
Sbjct  318  TEQD-KYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS  360



>dbj|GAN07621.1| pkinase-domain-containing protein [Mucor ambiguus]
Length=346

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 105/165 (64%), Gaps = 7/165 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KPGNVL++     P   ILMDFGSA  AR Q+ +R EALQ Q+ A+E  + P+R
Sbjct  188  WAHRDIKPGNVLISDDGDIP---ILMDFGSACAARIQVNTRQEALQQQDLAAEQCTMPYR  244

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  +   +DE+ DIWSLGCTLYA+ YG SPFE  + + GGS+ LA++N Q K P 
Sbjct  245  APELFDVKTGTTLDEKVDIWSLGCTLYAMAYGQSPFEVNM-DQGGSVALAVLNNQYKIP-  302

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH  238
               D  Y + ++  + WML      RP I  ++  +D L+ + S+
Sbjct  303  --QDSNYSKQVNDTIQWMLTANPATRPSIQQVIAKLDDLLKESSN  345



>gb|KFM72644.1| Serine/threonine-protein kinase 16, partial [Stegodyphus mimosarum]
Length=329

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 110/177 (62%), Gaps = 9/177 (5%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSE  604
            RQ+C G++ MHN +P   AH DVKP NVL+++        + MDFGS   AR++IR  SE
Sbjct  154  RQMCEGIRIMHNAQPYPLAHRDVKPANVLMSNDDS----PVWMDFGSMGRARQEIRKASE  209

Query  603  ALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGES  424
            A  LQ++A+E  S  FRAPEL++  SH+ IDER D+WSLGC LYA+ Y  SPF+ A  + 
Sbjct  210  ARALQDFAAEKCSMAFRAPELFNVESHSSIDERVDVWSLGCCLYAMCYFKSPFDAAY-QR  268

Query  423  GGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
            G S+ LA+++  +++P       Y   +H  +  ML+  A  RP ID ++  +D L+
Sbjct  269  GDSVALAVISGVIEFP---EITPYGTGMHNLIKSMLEVSALQRPFIDGVLFQIDSLL  322



>ref|XP_004348721.1| serine/threonine protein kinase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22207.1| serine/threonine protein kinase [Acanthamoeba castellanii str. 
Neff]
Length=303

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 110/175 (63%), Gaps = 6/175 (3%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            LC GL  +H+  P   H D+K  NVLL+    Q   AILMDFGS   AR+ IRS ++A++
Sbjct  134  LCKGLAVLHSHSPPLVHRDLKCLNVLLSDDGRQ---AILMDFGSVAKARRAIRSHADAVK  190

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            L+E A +  S  +R PEL+D P +ADIDERTDIWSLGCTLY + YG +PFE A    G S
Sbjct  191  LEEEADKSCSPMYRPPELYDPPFNADIDERTDIWSLGCTLYEMAYGKNPFEEAYTHQGAS  250

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLIS  250
            ++L+ ++ ++ +P    D  + E L   V  ++      RP+ID+++  V++++S
Sbjct  251  IKLSAMSGRIDFP---RDGHHSEELQSLVRRLMHKNMDERPYIDEVIHSVERMLS  302



>gb|KFH73600.1| NAK protein kinase [Mortierella verticillata NRRL 6337]
Length=398

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 3/162 (2%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KP NVL+    GQ P  +LMDFGS   AR +I++R +AL  Q+ A+E  S P+R
Sbjct  238  FAHRDIKPANVLIAD-DGQTP--VLMDFGSMARARVKIQTRQQALHEQDLAAEQCSMPYR  294

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  + A +DE+ DIWSLGCTLYA+ YG SPFE      GGS+ LA++N  V++PT
Sbjct  295  APELFDVKTGATLDEKVDIWSLGCTLYAMAYGTSPFETNQMNQGGSIALAVLNGTVRFPT  354

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
                 +Y       V  ML  + T R  I  ++  VD L+S+
Sbjct  355  ADQQDRYSTEFRTLVKSMLVVEPTDRLDIHQVIDQVDILLSR  396



>emb|CEG84388.1| Putative NAK protein kinase [Rhizopus microsporus]
Length=236

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 103/161 (64%), Gaps = 7/161 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KPGNVL+    GQ   A+LMDFGSA  AR  I +R EAL  Q+ A+EH + P+R
Sbjct  80   WAHRDIKPGNVLIAD-DGQT--AVLMDFGSACQARIHIENRQEALAQQDLAAEHCTMPYR  136

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  +   IDE+ DIWSLGCTLYA+ YG SPFE    + GGS+ LA++N Q K+P 
Sbjct  137  APELFDVKTGTTIDEKVDIWSLGCTLYAMAYGQSPFEMNT-DQGGSVALAVLNNQYKFP-  194

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLIS  250
                  Y + +   + WML    + RP I  ++  +D++++
Sbjct  195  --ESNVYSQNVKDLIQWMLTTDPSSRPDIHQVLSKLDEVLN  233



>ref|XP_004622575.1| PREDICTED: serine/threonine-protein kinase 16-like, partial [Sorex 
araneus]
Length=197

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 111/176 (63%), Gaps = 9/176 (5%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            R +C GL  +H+    + H D+K  NVLL+    +   A+LMDFGSARPAR ++++ S A
Sbjct  28   RDICHGLNVLHSLPEPFVHGDLKAANVLLSDDDDR---AVLMDFGSARPARFEVKNESLA  84

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADI-DERTDIWSLGCTLYAIMYGVSPFEYALGES  424
             ++QE+A+EH S  +RAPEL+  P   DI D+RTDIWSLGC LYA+ + VSPFE A    
Sbjct  85   RKIQEYAAEHCSMYYRAPELF-TPKVGDILDQRTDIWSLGCLLYALCFWVSPFEEA-ANR  142

Query  423  GGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            G SL L  ++ + + P   S   Y +ALH  +T ML+   + RP + D++  +DK+
Sbjct  143  GDSLPLIFLSLKYRIP---SKSPYSKALHDMITLMLEVDPSCRPFLSDVIDRLDKI  195



>ref|XP_500508.1| YALI0B04840p [Yarrowia lipolytica]
 emb|CAG82736.1| YALI0B04840p [Yarrowia lipolytica CLIB122]
Length=357

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 97/153 (63%), Gaps = 7/153 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KP N++L+   G+P   ILMD GS   AR  + SR +AL+LQ+ A+E  S P+R
Sbjct  202  YAHRDIKPANIMLSD-NGRP---ILMDLGSCSRARIDVSSRQKALELQDMAAEQCSMPYR  257

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  + A+IDER D+WSLGCT+Y +MY  SPFE+   E+G SL LAI+N     P 
Sbjct  258  APELFDVKTGANIDERVDVWSLGCTIYTLMYFTSPFEHQTNETGASLNLAIMNGHFTMP-  316

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
              + P+Y + L   V   L      RP IDD++
Sbjct  317  --ASPEYSDQLKGLVKKCLIVDPQERPFIDDVL  347



>dbj|GAM27617.1| hypothetical protein SAMD00019534_107930 [Acytostelium subglobosum 
LB1]
Length=306

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 110/176 (63%), Gaps = 7/176 (4%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQ+   +   H+ +P  AH D+KPGNVLL+  K +P   +LMDFGS   AR ++ SR +A
Sbjct  138  RQILDAIAQFHHCDPPLAHRDIKPGNVLLSDEK-KP---VLMDFGSTTQARIRVTSRKQA  193

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            L++QE A +H +  ++APEL+D  S  ++DERTDIW+LGC LYA+ +  SPFE ++  + 
Sbjct  194  LEVQEEADQHSTPLYKAPELFDVASDCNLDERTDIWALGCLLYAMSFNRSPFESSMDNNS  253

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
            GS+ L++++ +V  P   S   +   L Q +  ML      RP ID+++  VD ++
Sbjct  254  GSVALSVLSGRVDIPASHS---FSNELIQLIRSMLSLNPQERPFIDNVIQQVDAML  306



>ref|XP_005096441.1| PREDICTED: serine/threonine-protein kinase 16-like [Aplysia californica]
Length=308

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 106/174 (61%), Gaps = 8/174 (5%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C G+K +H+  P YAH D+KP NV+ TH  G P   ++MD GSA PAR +I +  +A  
Sbjct  136  ICKGIKALHDHNPPYAHRDIKPDNVM-THDDGTP---VVMDLGSAAPARMEIHTARQATS  191

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            LQ+ A+E  S  +RAPEL+   +++ IDERTDIWSLGC LYA+ Y  SPFE A  + G S
Sbjct  192  LQDTAAERCSMLYRAPELFTVETNSSIDERTDIWSLGCVLYALAYLESPFESAY-QRGDS  250

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
            L LA +  ++ +P      +Y   ++  + WML+     RP ID ++  +  +I
Sbjct  251  LALATMAGKINFPDS---SEYSSKINDIILWMLKSDPQERPFIDQVLDRLHSII  301



>dbj|GAA94070.1| hypothetical protein E5Q_00717 [Mixia osmundae IAM 14324]
 gb|KEI41783.1| hypothetical protein L969DRAFT_45043 [Mixia osmundae IAM 14324]
Length=421

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 107/173 (62%), Gaps = 5/173 (3%)
 Frame = -3

Query  765  GLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQE  586
            G K      P +AH D+KP N+++T   GQ   AILMDFGSA PAR ++ SRS AL  Q+
Sbjct  249  GAKQRGKMTP-WAHRDIKPANIMVTD-DGQD--AILMDFGSAAPARVEVPSRSVALTQQD  304

Query  585  WASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQL  406
             A+E  S PFRAPEL+D  +  D+D++ DIWSLGCTL+A+ +  SPFE    + GGS+ +
Sbjct  305  LAAEQCSMPFRAPELFDVKTGQDLDQKVDIWSLGCTLFALAFHHSPFETEQEQQGGSIAM  364

Query  405  AIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
            A++N Q K+P+G  D KY + L   ++ ML      RP I  ++      +++
Sbjct  365  AVLNGQYKFPSGSGD-KYSQPLKDLISSMLIVDPESRPDIHQVITSTKAALAR  416



>dbj|GAN03135.1| Ser/Thr protein kinase [Mucor ambiguus]
Length=352

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            Q+ A  K+       +AH D+KP NVLL+   G+ P  +LMDFGSARPA   I  R  A+
Sbjct  158  QVLASYKNRAGVSIPWAHRDIKPANVLLSD-DGKTP--VLMDFGSARPAHIDIADRQTAM  214

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            + Q+ A+E+ S P+RAPEL+D      + E+ D+WSLGCTL+A+ YG SPFE  + + GG
Sbjct  215  KQQDDAAENCSMPYRAPELFDVKKGTTLTEKVDVWSLGCTLFAMAYGESPFEMTINQQGG  274

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDD  280
            ++ LA++N Q  +P    D  Y + L   ++WML      RP I D
Sbjct  275  TMALAVLNRQFYFPHAKKDV-YSKTLQDLISWMLNTDPDARPIIKD  319



>ref|XP_009045048.1| hypothetical protein LOTGIDRAFT_223991 [Lottia gigantea]
 gb|ESP04238.1| hypothetical protein LOTGIDRAFT_223991 [Lottia gigantea]
Length=313

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 108/180 (60%), Gaps = 9/180 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            Q+C GLK MH+  P YAH DVKP NV++    G     ILMD GSA  AR +I++ ++  
Sbjct  141  QICEGLKAMHHHNPPYAHRDVKPANVMI----GDDSTPILMDLGSAAKARVEIKTSAQGR  196

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
             LQ+ A+E  S  +RAPEL++  +H+ IDERTDIWSLGC LYA+ Y  SPFE ++ + G 
Sbjct  197  ALQDQAAERCSMLYRAPELFNVETHSTIDERTDIWSLGCVLYAMAYLESPFE-SVYQRGD  255

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH  238
            S+ LA++   +K+     D  Y   + + V +++      RP ID+ +  V  +I+   +
Sbjct  256  SIALAVMGRNLKF----KDIGYSHNVEETVCFLMAINPMERPFIDNAIDKVTDIINSMEN  311



>gb|ENN77639.1| hypothetical protein YQE_05933, partial [Dendroctonus ponderosae]
 gb|ERL90265.1| hypothetical protein D910_07617 [Dendroctonus ponderosae]
Length=318

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 107/172 (62%), Gaps = 9/172 (5%)
 Frame = -3

Query  774  LCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            +C  +K+MH+F P   AH D+K GNV LT         ILMD GS  PA++QI    +A 
Sbjct  145  ICQAVKYMHDFSPEPIAHRDLKTGNVCLTDNLD----PILMDLGSCAPAKQQICGTQDAQ  200

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
            +L++ A+E  S  +RAPEL+   S+  ID++TDIWSLGC LYA++Y  SPF+ A+ E G 
Sbjct  201  KLEDIAAERCSMTYRAPELFHVESYCVIDQKTDIWSLGCLLYALLYFKSPFD-AVYERGD  259

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVD  262
            S+ LA+++  + +P    D  +P+ LH  +  +L+     RP+IDD++  VD
Sbjct  260  SVNLAVISGNIYFP---EDAPFPKELHDQILSILKVNPAERPYIDDVIEQVD  308



>emb|CEP08159.1| hypothetical protein [Parasitella parasitica]
Length=309

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH DVKPGN+L++   G+ P  ILMDFGS   AR  IR+R + L  Q+ A+EH + P+R
Sbjct  160  YAHRDVKPGNILISD-DGKTP--ILMDFGSVTKARIHIRTRQDGLLQQDIAAEHSTIPYR  216

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  + + +DE+ DIWSLGCT+YA  YG +PFE ++ E GGS+ LAI+N   K+P 
Sbjct  217  APELYDVQTGSTLDEKVDIWSLGCTMYAAAYGQNPFEASVSEMGGSIALAILNGHYKFPL  276

Query  372  GLS-DPKYPEALHQFVTWMLQPQATVRPHI  286
                D  + +     V ++L      RP I
Sbjct  277  DKEQDDPFGDEFKNLVRFLLVVDPKERPDI  306



>emb|CEP18224.1| hypothetical protein [Parasitella parasitica]
Length=1185

 Score =   144 bits (364),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 105/163 (64%), Gaps = 7/163 (4%)
 Frame = -3

Query  732   YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
             +AH D+KPGNVL++   G+ P  +LMDFGSA  AR  I +R EALQ Q+ A+E  + P+R
Sbjct  1027  WAHRDIKPGNVLISD-DGETP--VLMDFGSACAARIHITTRQEALQQQDLAAEQCTMPYR  1083

Query  552   APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
             APEL+D  +   + E+ DIWSLGCTL+A+ YG SPFE  + + GGS+ LA++N Q K+P 
Sbjct  1084  APELFDVKTGTTLSEKVDIWSLGCTLFAMAYGQSPFEVNM-DQGGSVALAVLNNQYKFP-  1141

Query  372   GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
                   Y + + + + WML    + RP I  ++  +D L++K 
Sbjct  1142  --DKSNYSKDVDETIQWMLTADPSKRPTIQQVIGKLDDLLNKI  1182



>ref|XP_011273085.1| SNF1-related protein kinase catalytic subunit alpha [Wickerhamomyces 
ciferrii]
 emb|CCH45092.1| SNF1-related protein kinase catalytic subunit alpha [Wickerhamomyces 
ciferrii]
Length=377

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 97/154 (63%), Gaps = 6/154 (4%)
 Frame = -3

Query  735  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF  556
            +YAH D+KP NV+L+ + G P   +L+D GS   AR + ++RS A+ +QE A+EH + P+
Sbjct  219  AYAHKDIKPSNVMLS-KDGLP---VLVDLGSCSKARVKAKTRSAAIAIQELAAEHCTLPY  274

Query  555  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP  376
            RAPEL D  + + IDE+ DIWSLGCTLYA++YG SPFEY   E+G S+ LAI N  + +P
Sbjct  275  RAPELLDVKTGSKIDEKIDIWSLGCTLYALLYGCSPFEYEENENGASITLAISNGTLNFP  334

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
                   Y + L   +   +      RP I+D++
Sbjct  335  K--KGDLYSDELKSLIKMCIVIDPEERPSIEDVL  366



>gb|EFA83040.1| putative protein serine/threonine kinase [Polysphondylium pallidum 
PN500]
Length=310

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 101/179 (56%), Gaps = 16/179 (9%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQP-------------PLAILMDFGSA  640
            RQ+C G+   H+ +P  AH D+KPGNVLL                     + ILMDFGS 
Sbjct  113  RQICEGIAQFHHSDPPLAHRDIKPGNVLLADSNNNNNNNNSSNSSSSSNKIPILMDFGST  172

Query  639  RPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMY  460
             PAR  + SR +AL++QE A +H +  +RAPEL+D  S   +DERTDIW+LGC LY++ +
Sbjct  173  GPARLTVTSRKQALEIQEDADQHSTPLYRAPELFDVSSDCQLDERTDIWALGCLLYSMAF  232

Query  459  GVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHID  283
              SPFE +  +  GS+ L++++ Q + P   S   + + L   +  MLQ     RP ID
Sbjct  233  NKSPFESSSEDKSGSIALSVISGQFEIPKSHS---FSKELIDLIRSMLQLNIQDRPSID  288



>ref|XP_002504178.1| serine/threonine-protein kinase [Micromonas sp. RCC299]
 gb|ACO65436.1| serine/threonine-protein kinase [Micromonas sp. RCC299]
Length=391

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 112/193 (58%), Gaps = 17/193 (9%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTH-------RKGQPP---LAILMDFGSARPAR  628
            QLC GL+HMH      AH DVKPGNVLL          +G  P    A+LMDFGSAR A 
Sbjct  189  QLCRGLEHMHAL--GIAHYDVKPGNVLLESVMDSMDGAEGSCPGGFRAVLMDFGSARTAT  246

Query  627  KQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHAD--ID-ERTDIWSLGCTLYAIMY-  460
            + + SR EAL++QE A    +APFRAPELWDCPS  D  ID    D+WSLGC L+++   
Sbjct  247  RAVASRQEALRVQECAERESTAPFRAPELWDCPSGGDATIDGGACDVWSLGCALFSLTSG  306

Query  459  GVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDD  280
            G SPFE A GE+GGSL LA+++ + +W    +   Y       +  M+   A+ RP+   
Sbjct  307  GKSPFESASGETGGSLALAVLSGKYRWGES-ARLAYGTETRAAIDSMISRDASSRPNAVA  365

Query  279  IVIHVDKLISKFS  241
              + +++ ++  S
Sbjct  366  ARLALERAMTSAS  378



>dbj|GAN05866.1| pkinase-domain-containing protein [Mucor ambiguus]
Length=342

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGN+L++     P   ILMDFGS   AR  IRSR + L  Q+ A+E+ + P+R
Sbjct  184  YAHRDLKPGNILISDDGKTP---ILMDFGSVMKARIHIRSRQDGLLQQDIAAENSTIPYR  240

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  + + +DE+ DIWSLGCT+YA  YG +PFE ++ E GGS+ LAI+N   K+P 
Sbjct  241  APELYDVQTGSTLDEKVDIWSLGCTIYAAAYGQNPFEASVNEMGGSIALAILNGHYKFPL  300

Query  372  GLS-DPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
                D  Y +   + + ++L      RP I  ++  ++ ++
Sbjct  301  DKEQDDPYSDEFKELIQFLLVIDPKERPTIQQVIEKLESIL  341



>ref|XP_002838172.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ82363.1| unnamed protein product [Tuber melanosporum]
Length=387

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 105/168 (63%), Gaps = 10/168 (6%)
 Frame = -3

Query  735  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF  556
            +YAH D+KPGNV++     +P   ILMDFGS  PA   I SR+ AL +Q+ A+EH + P+
Sbjct  215  AYAHRDIKPGNVMIDDDGLRP---ILMDFGSMTPAPTPITSRTLALSVQDNAAEHSTMPY  271

Query  555  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP  376
            RAPEL+D  + + IDE+ DIWS+GCTLY  +YG SPFE A  ESGGSL LA+ +    +P
Sbjct  272  RAPELFDVKTGSVIDEKVDIWSMGCTLYCALYGDSPFELATEESGGSLALAVCSGSYTFP  331

Query  375  -TGLSDPKYP------EALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
              G    + P      E + + V   L+ +   RP+I +++  V+++I
Sbjct  332  EEGRLGGRKPGQRPVSEGVKEIVRMCLKVEPADRPNIRELIREVERVI  379



>gb|KIY64992.1| Pkinase-domain-containing protein [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=397

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 102/165 (62%), Gaps = 9/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    GQP   ILMDFGSA  AR  I +RS+AL  Q+ A+E  +  +R
Sbjct  241  YAHRDIKPGNVMIAD-NGQP---ILMDFGSAVKARIHIENRSQALLQQDIAAEQSTMAYR  296

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NA+ K P
Sbjct  297  APELFDVKTGTTLDEKVDIWSLGCTLYAMAYSHSPFENTQTTEQGGSIAMAVLNARYKHP  356

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                +  Y + L   +  ML+   + RP ID ++   ++++   S
Sbjct  357  ----NSAYSQGLKDLIDSMLKTDPSQRPDIDKVIDMAERVLQSLS  397



>ref|XP_006563128.1| PREDICTED: serine/threonine-protein kinase 16-like [Apis mellifera]
Length=318

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 105/181 (58%), Gaps = 9/181 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C G+K  H  +P   AH D+K  N+LL    G  P  I+MD GS  PAR +I     A
Sbjct  144  QICEGVKAFHEAKPEPLAHRDLKTANILLD--DGSTP--IIMDLGSVAPARIKICGSQAA  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P+RAPEL++  S+  +DERTDIWSLGC LYA+ Y  SPF+  + E G
Sbjct  200  QTLQDLAAERCSMPYRAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-TVYERG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
             S+ LA+++A + +P    D  Y E +   +  ML+     RP+I  ++  V  +ISK  
Sbjct  259  DSVALAVISANIIFP---EDAPYTEDIQNLILLMLKVNPMERPYIYSVIEKVHDIISKLE  315

Query  240  H  238
            +
Sbjct  316  N  316



>gb|KJA16857.1| hypothetical protein HYPSUDRAFT_46891 [Hypholoma sublateritium 
FD-334 SS-4]
Length=418

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 100/165 (61%), Gaps = 8/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGN+++    G+ P  ILMDFGS   AR  I +RS+AL  Q+ A+E  +  +R
Sbjct  261  YAHRDLKPGNIMIAD-DGKTP--ILMDFGSTMLARVHIENRSQALLQQDIAAEQSTMAYR  317

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG-ESGGSLQLAIVNAQVKWP  376
            APEL+D  +   IDE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  318  APELFDVKTGQTIDEKVDIWSLGCTLYALAYSHSPFENTQTIEQGGSIAMAVLNAQYKHP  377

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                   Y + L   +  ML+   T RP I+ ++   D++I   S
Sbjct  378  QS----AYSQGLKNLIDSMLKVNPTDRPDINQVIAMTDRVIQSLS  418



>gb|KIO15191.1| hypothetical protein M404DRAFT_991904 [Pisolithus tinctorius 
Marx 270]
Length=423

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 99/170 (58%), Gaps = 9/170 (5%)
 Frame = -3

Query  747  NFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHV  568
            N    YAH D+KPGNV+L    G P   ILMDFGS   AR  I SRS+AL  Q+ A+E  
Sbjct  262  NLHVPYAHRDIKPGNVMLAD-DGTP---ILMDFGSTVKARIPIESRSQALVQQDIAAEQS  317

Query  567  SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNA  391
            +  +RAPEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NA
Sbjct  318  TMAYRAPELFDVKTGITLDEKVDIWSLGCTLYAMAYSHSPFENTQTTEQGGSIAMAVLNA  377

Query  390  QVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            Q   P    D  Y + L + +  +L+     RP I  +V   D L+  F+
Sbjct  378  QYSHP----DSAYSQGLRELIDMLLKVNPKDRPDIHQVVAATDNLLRSFA  423



>ref|XP_003485183.1| PREDICTED: serine/threonine-protein kinase 16-like isoform 1 
[Bombus impatiens]
Length=318

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 105/181 (58%), Gaps = 9/181 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C G+K  H   P   AH D+K  N++L    G  P  ILMD GS  PAR +I     A
Sbjct  144  QICEGVKAFHETTPEPLAHRDLKTANIVLD--DGNTP--ILMDLGSVAPARVKICGSQAA  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P++APEL++  S+  +DERTDIWSLGC LYA+ Y  SPF+ A+ E G
Sbjct  200  QSLQDLAAERCSMPYKAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-AVYERG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
             S+ LA+++A + +P    D  Y E +   +  ML+     RP+I  ++ +V   ISK  
Sbjct  259  DSVALAVMSANITFP---EDAPYTEEMQNLILSMLKVNPMERPYIYSVIENVQDYISKLE  315

Query  240  H  238
            +
Sbjct  316  N  316



>gb|ACU19230.1| unknown [Glycine max]
Length=230

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMH+F+P +AHNDVKPGNVL+THRKGQPPLAILMDFGSARPARKQI SRSEA
Sbjct  164  RQLCAGLKHMHSFDPPHAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKQIGSRSEA  223

Query  600  LQLQEWA  580
            LQLQEWA
Sbjct  224  LQLQEWA  230



>ref|XP_007402665.1| hypothetical protein PHACADRAFT_266143 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM48782.1| hypothetical protein PHACADRAFT_266143 [Phanerochaete carnosa 
HHB-10118-sp]
Length=348

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 9/164 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    G+P   ILMDFGSA  AR +I +RS+AL  Q+ A+E  +  +R
Sbjct  193  YAHRDLKPGNVMVAD-DGRP---ILMDFGSATKARIKIENRSQALLQQDIAAEQSTMAYR  248

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTL+A+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  249  APELFDVKTGITLDEKVDIWSLGCTLFALAYSHSPFENTQTTEQGGSIAMAVMNAQYKHP  308

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            +     +Y + L + +   L+     RP I  +V   DKL+ + 
Sbjct  309  SS----QYSQGLKELIDSTLKVNPQDRPDIHQVVEMTDKLLQRL  348



>gb|KHJ34990.1| putative serine threonine protein kinase [Erysiphe necator]
Length=405

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 109/178 (61%), Gaps = 16/178 (9%)
 Frame = -3

Query  735  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF  556
            +YAH D+KPGN+++     QP   ILMD GS  P+   I SRS AL +Q+ A+EH + P+
Sbjct  231  AYAHRDIKPGNIMIDDDGEQP---ILMDLGSIAPSPIAITSRSLALAVQDTAAEHSTMPY  287

Query  555  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP  376
            RAPEL+D  + ++ID + DIWSLGCTLYA + G SPFE    E+GGSL + +++   ++P
Sbjct  288  RAPELFDVKTGSNIDTKVDIWSLGCTLYACLIGKSPFEMRSDETGGSLSICVLSGDWRFP  347

Query  375  -----------TGLSDP--KYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                         + +P  +  E++ + V   L+ + T RP +++++   + +I+KFS
Sbjct  348  DEGNGGKKAKSKAVKEPISEINESIREVVRKCLKVEPTERPDVNELIAMTEDIIAKFS  405



>ref|XP_006440850.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
 gb|ESR54090.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
Length=221

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            ++CAGLKHMH+ EP YAHNDVKPGN+L+T RKGQPPLAILMDFGSARPARKQIRSRSEAL
Sbjct  119  KICAGLKHMHSLEPPYAHNDVKPGNILITCRKGQPPLAILMDFGSARPARKQIRSRSEAL  178

Query  597  QLQEWASEHVSAPFRAPELWDCPS  526
            QLQEWA+E V       EL  C +
Sbjct  179  QLQEWAAEIV---LHLSELLSCGT  199



>gb|EWM24320.1| serine threonine protein kinase [Nannochloropsis gaditana]
Length=401

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 110/196 (56%), Gaps = 24/196 (12%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            R +  G++H+H  EP++AH D+KP NVLL   K      +L+DFGS   A + + +R+EA
Sbjct  163  RDILLGVRHLHEHEPAFAHRDIKPENVLL---KADGLTPVLIDFGSMTMADRTVGARAEA  219

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            L +QE A++H + P+RAPEL+D  S+A +D R D+W+LGC L+A+M+G SPFE    E G
Sbjct  220  LMVQEEAAQHSTLPYRAPELFDVTSNATLDARVDVWALGCLLFALMFGYSPFEVEFEEPG  279

Query  420  G------------------SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVR  295
            G                        V  +V +PT      Y   L + V W+L+     R
Sbjct  280  GRHAGGPGEGQGGPRPRVVECTFLRVIGKVPFPT---KHAYSTRLVETVEWILEQNPRRR  336

Query  294  PHIDDIVIHVDKLISK  247
            PH+ +++  ++ L+SK
Sbjct  337  PHVTEVLGRIEPLMSK  352



>ref|XP_006440851.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
 gb|ESR54091.1| hypothetical protein CICLE_v10021674mg [Citrus clementina]
Length=269

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 70/84 (83%), Gaps = 3/84 (4%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            Q+CAGLKHMH+ EP YAHNDVKPGN+L+T RKGQPPLAILMDFGSARPARKQIRSRSEAL
Sbjct  167  QICAGLKHMHSLEPPYAHNDVKPGNILITCRKGQPPLAILMDFGSARPARKQIRSRSEAL  226

Query  597  QLQEWASEHVSAPFRAPELWDCPS  526
            QLQEWA+E V       EL  C +
Sbjct  227  QLQEWAAEIV---LHLSELLSCGT  247



>gb|EPB88470.1| NAK protein kinase [Mucor circinelloides f. circinelloides 1006PhL]
Length=337

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KP N+L++   G+ P  ILMDFGS   AR  IRSR + L  Q+ A+E+ + P+R
Sbjct  179  YAHRDLKPSNILISD-DGKTP--ILMDFGSVMKARIPIRSRQDGLLQQDIAAENSTIPYR  235

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  +   +DE+ DIWSLGCTLYA  YG +PFE ++ E GGS+ LAI+N   K+P 
Sbjct  236  APELYDVQTGTTLDEKVDIWSLGCTLYAAAYGQNPFEASVNEMGGSIALAILNGHYKFPL  295

Query  372  GLS-DPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
                D  Y +   + + ++L      RP I  ++  ++ ++
Sbjct  296  DKEQDDPYSDEFKELIQFLLVIDPKERPTIHQVIEKLESIL  336



>gb|EIE83144.1| hypothetical protein RO3G_07849 [Rhizopus delemar RA 99-880]
Length=159

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 86/123 (70%), Gaps = 4/123 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KPGNVL+    GQ   A+LMDFGS   AR  I +R EAL  Q+ A+EH + P+R
Sbjct  37   WAHRDIKPGNVLIAD-DGQT--AVLMDFGSMCQARIHIENRQEALAQQDIAAEHCTMPYR  93

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  +   +DE+ DIWSLGCTLYA+ YG SPFE  + + GGS+ LA++N Q K+P 
Sbjct  94   APELFDVKTGTTLDEKVDIWSLGCTLYAMAYGQSPFEMNM-DQGGSVALAVLNNQYKFPE  152

Query  372  GLS  364
            G S
Sbjct  153  GNS  155



>ref|XP_008543942.1| PREDICTED: serine/threonine-protein kinase 16 [Microplitis demolitor]
Length=318

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 106/180 (59%), Gaps = 9/180 (5%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSE  604
            +Q+C G+K  H+ +P   AH D+K  N+LL          I+MD GS   AR ++    E
Sbjct  143  QQICEGVKVFHDVKPEPLAHRDLKTANILL----DDTLTPIIMDLGSVSQARVKVCGAQE  198

Query  603  ALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGES  424
            A  LQ+ A+E  S P+RAPEL++  S+  IDERTDIWSLGC LYA+ Y  SPFE A+ E 
Sbjct  199  AQTLQDIAAERCSMPYRAPELFNVESYCMIDERTDIWSLGCILYALCYFKSPFE-AVYER  257

Query  423  GGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            G S+ LA+++A + +P    +  Y E +   +  ML+     RP+I  ++ +V  +ISK 
Sbjct  258  GDSVALAVISANITFP---ENAPYNEDIQNLIQSMLKTNPMERPYIYSVIENVHDVISKL  314



>ref|XP_006616705.1| PREDICTED: serine/threonine-protein kinase 16-like [Apis dorsata]
Length=318

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 105/181 (58%), Gaps = 9/181 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C G+K  H  +P   AH D+K  N+LL    G  P  I+MD GS  PAR +I     A
Sbjct  144  QICEGVKAFHEAKPEPLAHRDLKTANILLD--DGSTP--IIMDLGSVAPARIKICGSQAA  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P+RAPEL++  S+  +DERTDIWSLGC LYA+ Y  SPF+  + E G
Sbjct  200  QTLQDLAAERCSMPYRAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-TVYERG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
             S+ LA+++A + +P    D  Y E +   +  ML+     RP+I  ++  V  +ISK  
Sbjct  259  DSVALAVMSANIIFP---EDAPYTEDIQNLILLMLKVNPMERPYIYSVIEKVHDIISKLE  315

Query  240  H  238
            +
Sbjct  316  N  316



>ref|XP_004358442.1| putative protein serine/threonine kinase [Dictyostelium fasciculatum]
 gb|EGG20592.1| putative protein serine/threonine kinase [Dictyostelium fasciculatum]
Length=305

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 106/176 (60%), Gaps = 10/176 (6%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSE  604
            +QLC  +  +H+ +P+  AH D+KPGN+LL     +P   IL+DFGS   AR  + +R  
Sbjct  138  QQLCQAVLVLHSLQPTPLAHRDLKPGNILLEGENNKP---ILLDFGSVSEARINVETRKR  194

Query  603  ALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGES  424
            AL++QE A +H +  +RAPEL+D  ++  IDERTD+W+LGC LYA+ +  SPFE    + 
Sbjct  195  ALEVQEDAEQHSTPMYRAPELFDVATNCTIDERTDVWALGCILYAMAFNKSPFE---ADE  251

Query  423  GGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
              S+ L +V+ Q++ P    + KY +   Q +  ML    + RP I+ I+I +  +
Sbjct  252  SSSVALKVVSGQIEIP---PNHKYSQPFIQLIHKMLSHSISNRPFINQILIDLSSI  304



>ref|XP_003694450.1| PREDICTED: serine/threonine-protein kinase 16-like [Apis florea]
Length=318

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 105/181 (58%), Gaps = 9/181 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C G+K  H  +P   AH D+K  N+LL    G  P  I+MD GS  PAR +I     A
Sbjct  144  QICEGVKAFHEAKPEPLAHRDLKTANILLD--DGSIP--IIMDLGSVAPARIKICGSQAA  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P+RAPEL++  S+  +DERTDIWSLGC LYA+ Y  SPF+  + E G
Sbjct  200  QTLQDLAAERCSMPYRAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-TVYERG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
             S+ LA+++A + +P    D  Y E +   +  ML+     RP+I  ++  V  +ISK  
Sbjct  259  DSVALAVMSANIIFP---EDAPYTEDIQNLILLMLKVNPMERPYIYSVIEKVHDIISKLE  315

Query  240  H  238
            +
Sbjct  316  N  316



>gb|KIK66664.1| hypothetical protein GYMLUDRAFT_157468 [Gymnopus luxurians FD-317 
M1]
Length=435

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 102/154 (66%), Gaps = 6/154 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV+++  +G+P   ILMDFGSA  AR +I +R++AL  Q+ A+E  +  +R
Sbjct  276  YAHRDIKPGNVMISD-EGRP---ILMDFGSAMRARIKIENRNQALYQQDIAAEQSTMAYR  331

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +  D+DE+ DIWSLGC L+A++Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  332  APELFDVKTGIDLDEKVDIWSLGCLLFAMLYSHSPFENTQTTEQGGSIAMAVLNAQYKHP  391

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
              +S  +Y   L + V  ML+     RP I +++
Sbjct  392  QAVSG-RYSAGLREMVDKMLRVDPKERPAIGEVI  424



>ref|XP_003708300.1| PREDICTED: serine/threonine-protein kinase 16-like [Megachile 
rotundata]
Length=318

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 106/181 (59%), Gaps = 9/181 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C G+K  H  +P   AH D+K  N++L    G  P  ++MD GS  PAR ++     A
Sbjct  144  QICEGVKAFHEAKPEPLAHRDLKTANIVLG--DGNTP--VIMDLGSVAPARVKVCGSQAA  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P+RAPEL++  S+  +DERTDIWSLGC LYA+ Y  SPF+  + E G
Sbjct  200  QTLQDLAAERCSMPYRAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-TVYERG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
             S+ LA+++A + +P    D  Y E +   +  ML+     RP+I  ++ +V  LI+K  
Sbjct  259  DSVALAVISANITFP---DDAPYNEDMQNLILSMLKVNPMERPYIYSVIENVHDLITKLE  315

Query  240  H  238
            +
Sbjct  316  N  316



>ref|XP_426593.1| PREDICTED: serine/threonine-protein kinase 16 isoformX2 [Gallus 
gallus]
Length=305

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 106/175 (61%), Gaps = 11/175 (6%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            R +C+GL+ +H     YAH D+KP NVLL     QP   ILMD GS   AR ++ +  EA
Sbjct  130  RGICSGLQAIHG--KGYAHRDLKPTNVLLDE-DDQP---ILMDLGSMNRARMEVTNSREA  183

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            + +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  PF+ A+ + G
Sbjct  184  MAVQDWAAQRCTISYRAPELFTVPSQCIIDERTDIWSLGCVLYCMMFGEGPFD-AIFQKG  242

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
             S+ LA+ N  +  PT     +Y  ALH+ +  M+      RP I+DI+  ++ L
Sbjct  243  DSVALAVQNP-IAIPT---TSRYSAALHRLLFSMMTVNPQERPSIEDILQQLEGL  293



>ref|XP_005848000.1| hypothetical protein CHLNCDRAFT_145529 [Chlorella variabilis]
 gb|EFN55898.1| hypothetical protein CHLNCDRAFT_145529 [Chlorella variabilis]
Length=452

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 86/141 (61%), Gaps = 1/141 (1%)
 Frame = -3

Query  666  AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL  487
            A+LMDFGS R AR  +R+RSEA+ +QE A    +AP+RA ELWD PS   IDER D+WSL
Sbjct  311  AVLMDFGSTRTARVVVRNRSEAMSVQEDAERQCTAPYRASELWDVPSFCAIDERVDVWSL  370

Query  486  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ  307
            GC LY ++ G SPFE A GE+GGSL LA+VN ++ WP   +    P  + Q     L   
Sbjct  371  GCLLYFLVCGQSPFERAAGEAGGSLMLAVVNGRLSWPDDAAS-SCPAGIKQLAAACLDTD  429

Query  306  ATVRPHIDDIVIHVDKLISKF  244
               RP + ++    D +++  
Sbjct  430  PATRPAVAEVAAQADAILASL  450



>ref|XP_007777376.1| NAK protein kinase [Coniosporium apollinis CBS 100218]
 gb|EON62059.1| NAK protein kinase [Coniosporium apollinis CBS 100218]
Length=418

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 105/172 (61%), Gaps = 12/172 (7%)
 Frame = -3

Query  741  EPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSA  562
            E +YAH D+KPGN++++   GQ P  ILMD GS  PA   I SRS ALQ+Q+ A+EH + 
Sbjct  240  ERAYAHRDIKPGNIMISD-DGQTP--ILMDLGSLAPAPTSITSRSLALQVQDQAAEHSTM  296

Query  561  PFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVK  382
            P+RAPEL+D  + + ID + DIWSLGCTLYA + G SPFE    E+GGSL L ++    +
Sbjct  297  PYRAPELFDVKTGSTIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSLCVLGGDWR  356

Query  381  WP-----TGLSDPKYPE----ALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
            +P      G    K  E    A+   V   L+ +   RP +D+++  V+++I
Sbjct  357  FPDEAPARGKQKAKSEEGITPAVKDVVRRCLRVEPAERPDVDELISLVEEVI  408



>ref|XP_011140913.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Harpegnathos 
saltator]
Length=318

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 106/179 (59%), Gaps = 9/179 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C G+K  H  +P   AH D+K  N++L+   G P   ++MD GS   AR Q+     A
Sbjct  144  QICEGVKAFHEAKPEPLAHRDLKTANIVLSD-DGTP---VIMDLGSVTTARVQVCGTQAA  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P+RAPEL++  S+  +DERTDIWSLGCTLYA+ Y  SPF+  + E G
Sbjct  200  RTLQDLAAERCSMPYRAPELFNVESYCMVDERTDIWSLGCTLYALCYFKSPFD-TVYERG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
             S+ LA+++A V +P G     Y E +   +  ML+  +  RP+I  ++ ++   I+K 
Sbjct  259  DSVALAVISAHVTFPEG---APYNEDMQSLILSMLKVNSMERPYIYSVIENIHDAIAKL  314



>ref|XP_011140914.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Harpegnathos 
saltator]
 ref|XP_011140915.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Harpegnathos 
saltator]
 gb|EFN83550.1| Serine/threonine-protein kinase 16 [Harpegnathos saltator]
Length=307

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 106/179 (59%), Gaps = 9/179 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C G+K  H  +P   AH D+K  N++L+   G P   ++MD GS   AR Q+     A
Sbjct  133  QICEGVKAFHEAKPEPLAHRDLKTANIVLSD-DGTP---VIMDLGSVTTARVQVCGTQAA  188

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P+RAPEL++  S+  +DERTDIWSLGCTLYA+ Y  SPF+  + E G
Sbjct  189  RTLQDLAAERCSMPYRAPELFNVESYCMVDERTDIWSLGCTLYALCYFKSPFD-TVYERG  247

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
             S+ LA+++A V +P G     Y E +   +  ML+  +  RP+I  ++ ++   I+K 
Sbjct  248  DSVALAVISAHVTFPEG---APYNEDMQSLILSMLKVNSMERPYIYSVIENIHDAIAKL  303



>ref|XP_006884670.1| PREDICTED: serine/threonine-protein kinase 16-like [Elephantulus 
edwardii]
Length=230

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 103/173 (60%), Gaps = 11/173 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C GL+ +H     YAH D+KP N+LL   +GQP   +LMD GS   AR  +    +AL 
Sbjct  57   ICRGLEAIH--AKGYAHRDLKPTNILLGD-EGQP---VLMDLGSMNQARIHVEGSRQALA  110

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            LQ+WA++  +  +RAPEL+   SH  IDERTD+WSLGC LYAIM+G  P++  L + G S
Sbjct  111  LQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAIMFGEGPYDMVL-QKGDS  169

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            + LA+ N Q+  P      +Y  AL Q +T M+      RPH+  ++  V+ L
Sbjct  170  VALAVQN-QLNIP---ESSRYSPALRQLLTSMMTVDPQQRPHVPVLLGQVEAL  218



>gb|KFW80140.1| Serine/threonine-protein kinase 16, partial [Manacus vitellinus]
Length=276

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 104/173 (60%), Gaps = 11/173 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C GL+ +H+    YAH D+KP NVLL     QP   +LMD GS   AR ++ S  EA+ 
Sbjct  103  ICRGLQAIHS--KGYAHRDLKPTNVLLDE-DDQP---VLMDLGSMNQARIEVNSSREAMA  156

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  PF+ A+ + G S
Sbjct  157  VQDWAAQRCTISYRAPELFTVPSQCVIDERTDIWSLGCVLYCMMFGEGPFD-AIFQKGDS  215

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            + LA+ N     PT     +Y   L + ++ M+      RP+IDDI+  ++ L
Sbjct  216  VALAVQNPITFPPT----TRYSAGLQRLLSSMMTVNPQERPNIDDILCQLEGL  264



>ref|XP_008076868.1| Protein kinase-like (PK-like) [Glarea lozoyensis ATCC 20868]
 gb|EPE36050.1| Protein kinase-like (PK-like) [Glarea lozoyensis ATCC 20868]
Length=413

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 105/178 (59%), Gaps = 17/178 (10%)
 Frame = -3

Query  735  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF  556
            +YAH D+KPGN+++     QP   ILMD GS  PA   I SRS+AL +Q+ A+EH + P+
Sbjct  233  AYAHRDIKPGNIMIDDDGEQP---ILMDLGSLAPAPTPITSRSQALAVQDQAAEHSTMPY  289

Query  555  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP  376
            RAPEL+D  + + ID + DIWSLGCTLYA + G SPFE    E+GGSL L ++    ++P
Sbjct  290  RAPELFDVKTGSVIDTKVDIWSLGCTLYACLVGKSPFEMRSDETGGSLSLCVLGGDWRFP  349

Query  375  -------------TGLS-DPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
                         TG S D +  E + + V   L+ +   RP +D+++  V+ +I + 
Sbjct  350  DEGAGGKKKATNQTGQSDDSEISEGIREVVRKCLKVEPAERPDVDELIEIVEGVIEQL  407



>gb|EPS96122.1| hypothetical protein FOMPIDRAFT_1167839 [Fomitopsis pinicola 
FP-58527 SS1]
Length=434

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 100/162 (62%), Gaps = 9/162 (6%)
 Frame = -3

Query  735  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF  556
            SYAH D+KPGNV++    G P   +LMDFGSA  AR +I +RS+AL  Q+ A+E  +  +
Sbjct  277  SYAHRDLKPGNVMIAD-DGSP---VLMDFGSAMKARIRIENRSQALLQQDLAAEQCTMAY  332

Query  555  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE-YALGESGGSLQLAIVNAQVKW  379
            RAPEL+D  ++  +DE+ DIWSLGCTL+A+ Y  SPFE     E GGS+ +A++NAQ K 
Sbjct  333  RAPELFDVKTNVALDEKVDIWSLGCTLFALAYSHSPFENMQTTEQGGSIAMAVMNAQYKH  392

Query  378  PTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
            P       Y + L   +  ML+     RP I  ++   DK++
Sbjct  393  PQS----AYSQGLKNLIDSMLKVNPADRPDIHQVIEMTDKVL  430



>ref|XP_003287685.1| hypothetical protein DICPUDRAFT_78515 [Dictyostelium purpureum]
 gb|EGC35791.1| hypothetical protein DICPUDRAFT_78515 [Dictyostelium purpureum]
Length=311

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 98/178 (55%), Gaps = 3/178 (2%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            +++C  ++  H  EP  AH D+KPGN+LL +        IL DFGS + AR +I +R EA
Sbjct  136  KKICEAIQVFHTHEPPLAHRDIKPGNILLANSNDGILNPILTDFGSVKEARIKISNRKEA  195

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            L  Q+   ++ +  ++APEL+D  S   IDER D+WSLGC LY   Y  SPFE +  E  
Sbjct  196  LSFQDEVEQNTTPFYKAPELFDIASDCVIDERIDVWSLGCLLYTAAYNRSPFEVSDDEPS  255

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
            GS+ L +++     P+      Y    +Q +  M+      R HI+ I+  ++ ++SK
Sbjct  256  GSVALKVLSG---LPSPFPSTNYSNEFNQLIRNMVNLNKDDRLHINQIITEIENILSK  310



>ref|XP_001231623.1| PREDICTED: serine/threonine-protein kinase 16 isoformX1 [Gallus 
gallus]
Length=317

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 106/175 (61%), Gaps = 11/175 (6%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            R +C+GL+ +H     YAH D+KP NVLL     QP   ILMD GS   AR ++ +  EA
Sbjct  142  RGICSGLQAIHG--KGYAHRDLKPTNVLLDE-DDQP---ILMDLGSMNRARMEVTNSREA  195

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            + +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  PF+ A+ + G
Sbjct  196  MAVQDWAAQRCTISYRAPELFTVPSQCIIDERTDIWSLGCVLYCMMFGEGPFD-AIFQKG  254

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
             S+ LA+ N  +  PT     +Y  ALH+ +  M+      RP I+DI+  ++ L
Sbjct  255  DSVALAVQNP-IAIPT---TSRYSAALHRLLFSMMTVNPQERPSIEDILQQLEGL  305



>gb|KDQ19325.1| hypothetical protein BOTBODRAFT_184376 [Botryobasidium botryosum 
FD-172 SS1]
Length=465

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 105/164 (64%), Gaps = 7/164 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KPGNV+++  +G+   A+LMDFGSA  AR  + +R +AL  Q+ A+E  + P+R
Sbjct  307  WAHRDIKPGNVMISD-EGE---AVLMDFGSAIKARVNVETRQQALVQQDIAAEQSTMPYR  362

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYAL-GESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTL+A++Y  SPFE  +  E GGS+ +A++NAQ K P
Sbjct  363  APELFDVKTGTTLDEKVDIWSLGCTLFALLYHYSPFESTVQTEQGGSIAMAVLNAQYKHP  422

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
               +  +Y E + + +  ML+     RP I  ++   D+++   
Sbjct  423  A--TGAQYSEGVRKLIDAMLKVNPKDRPDIHQVIEMADRVLQSL  464



>ref|XP_008921223.1| PREDICTED: serine/threonine-protein kinase 16 [Manacus vitellinus]
Length=312

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 104/173 (60%), Gaps = 11/173 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C GL+ +H+    YAH D+KP NVLL     QP   +LMD GS   AR ++ S  EA+ 
Sbjct  139  ICRGLQAIHS--KGYAHRDLKPTNVLLDE-DDQP---VLMDLGSMNQARIEVNSSREAMA  192

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  PF+ A+ + G S
Sbjct  193  VQDWAAQRCTISYRAPELFTVPSQCVIDERTDIWSLGCVLYCMMFGEGPFD-AIFQKGDS  251

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            + LA+ N     PT     +Y   L + ++ M+      RP+IDDI+  ++ L
Sbjct  252  VALAVQNPITFPPT----TRYSAGLQRLLSSMMTVNPQERPNIDDILCQLEGL  300



>ref|XP_010128957.1| PREDICTED: serine/threonine-protein kinase 16, partial [Chlamydotis 
macqueenii]
Length=199

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 106/176 (60%), Gaps = 11/176 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C GL+ +H+    YAH D+KP NVLL     +P   +LMD GS   AR ++ S  EA+ 
Sbjct  30   ICRGLQAIHS--KGYAHRDLKPTNVLLDE-DDRP---VLMDLGSMNQARIEVNSSREAMA  83

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  P++ A+ + G S
Sbjct  84   VQDWAAQRCTISYRAPELFTVPSQCVIDERTDIWSLGCVLYCMMFGEGPYD-AVFQKGDS  142

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
            + LA+ N     PT     +Y  AL + ++ M+      RP IDD++  ++ L+ +
Sbjct  143  VALAVQNPITVPPT----TRYSAALQRLLSSMMTLNPQERPSIDDVLHQLEGLLGQ  194



>gb|KDR78818.1| hypothetical protein GALMADRAFT_1271408 [Galerina marginata CBS 
339.88]
Length=417

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 99/165 (60%), Gaps = 8/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    G+ P  ILMDFGS   AR QI +RS+AL  Q+ A+E  +  +R
Sbjct  260  YAHRDLKPGNVMIAD-DGKTP--ILMDFGSTMLARVQIENRSQALLQQDIAAEQSTMAYR  316

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   IDE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  317  APELFDVKTGQTIDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP  376

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                   Y + L   +  ML+     RP I+ ++   D ++   +
Sbjct  377  QS----AYSQGLKNLIDSMLKVNPADRPDINGVIRMTDAVLQSLA  417



>gb|KIY43898.1| kinase-like protein [Fistulina hepatica ATCC 64428]
Length=350

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 94/153 (61%), Gaps = 8/153 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGN+++T     P   ILMDFGS   AR +I +RS+AL  Q+ A+E  +  +R
Sbjct  199  YAHRDIKPGNIMITDDGNTP---ILMDFGSTMKARIKIETRSQALLHQDIAAEQCTMAYR  255

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  256  APELFDVKTGQTLDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP  315

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDI  277
            +      Y + L   +  ML+     RP I+ +
Sbjct  316  SS----AYSQGLKDLIDSMLKVDPKDRPDINQV  344



>gb|KFP39383.1| Serine/threonine-protein kinase 16, partial [Chlamydotis macqueenii]
Length=200

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 106/176 (60%), Gaps = 11/176 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C GL+ +H+    YAH D+KP NVLL     +P   +LMD GS   AR ++ S  EA+ 
Sbjct  31   ICRGLQAIHS--KGYAHRDLKPTNVLLDE-DDRP---VLMDLGSMNQARIEVNSSREAMA  84

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  P++ A+ + G S
Sbjct  85   VQDWAAQRCTISYRAPELFTVPSQCVIDERTDIWSLGCVLYCMMFGEGPYD-AVFQKGDS  143

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
            + LA+ N     PT     +Y  AL + ++ M+      RP IDD++  ++ L+ +
Sbjct  144  VALAVQNPITVPPT----TRYSAALQRLLSSMMTLNPQERPSIDDVLHQLEGLLGQ  195



>gb|KDN40698.1| Pkinase-domain-containing protein [Tilletiaria anomala UBC 951]
Length=447

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 99/165 (60%), Gaps = 7/165 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGN+++    GQ PL  L DFGS   AR+ I++R EA+  Q+ A+E  S P+R
Sbjct  289  YAHRDIKPGNIMIAD-DGQTPL--LYDFGSTIKARRMIKTRREAIAEQDLAAEQSSMPYR  345

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG-ESGGSLQLAIVNAQVKWP  376
            APEL+D  +  +I E  DIW+LGCTL+A+ Y  SPFE     E GGSL LA++N + K+P
Sbjct  346  APELFDVKTGTEITEAVDIWALGCTLFAMAYHHSPFETPQTLEQGGSLALAVLNGKYKFP  405

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
             G    +Y EA  Q V   L      RP ID ++   +K +   S
Sbjct  406  DG---DQYSEATRQIVRSCLATDPKARPTIDGLIDLTEKALRGVS  447



>ref|XP_007263188.1| other/NAK protein kinase [Fomitiporia mediterranea MF3/22]
 gb|EJD06924.1| other/NAK protein kinase [Fomitiporia mediterranea MF3/22]
Length=439

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 99/165 (60%), Gaps = 8/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    G P   ILMDFGSA  AR +I +R +AL  Q+ A+E  +  +R
Sbjct  282  YAHRDLKPGNVMVAD-DGSP---ILMDFGSAIRARIKIETRQQALLQQDIAAEQSTMAYR  337

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE-YALGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE  A  E GGS+ +A++NA  K P
Sbjct  338  APELFDVKTGVTLDEKVDIWSLGCTLYALAYLHSPFETLATTEQGGSIAMAVMNAAYKHP  397

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                D  Y + L   +  ML+   T RP I  ++   D ++   S
Sbjct  398  ---RDSAYSQGLRDLIDSMLKADPTQRPDIHQVIEQTDAVLRSLS  439



>ref|XP_011456099.1| PREDICTED: serine/threonine-protein kinase 16-like [Crassostrea 
gigas]
Length=318

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 107/181 (59%), Gaps = 8/181 (4%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            R LC  +K  H+  P YAH D+KP NV++    G P   ILMD GSA  AR ++ +   +
Sbjct  144  RGLCQAVKEFHSQNPPYAHRDIKPANVMIAA-DGSP---ILMDLGSANLARVEVSNAKIS  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
             QLQ+ A+E  S  +RAPEL++    + +DERTDIWSLGC LYA+ +  SP++  L   G
Sbjct  200  RQLQDEAAERCSMFYRAPELFNVEVGSSVDERTDIWSLGCLLYAMAFLESPYD-KLYAQG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            GS+ LA  +  VK+P    +  Y  A+H+ +  +++     RP ID+++  V++   KF 
Sbjct  259  GSMALATQSDNVKFP---DNSGYSSAIHELILRLMKVNVAERPFIDNVLEIVEENYRKFQ  315

Query  240  H  238
            +
Sbjct  316  N  316



>gb|KDR07799.1| Serine/threonine-protein kinase 16 [Zootermopsis nevadensis]
Length=333

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 106/179 (59%), Gaps = 9/179 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
             +C G+K  H   P   AH D+K  N+LL+  +      I+MD GS   AR +I   SEA
Sbjct  144  HICEGVKAFHEANPEPLAHRDLKTANILLSDDRS----PIIMDLGSVAVARVKICGSSEA  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
             QLQ+ ASE  S P+RAPEL+   S+  IDERTDIWSLGC L+A+ Y  SPF+ A+ E G
Sbjct  200  QQLQDLASERCSMPYRAPELFSVESYCMIDERTDIWSLGCILFAMCYFKSPFD-AVYERG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
             S+ LA+++  + +P   S P  PE +H+ + +ML+     RP+I  ++     +IS+ 
Sbjct  259  DSVALAVISGNITFPE--SSPYDPE-IHELILYMLKVNPMERPYIYSVIEKTHDIISEI  314



>ref|XP_007393556.1| hypothetical protein PHACADRAFT_252405 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM58233.1| hypothetical protein PHACADRAFT_252405 [Phanerochaete carnosa 
HHB-10118-sp]
Length=348

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 101/164 (62%), Gaps = 9/164 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    G+P   ILMDFGSA  AR +I +RS+AL  Q+ A+E  +  +R
Sbjct  193  YAHRDLKPGNVMVAD-DGRP---ILMDFGSATKARIKIENRSQALLQQDIAAEQSTMAYR  248

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTL+A+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  249  APELFDVKTGITLDEKVDIWSLGCTLFALAYLHSPFENTQTTEQGGSIAMAVMNAQYKHP  308

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            +     +Y +   + +   L+     RP I  +V   DKL+ + 
Sbjct  309  SS----QYSQGFKELIDSTLKVNPQDRPDIHQVVEMTDKLLQRL  348



>ref|XP_003031576.1| hypothetical protein SCHCODRAFT_76377 [Schizophyllum commune 
H4-8]
 gb|EFI96673.1| hypothetical protein SCHCODRAFT_76377, partial [Schizophyllum 
commune H4-8]
Length=408

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 97/164 (59%), Gaps = 7/164 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++      P   ILMDFGS   AR  I++R++AL  Q+ A+E  +  +R
Sbjct  252  YAHRDIKPGNVMIADDGVTP---ILMDFGSTVKARIPIQNRNQALVQQDIAAEQSTMTYR  308

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D  +   +DE+ DIWSLGC LYA+ Y  SPFE   GE GGS+ +A++NAQ K P 
Sbjct  309  APELFDVKTGVTLDEKVDIWSLGCMLYALAYNHSPFESTQGEQGGSIAMAVLNAQYKHPP  368

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                  Y + L   +  ML+     RP I  ++   D+++   +
Sbjct  369  S----AYSQGLKDLIDSMLKVNPADRPDIHRVIQMTDRVLQSLA  408



>emb|CDH53858.1| other nak protein kinase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=387

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 95/159 (60%), Gaps = 5/159 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KP N+L+    G  P  IL DFGS   AR  I++R EAL  Q+ A+EH +  +R
Sbjct  221  YAHRDLKPSNILIAD-DGHTP--ILTDFGSITRARITIKTRREALLQQDLAAEHSTMAYR  277

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF-EYALGESGGSLQLAIVNAQVKWP  376
            +PEL+D  ++  +DE+ DIWSLGC LYA  YG SPF E  + E GGS+ LA++N Q K+P
Sbjct  278  SPELYDVQTNTQLDEKMDIWSLGCLLYATAYGQSPFSEANMHEVGGSMSLAVLNGQYKFP  337

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDK  259
               SDP Y E     +  ML      R  I  ++  VD+
Sbjct  338  PSESDP-YSEGFRGLIRSMLVVDRKERADIQSVIATVDR  375



>ref|XP_001732295.1| hypothetical protein MGL_0070 [Malassezia globosa CBS 7966]
 gb|EDP45081.1| hypothetical protein MGL_0070 [Malassezia globosa CBS 7966]
Length=301

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 94/157 (60%), Gaps = 5/157 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH DVKPGN++++         +LMDFGS   AR  I SR EA+  Q+ AS H S P+R
Sbjct  142  YAHRDVKPGNIMISDDGNT---GVLMDFGSTMRARVTISSRREAIAHQDLASVHSSMPYR  198

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE-YALGESGGSLQLAIVNAQVKWP  376
            APEL+D  + A +DE+ DIW+LGCTLYA+ Y  SPFE  +  E GGS+ LA++N   K+P
Sbjct  199  APELFDVKTDAVLDEKVDIWALGCTLYAMAYLHSPFETLSTVEQGGSIALAVMNGAYKFP  258

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHV  265
                DP  P   H  +   L+     RP ID ++  V
Sbjct  259  PADEDPYSPHVRH-IIERCLEHDPQARPDIDAVLNDV  294



>gb|KFO72172.1| Serine/threonine-protein kinase 16, partial [Cuculus canorus]
Length=276

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 106/175 (61%), Gaps = 11/175 (6%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            R +C GL+ +H+    YAH D+KP NVLL     +P   +LMD GS   AR ++ S  EA
Sbjct  101  RGICRGLQAIHS--KGYAHRDLKPTNVLLDE-DDRP---VLMDLGSMNQARIEVNSSREA  154

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            + +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  P++ A+ + G
Sbjct  155  MAVQDWAAQRCTISYRAPELFTVPSQCIIDERTDIWSLGCVLYCMMFGEGPYD-AIFQKG  213

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
             S+ LA+ N  V  PT     +Y  AL + ++ M+      RP IDDI+  ++ L
Sbjct  214  DSVALAVQNPIVLPPT----TRYSAALQRLLSSMMTLNPQERPSIDDILHQLEGL  264



>ref|XP_011049589.1| PREDICTED: serine/threonine-protein kinase 16 isoform X4 [Acromyrmex 
echinatior]
Length=256

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 105/179 (59%), Gaps = 9/179 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C G+K  H  +P   AH D+K  N++L +  G P   ++MD GS   AR ++ S   A
Sbjct  84   QICEGVKAFHEAKPEPLAHRDLKTANIVL-NDVGIP---VIMDLGSVATARVKVCSTQAA  139

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P+RAPEL++  S+  +DERTDIWSLGC LYA+ Y  SPF+  + E G
Sbjct  140  RTLQDLATERCSMPYRAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-TVYERG  198

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
             S+ LA+++A VK+P    D  Y E +   +  ML+     RP+I  ++  V   I+K 
Sbjct  199  DSVALAVMSAHVKFP---EDTPYNEDMQNLILLMLKVDPMERPYIYSVIESVHDTIAKL  254



>gb|KIJ52504.1| hypothetical protein M422DRAFT_223049 [Sphaerobolus stellatus 
SS14]
Length=427

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 98/165 (59%), Gaps = 5/165 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGN++L+   G  P  ILMDFGS   AR ++ +RS+A+  Q+ A+E  + P+R
Sbjct  267  YAHRDIKPGNIMLSD-DGHTP--ILMDFGSTIKARIKVENRSQAVAQQDLAAEQSTMPYR  323

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE-YALGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ ++++N   K P
Sbjct  324  APELFDVKTGTTLDEKVDIWSLGCTLYAMAYSHSPFETLQTTEQGGSIAMSVMNGAYKHP  383

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
               S   Y E L   + +ML      RP I  ++   D ++   S
Sbjct  384  ANAS-SIYSEGLRNLIDFMLVLDPKNRPDIHQVIEKTDTVLQTLS  427



>emb|CDR44020.1| CYFA0S13e01706g1_1 [Cyberlindnera fabianii]
Length=372

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 97/154 (63%), Gaps = 6/154 (4%)
 Frame = -3

Query  735  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF  556
            +YAH D+KP NV+L+ + G P   +L D GS   AR   ++RS A+ +QE A+EH + P+
Sbjct  215  AYAHRDIKPANVMLS-KDGLP---VLCDLGSCAKARITAKNRSTAVAIQELAAEHCTLPY  270

Query  555  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP  376
            RAPEL D  + A +DE+ DIWSLGC LYA++YG SPFE+   ESGGS+ +AI N + ++P
Sbjct  271  RAPELLDVKTGAHLDEKIDIWSLGCLLYALLYGCSPFEHEEAESGGSMNMAISNGKWEYP  330

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
                   Y + + + +   L      RP ++D++
Sbjct  331  K--RGDVYSDDIKELIEMCLVVDPEQRPAVEDVL  362



>gb|ACO15455.1| Serine/threonine-protein kinase 16 [Caligus clemensi]
Length=320

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C GL  +H+ +P   AH D+KP NVLLT  K   P  +++D GSA  AR  +++  EA
Sbjct  147  QICEGLSALHSLDPYPLAHRDIKPHNVLLT--KDFAP--VIIDLGSATKARVMVKTSYEA  202

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              +++ A++  S  +R+PEL+    + ++DERTDIWSLGC LYA+ Y  SPF+   G  G
Sbjct  203  KDIEDTAAKRSSITYRSPELFHVNVNKELDERTDIWSLGCLLYALCYFKSPFDSVYGR-G  261

Query  420  GSLQLAIVNA-QVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
             S+ LA+ +A  V +P   SD  YP+ LH+ + WML    ++RP++  I+  V++L+
Sbjct  262  DSVALAVQSASNVNFP---SDSPYPKELHELIEWMLTLDMSLRPYLPQIMKKVEELL  315



>ref|XP_009553933.1| PREDICTED: serine/threonine-protein kinase 16 [Cuculus canorus]
Length=287

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 106/175 (61%), Gaps = 11/175 (6%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            R +C GL+ +H+    YAH D+KP NVLL     +P   +LMD GS   AR ++ S  EA
Sbjct  112  RGICRGLQAIHS--KGYAHRDLKPTNVLLDE-DDRP---VLMDLGSMNQARIEVNSSREA  165

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            + +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  P++ A+ + G
Sbjct  166  MAVQDWAAQRCTISYRAPELFTVPSQCIIDERTDIWSLGCVLYCMMFGEGPYD-AIFQKG  224

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
             S+ LA+ N  V  PT     +Y  AL + ++ M+      RP IDDI+  ++ L
Sbjct  225  DSVALAVQNPIVLPPT----TRYSAALQRLLSSMMTLNPQERPSIDDILHQLEGL  275



>ref|XP_007362345.1| Pkinase-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF64549.1| Pkinase-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
Length=434

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 102/161 (63%), Gaps = 9/161 (6%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGN++++  +GQP   ILMDFGS   AR +I +RS+AL  Q+ A+E  +  +R
Sbjct  278  YAHRDLKPGNIMISD-EGQP---ILMDFGSTMKARVKIENRSQALLQQDIAAEQSTMAYR  333

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   IDE+ DIWSLGCTL+A+ Y  SPFE     E GGS+ +A++ AQ K P
Sbjct  334  APELFDVKTGVTIDEKVDIWSLGCTLFALAYSHSPFENTQTTEQGGSIAMAVMGAQYKHP  393

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
                   Y + L   +  ML+ +   RP+I +++   D+++
Sbjct  394  PS----AYSQGLRDLIDSMLKVKPEERPNIHEVIRRTDQVL  430



>gb|KIO26332.1| hypothetical protein M407DRAFT_15093 [Tulasnella calospora MUT 
4182]
Length=427

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 8/161 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KP NV+L+   G P   +LMDFGS   AR  I +R++AL  Q+ A+E  + P+R
Sbjct  270  YAHRDIKPANVMLSD-DGTP---VLMDFGSTIKARVHIENRNQALMQQDLAAEQSTMPYR  325

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   IDE+ DIWSLGC L+A+ +  SPFE +   E GGS+ +A++NAQ K P
Sbjct  326  APELFDVKTGTTIDEKVDIWSLGCLLFALAFNHSPFETSQTTEQGGSMAMAVMNAQYKIP  385

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
                D  Y E L   +   L+     RP ID +V   + L+
Sbjct  386  ---RDSPYSEGLKDLINSCLKVNPVERPSIDQLVEETEALL  423



>ref|XP_008467843.1| PREDICTED: serine/threonine-protein kinase 16 [Diaphorina citri]
Length=322

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 110/183 (60%), Gaps = 9/183 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEP-SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            ++C  +K  H+ +P +YAH D+K  NVLL +     PL  LMD GS  PA  ++   +EA
Sbjct  144  KICEAVKVFHDAKPIAYAHRDLKTANVLLANDNN--PL--LMDLGSVAPAVVKVCGSAEA  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P+RAPEL+   S+  +D+RTD+WSLGC LYA+ Y  SPF+  + E G
Sbjct  200  QNLQDVAAERCSMPYRAPELFHVDSYCVVDQRTDVWSLGCLLYAMCYFKSPFD-TVYERG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
             S+ LA+++  + +P    +  +P+ LH  + +ML+   + RP I  +  +   L+S+ S
Sbjct  259  DSVALAVISGNITFP---ENTPFPQELHDLILFMLKVTPSERPFIHSVCDNAQDLLSRLS  315

Query  240  H*E  232
            + E
Sbjct  316  NRE  318



>emb|CDH51862.1| serine threonine protein kinase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=362

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 100/165 (61%), Gaps = 5/165 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KP N+L+    G+ P  IL DFGS   AR  I+++ +A+  Q+ A+EH +  +R
Sbjct  203  YAHRDLKPSNILIAD-DGKTP--ILTDFGSITRARITIKTKKDAMVQQDMAAEHTTMAYR  259

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPT  373
            APEL+D      +DE+ DIWSLGC LYA  YG +PFE  + + GGS+ LAI+N Q K+P 
Sbjct  260  APELYDVRPGKHLDEKVDIWSLGCLLYATAYGQNPFEATVHQMGGSISLAILNNQYKFPN  319

Query  372  GLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFSH  238
              +DP Y + L + +  ML      R  I  I+  +D+++   SH
Sbjct  320  E-NDP-YSDDLRRLIRSMLVTDPNERADIQTIIDTLDRILDTTSH  362



>ref|XP_782009.2| PREDICTED: serine/threonine-protein kinase 16-like [Strongylocentrotus 
purpuratus]
Length=193

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 102/169 (60%), Gaps = 13/169 (8%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSE  604
            + +C G+K +H  +P   AH D+KPGNV+L     +    ++MDFGS   AR +++ RSE
Sbjct  18   KGVCEGIKALHTAKPKPLAHRDMKPGNVML----AEDDTPVIMDFGSMGEARIEVKGRSE  73

Query  603  ALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE--YALG  430
            A  LQ+ A+E  S  FRAPEL+   SH  ++E+ DIWSLGC L+ + Y  SPFE  YA G
Sbjct  74   ACALQDLAAEKCSMLFRAPELFHVDSHCIVEEKVDIWSLGCVLFNMAYLHSPFEPIYARG  133

Query  429  ESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHID  283
            +   S+ LA++    K+P    + +Y + L   V+ ML  +A  RP+ID
Sbjct  134  D---SIHLAVLGRNFKFP---ENSRYSQGLQDTVSGMLVVEAVERPNID  176



>ref|XP_003060182.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56134.1| predicted protein [Micromonas pusilla CCMP1545]
Length=377

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 99/173 (57%), Gaps = 7/173 (4%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPSY---AHNDVKPGNVLLTHR-KGQPPL-AILMDFGSARPARKQIRS  613
            QLC  L+ MH   P     AH DVK  NVLL    + +  L A+LMDFGSA+PA+  +  
Sbjct  169  QLCDALECMHTLSPPLGPIAHRDVKLDNVLLESSPETEGGLKAVLMDFGSAKPAKVTVTD  228

Query  612  RSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLY-AIMYGVSPFEYA  436
            RS+AL +QE A+   +A +RAPELWD PS   IDER D+WSLGC L+ A   G +PFEYA
Sbjct  229  RSQALLIQEKAAGECTASYRAPELWDTPSECVIDERVDVWSLGCLLFAATAAGKTPFEYA  288

Query  435  LGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDI  277
               +GGSL LA+++ +  W    +   YP  +       L+     RP   D+
Sbjct  289  TDAAGGSLALAVMSGKYAWSEA-ARKAYPREVMAVAECCLEKDWRARPRARDV  340



>ref|XP_004617190.1| PREDICTED: serine/threonine-protein kinase 16 [Sorex araneus]
Length=305

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 103/173 (60%), Gaps = 11/173 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C GL+ +H     YAH D+KP N+LL   +GQP   +LMD GS   AR Q+    +AL 
Sbjct  132  ICRGLEAIHA--KGYAHRDLKPTNILLG-EEGQP---VLMDLGSMNQARIQVEGSRQALA  185

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            LQ+WA++  +  +RAPEL+   SH  IDERTD+WSLGC LYA+MYG  P++    + G S
Sbjct  186  LQDWAAQRCTISYRAPELFTVQSHCVIDERTDVWSLGCVLYAMMYGEGPYDMVF-QKGDS  244

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            + LA+ N  +  P     P+Y  A+ Q +  M+   +  RPH+  ++  ++ L
Sbjct  245  VALAVQNKLI-IP---QSPRYSAAMQQLLDSMMTVDSEQRPHVPVLLTQLEAL  293



>ref|XP_011049586.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Acromyrmex 
echinatior]
Length=316

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 105/179 (59%), Gaps = 9/179 (5%)
 Frame = -3

Query  777  QLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            Q+C G+K  H  +P   AH D+K  N++L +  G P   ++MD GS   AR ++ S   A
Sbjct  144  QICEGVKAFHEAKPEPLAHRDLKTANIVL-NDVGIP---VIMDLGSVATARVKVCSTQAA  199

Query  600  LQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
              LQ+ A+E  S P+RAPEL++  S+  +DERTDIWSLGC LYA+ Y  SPF+  + E G
Sbjct  200  RTLQDLATERCSMPYRAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-TVYERG  258

Query  420  GSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
             S+ LA+++A VK+P    D  Y E +   +  ML+     RP+I  ++  V   I+K 
Sbjct  259  DSVALAVMSAHVKFP---EDTPYNEDMQNLILLMLKVDPMERPYIYSVIESVHDTIAKL  314



>gb|KIM36166.1| hypothetical protein M413DRAFT_449359 [Hebeloma cylindrosporum 
h7]
Length=411

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 100/165 (61%), Gaps = 8/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGN+++    G+ P  ILMDFGS   AR  I +RS+AL  Q+ A+E  +  +R
Sbjct  254  YAHRDLKPGNIMIAD-DGKTP--ILMDFGSTMLARVHIENRSQALLQQDIAAEQSTMAYR  310

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   IDE+ DIWSLGCTL+A+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  311  APELFDVKTGQTIDEKVDIWSLGCTLFALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP  370

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                   Y + L   +  ML+     RP I++++   D ++ + +
Sbjct  371  QS----AYSQGLKDLIDTMLKVNPADRPDINEVIRLTDSVLQRLA  411



>gb|EJU04981.1| Pkinase-domain-containing protein, partial [Dacryopinax sp. DJM-731 
SS1]
Length=425

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 98/165 (59%), Gaps = 7/165 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGN+++      P   ILMDFGSA  AR  I++R +AL  Q+ A+E  + P+R
Sbjct  266  YAHRDIKPGNIMVADDGTTP---ILMDFGSAIRARIPIKTRQQALVQQDLAAEQSTMPYR  322

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEY-ALGESGGSLQLAIVNAQVKWP  376
            APEL+D  ++  + E  DIWSLGCTL+A+ Y  SPFE  A  E GGS+ +A++    K P
Sbjct  323  APELFDVKTNTTLTEAVDIWSLGCTLFALAYNHSPFETNATMEQGGSMAMAVMGGVYKHP  382

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
             G    +Y +     +  ML+     RP I+ ++   DK+IS  S
Sbjct  383  PGY---QYSQGFRNLIDAMLKVSPEERPDINQVIEMTDKVISTLS  424



>gb|KIN04003.1| hypothetical protein OIDMADRAFT_143466 [Oidiodendron maius Zn]
Length=413

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 106/178 (60%), Gaps = 17/178 (10%)
 Frame = -3

Query  735  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF  556
            +YAH D+KPGN+++     QP   ILMD GS  P+   I SRS+A+ +Q+ A+EH + P+
Sbjct  233  AYAHRDIKPGNIMIDDDGEQP---ILMDLGSLAPSPTPITSRSQAIAVQDQAAEHSTMPY  289

Query  555  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP  376
            RAPEL+D  + + ID + DIWSLGCTLYA + G SPFE    E+GGSL + I+    ++P
Sbjct  290  RAPELFDVKTGSVIDTKVDIWSLGCTLYACLVGKSPFEMRSDETGGSLSMCILGGDWRFP  349

Query  375  -------------TGLS-DPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
                         TG S D +  +++ + V   L  + T RP +D+++  V +++ + 
Sbjct  350  DEGAGGKKKTRNQTGQSEDSEISDSIREVVRRCLAVEPTQRPDVDELIEIVQRVVDEL  407



>ref|XP_007383154.1| Pkinase-domain-containing protein [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN09886.1| Pkinase-domain-containing protein [Punctularia strigosozonata 
HHB-11173 SS5]
Length=404

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 8/161 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++         +ILMDFGS   AR  I +R++AL  Q+ A+E  +  +R
Sbjct  247  YAHRDLKPGNVMIAD---DGVTSILMDFGSVMKARVAIENRNQALLQQDIAAEKSTMAYR  303

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE-YALGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   IDE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  304  APELFDVKTGVTIDEKVDIWSLGCTLYAMAYLHSPFENLQTTEQGGSIAMAVMNAQYKHP  363

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
                   Y + L + +  ML    + RP ID ++  VD+ +
Sbjct  364  QS----SYSDGLKKLIDSMLTVDPSKRPDIDQVIGMVDRCL  400



>gb|KII85212.1| hypothetical protein PLICRDRAFT_166831 [Plicaturopsis crispa 
FD-325 SS-3]
Length=445

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 100/165 (61%), Gaps = 9/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV+++   G+P   ILMDFGS   AR ++R+R EAL+ Q+ A+E  +  +R
Sbjct  289  YAHRDLKPGNVMISD-DGRP---ILMDFGSTVRARVEVRNRFEALEQQDMAAEQSTMAYR  344

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTL+A+ Y  SPFE     E GGS+ +A++NA+ K P
Sbjct  345  APELFDVKTGTTLDEKVDIWSLGCTLFALAYSHSPFENTQTTEQGGSIAMAVLNARYKQP  404

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                   Y + L   +  ML+     RP I  ++   D ++   +
Sbjct  405  A----SAYSQGLQNLIDAMLKVDPKERPDIHQVIKLTDGVLRSLT  445



>ref|XP_006955764.1| kinase-like protein [Wallemia sebi CBS 633.66]
 gb|EIM23923.1| kinase-like protein [Wallemia sebi CBS 633.66]
Length=334

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 8/154 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV+LT       L +LMDFGS   AR ++ +RSEAL  Q+ A+EH S P+R
Sbjct  177  YAHRDIKPGNVMLTDN----ALPVLMDFGSCIKARVRVNNRSEALIQQDMAAEHSSMPYR  232

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEY-ALGESGGSLQLAIVNAQVKWP  376
            APEL+D  S   +DE+ DIWSLGCTLYA+ Y  SPFE       GGS+ +A+ + +  +P
Sbjct  233  APELFDVKSDTTLDEKVDIWSLGCTLYALTYSHSPFEDPKQAAQGGSIAMAVQSGRYNYP  292

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
               S+  + +     +   L+     RP +D+++
Sbjct  293  ---SNDTHSDGFKNVIDACLRLNPAERPSVDELI  323



>gb|EMD31340.1| hypothetical protein CERSUDRAFT_119907 [Ceriporiopsis subvermispora 
B]
Length=424

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 98/161 (61%), Gaps = 9/161 (6%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    G P   ILMDFGS   AR ++ +RS+AL  Q+ A+E  +  +R
Sbjct  268  YAHRDLKPGNVMIAD-NGSP---ILMDFGSTMKARIKVENRSQALLQQDIAAEQSTMAYR  323

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  324  APELFDVKTGITLDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVMNAQYKHP  383

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
                +  Y + L   +  ML+     RP I  ++   D+++
Sbjct  384  ----NSAYSQGLKNLIDSMLKVNPAERPDIHKVIEMTDQVL  420



>ref|XP_007880653.1| hypothetical protein PFL1_04932 [Pseudozyma flocculosa PF-1]
 gb|EPQ27394.1| hypothetical protein PFL1_04932 [Pseudozyma flocculosa PF-1]
Length=440

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 98/154 (64%), Gaps = 5/154 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV+++   G+ P  +LMDFGS   AR +I SR EA+  Q++A+E  S P+R
Sbjct  280  YAHRDIKPGNVMISD-DGRTP--VLMDFGSTIKARVRITSRREAVAHQDYAAERSSMPYR  336

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG-ESGGSLQLAIVNAQVKWP  376
            APEL+D P+   + E  DIWSLGC L+A+ Y  SPFE     E GGS+ LA++N   K+P
Sbjct  337  APELFDVPTDCTLTEAVDIWSLGCMLFALAYLHSPFETTQTIEQGGSIALAVLNGSYKFP  396

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
                DP Y +A  + +   ++ +   RP ID+++
Sbjct  397  PAAEDP-YSDATREIIRRCIKVKPDERPDIDEVL  429



>gb|KIJ13415.1| hypothetical protein PAXINDRAFT_170488 [Paxillus involutus ATCC 
200175]
Length=428

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 98/161 (61%), Gaps = 8/161 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++      P   ILMDFGS   AR +I +RS+AL  Q+ A+E  +  +R
Sbjct  271  YAHRDIKPGNVMIADDGVTP---ILMDFGSTIKARIRIETRSQALLQQDIAAEQSTMAYR  327

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTL+A+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  328  APELFDVKTGVTLDEKIDIWSLGCTLFAMAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP  387

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
            +      Y + L   +  ML+  +  RP I  ++   D+++
Sbjct  388  SS----AYSQGLKDLIDSMLKVNSKDRPDIHQVIQATDRVL  424



>gb|KIY96099.1| serine/threonine kinase 16 [Monoraphidium neglectum]
Length=433

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = -3

Query  666  AILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSL  487
            A+LMDFGSARPA  ++ +R +AL LQE A  H +A +RAPEL+D  +H+ +D R D+WSL
Sbjct  273  AVLMDFGSARPAEVRVTNRVDALALQEDAEAHCTATYRAPELFDVGTHSTLDARVDVWSL  332

Query  486  GCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQ  307
            GCTL+ ++YG SPF+ AL + G SL LA++N ++ WP   + P+YP+ LH  +T  L P 
Sbjct  333  GCTLFHMLYGASPFQEAL-DRGASLPLAVMNCRIPWPKPPA-PRYPQELHDLITLCLNPD  390

Query  306  ATVRP  292
               RP
Sbjct  391  PERRP  395



>gb|EST04777.1| Protein kinase [Pseudozyma brasiliensis GHG001]
Length=450

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 92/154 (60%), Gaps = 5/154 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++      P   ILMDFGS   AR  I++R +A+  Q+ A+E  S P+R
Sbjct  290  YAHRDIKPGNVMVADDGKTP---ILMDFGSTIKARVYIKTRKDAMAHQDMAAERSSMPYR  346

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG-ESGGSLQLAIVNAQVKWP  376
            APEL+D P+ A + E  DIWSLGC LYA+ Y  SPFE     E GGS+ LA++N   K P
Sbjct  347  APELFDVPTDATLTEAVDIWSLGCVLYALAYLHSPFETTQTIEQGGSIALAVLNGSYKTP  406

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
                DP Y E   + +   +Q +   RP ID I+
Sbjct  407  PSSEDP-YSEKTREIIKCCIQVKPEERPGIDQII  439



>gb|ETS59570.1| hypothetical protein PaG_06492 [Pseudozyma aphidis DSM 70725]
Length=451

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 5/154 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    GQ P  ILMDFGS   AR  I++R EA+  Q+ A+E  S P+R
Sbjct  291  YAHRDIKPGNVMVAD-DGQTP--ILMDFGSTIKARVHIKTRKEAVAHQDLAAERSSMPYR  347

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG-ESGGSLQLAIVNAQVKWP  376
            APEL+D P+   + E  DIWSLGC LYA+ Y  SPFE     E GGS+ LA++N   K P
Sbjct  348  APELFDVPTDVTLTEAVDIWSLGCLLYALAYLHSPFETTQTVEQGGSIALAVLNGSYKTP  407

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
                DP Y E   + +   +Q +   RP ID ++
Sbjct  408  PSSQDP-YSEKTREIIKRCIQVKPEDRPDIDQVI  440



>dbj|GAC72100.1| serine/threonine protein kinase [Pseudozyma antarctica T-34]
Length=451

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 5/154 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    GQ P  ILMDFGS   AR  I++R EA+  Q+ A+E  S P+R
Sbjct  291  YAHRDIKPGNVMVAD-DGQTP--ILMDFGSTIKARVHIKTRKEAVAHQDLAAERSSMPYR  347

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG-ESGGSLQLAIVNAQVKWP  376
            APEL+D P+   + E  DIWSLGC LYA+ Y  SPFE     E GGS+ LA++N   K P
Sbjct  348  APELFDVPTDVTLTEAVDIWSLGCLLYALAYLHSPFETTQTVEQGGSIALAVLNGSYKTP  407

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
                DP Y E   + +   +Q +   RP ID ++
Sbjct  408  PSSQDP-YSEKTREIIKRCIQVKPEDRPDIDQVI  440



>ref|XP_001836285.1| other/NAK protein kinase [Coprinopsis cinerea okayama7#130]
 gb|EAU85469.1| other/NAK protein kinase [Coprinopsis cinerea okayama7#130]
Length=413

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 97/165 (59%), Gaps = 8/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGN+++      P   ILMDFGS   A+  I +R +AL  Q+ A+E  +  +R
Sbjct  256  YAHRDLKPGNIMIADDGKTP---ILMDFGSTMKAKIPIENRQQALLQQDIAAEQSTMAYR  312

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  313  APELFDVKTGITLDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP  372

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                   Y + L   +  ML+P    RP I+ ++   D+++   +
Sbjct  373  QS----AYSQGLRSLIDAMLKPNPQERPDINQVIELTDRVLQSLA  413



>gb|AEE60827.1| serine/threonine kinase [Haemaphysalis longicornis]
Length=307

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 102/176 (58%), Gaps = 9/176 (5%)
 Frame = -3

Query  774  LCAGLKHMHNFEP-SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            +C G++ +H+  P + AH D+KP NVLL    G+  + + MDFGS   AR  I   SEA+
Sbjct  134  MCQGVQAIHSAMPIALAHRDLKPANVLL----GEDDVPVWMDFGSMGRARLDIGRTSEAM  189

Query  597  QLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG  418
             LQ+ A+E  S  +RAPEL++  S   IDER DIWSLGC LYA+ +  SPFE A  E G 
Sbjct  190  ALQDLATEKCSMSYRAPELFNVESRTSIDERVDIWSLGCCLYAMCFFRSPFEAA-RERGD  248

Query  417  SLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLIS  250
            S+ LA+++  V  P    D  Y   LH  +  ML+     RP I+ ++  V  L++
Sbjct  249  SVALAVLSGHVDIP---EDSPYSGGLHTLIRTMLEVDCLQRPFIETVLDQVTALLA  301



>gb|EMS19970.1| serine/threonine-protein kinase [Rhodosporidium toruloides NP11]
 emb|CDR45442.1| RHTO0S11e00254g1_1 [Rhodosporidium toruloides]
Length=447

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 94/164 (57%), Gaps = 7/164 (4%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            +AH D+KP NV+L      P   ILMDFGSA PAR  I  R  AL  Q+ A+EH S PFR
Sbjct  289  WAHRDIKPANVMLADDGTTP---ILMDFGSAMPARIPIPDRRVALLQQDLAAEHCSMPFR  345

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   + E  DIWSLGCTLYA+ YG SPFE A   E GGS+ +A +  +  +P
Sbjct  346  APELFDVKTGTTLTEAVDIWSLGCTLYAMAYGTSPFETAQQSEHGGSIAMAAMGGKFSFP  405

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
                D +Y E     V  ML+     RP I  ++    +++++ 
Sbjct  406  ---DDGQYSERFRDLVRAMLKVNPEERPTIQKVIEMTQEVLARL  446



>emb|CCA71061.1| related to Prk1p [Piriformospora indica DSM 11827]
Length=471

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 101/171 (59%), Gaps = 9/171 (5%)
 Frame = -3

Query  765  GLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQE  586
            G+K MH     YAH D+KPGNV+L+  +G P   ILMDFGS   AR  I +RSEAL  Q+
Sbjct  306  GMKRMH---VPYAHRDIKPGNVMLSD-EGNP---ILMDFGSTVVARMYIATRSEALTQQD  358

Query  585  WASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQL  406
             A+E  +  FRAPEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE A  ++GGS+ +
Sbjct  359  IAAEQSTMTFRAPELFDVKTGVTLDEKVDIWSLGCTLYALAYNRSPFETAE-QAGGSIAM  417

Query  405  AIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
            A +N Q K P   +   Y + L   +   +      RP I  I+   D ++
Sbjct  418  AAMNGQYKHPAAAAG-AYSQGLRDLIDACMVVDPASRPDIHRILELTDGVL  467



>ref|XP_796127.2| PREDICTED: serine/threonine-protein kinase 16-like [Strongylocentrotus 
purpuratus]
Length=294

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 104/172 (60%), Gaps = 12/172 (7%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSE  604
            + +C G+K +H  +P   AH D+KPGNV+L     +    ++MDFGS   AR +++ RSE
Sbjct  127  KGVCEGIKALHTAKPKPLAHRDMKPGNVMLA----EDDTPVIMDFGSMGEARIEVKGRSE  182

Query  603  ALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE--YALG  430
            A  LQ+ A+E  S  FRAPEL+   SH  ++E+ DIWSLGC L+ + Y  SPFE  YA G
Sbjct  183  ACALQDLAAEKCSMLFRAPELFHVDSHCIVEEKVDIWSLGCVLFNMAYLHSPFEPIYARG  242

Query  429  ESGGSLQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
            +   S+ LA++    K+P   +  +    L+Q +T MLQ  A  RP I++I+
Sbjct  243  D---SIHLAVLGRNFKFPE--NSRESSGLLNQLITEMLQVDANERPSINEIL  289



>ref|XP_003377990.1| serine/threonine-protein kinase 16 [Trichinella spiralis]
 gb|EFV56765.1| serine/threonine-protein kinase 16 [Trichinella spiralis]
Length=317

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 104/171 (61%), Gaps = 15/171 (9%)
 Frame = -3

Query  774  LCAGLKHMHNFEPS-YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEAL  598
            +C GL  +H+ +P  YAH D++P NVLL         A+LMD GSAR A   + +   A 
Sbjct  153  ICNGLNALHSLKPQPYAHRDLRPANVLLNDDDS----AVLMDLGSARLAEFTVVNECRAR  208

Query  597  QLQEWASEHVSAPFRAPELWDCPSHAD-IDERTDIWSLGCTLYAIMYGVSPFEYALGESG  421
            QLQ++A+EH S  +RAPEL+  P+  D +DER+DIWSLGC LYA+ +  SPFEY   + G
Sbjct  209  QLQDYAAEHCSMFYRAPELF-APNVGDKLDERSDIWSLGCLLYALCFWESPFEYTF-DKG  266

Query  420  GSLQLAIVNAQVKWPTGLSDPK--YPEALHQFVTWMLQPQATVRPHIDDIV  274
             SL LA+++A  + P     PK  Y + +H  + +ML+P    RP +  ++
Sbjct  267  DSLMLAVLSANYRIP-----PKSPYSKTVHDLLKFMLEPDINRRPRLSAVM  312



>dbj|GAK65304.1| pkinase-domain-containing protein [Pseudozyma antarctica]
Length=523

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 5/154 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    GQ P  ILMDFGS   AR  I++R EA+  Q+ A+E  S P+R
Sbjct  363  YAHRDIKPGNVMVAD-DGQTP--ILMDFGSTIKARVHIKTRKEAVAHQDLAAERSSMPYR  419

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG-ESGGSLQLAIVNAQVKWP  376
            APEL+D P+   + E  DIWSLGC LYA+ Y  SPFE     E GGS+ LA++N   K P
Sbjct  420  APELFDVPTDVTLTEAVDIWSLGCLLYALAYLHSPFETTQTVEQGGSIALAVLNGSYKTP  479

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
                DP Y E   + +   +Q +   RP ID ++
Sbjct  480  PSSQDP-YSEKTREIIKRCIQVKPEDRPDIDQVI  512



>gb|KFU88495.1| Serine/threonine-protein kinase 16, partial [Chaetura pelagica]
Length=276

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 104/173 (60%), Gaps = 11/173 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C+GL+ +H+    YAH D+KP NVLL     +P   ILMD GS   AR ++ S  +A+ 
Sbjct  103  ICSGLQAIHS--KGYAHRDLKPTNVLLD-EDDRP---ILMDLGSMNKARIEVNSSRKAIA  156

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  P++ A+ + G S
Sbjct  157  VQDWAAQRCTISYRAPELFTVPSQCVIDERTDIWSLGCVLYCMMFGEGPYD-AVFQKGDS  215

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            + LA+ N     PT     +Y  AL   ++ M+      RP IDDI+  ++ L
Sbjct  216  VALAVQNPITVPPT----TRYSAALQHLLSSMMTLNPQARPSIDDILHQLEGL  264



>ref|XP_001795102.1| hypothetical protein SNOG_04689 [Phaeosphaeria nodorum SN15]
 gb|EAT88449.1| hypothetical protein SNOG_04689 [Phaeosphaeria nodorum SN15]
Length=412

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 104/174 (60%), Gaps = 11/174 (6%)
 Frame = -3

Query  741  EPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSA  562
            E +YAH D+KPGN+++      P   ILMD GS  P+   + SRS ALQ+Q+ A+EH + 
Sbjct  235  ERAYAHRDIKPGNIMIDDDGKSP---ILMDLGSLAPSPTPVTSRSLALQIQDTAAEHSTM  291

Query  561  PFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVK  382
            P+RAPEL+D  + + ID + DIWSLGCTLYA + G SPFE+   E+GGSL + ++    +
Sbjct  292  PYRAPELFDVKTGSVIDTKVDIWSLGCTLYACLVGKSPFEFRSDETGGSLSICVLGGDWR  351

Query  381  WP--------TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
            +P           ++    E + + V   L+ + + RP +D+++  V++L+   
Sbjct  352  FPDEGPQRGKAKQTEEVISEPVKEVVRKCLKLEPSERPDVDELISIVEELLESL  405



>gb|KIK16096.1| hypothetical protein PISMIDRAFT_277244 [Pisolithus microcarpus 
441]
Length=415

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 98/170 (58%), Gaps = 9/170 (5%)
 Frame = -3

Query  747  NFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHV  568
            N    YAH D+KPGNV+L    G P   +LMDFGS   AR  + SRS+AL  Q+ A+E  
Sbjct  254  NLHVPYAHRDIKPGNVMLAD-DGTP---VLMDFGSTVKARIPVESRSQALLQQDIAAEQS  309

Query  567  SAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNA  391
            +  +RAPEL+D  +   ++E+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NA
Sbjct  310  TMAYRAPELFDVKTGVTLNEKVDIWSLGCTLYAMAYSHSPFENTQTTEQGGSIAMAVLNA  369

Query  390  QVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            Q   P    D  Y + L + +   L+     RP I  ++   + L+  F+
Sbjct  370  QYNHP----DSAYSQRLKELIDMSLKVDPKERPDIHQVITATNNLLRSFA  415



>gb|KJB19471.1| hypothetical protein B456_003G104700 [Gossypium raimondii]
Length=255

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 64/77 (83%), Gaps = 5/77 (6%)
 Frame = -3

Query  780  RQLCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEA  601
            RQLCAGLKHMHN  P YAHNDVKPGNVLL+HRKG+ PLAILMDFGSARPARKQIRSRSEA
Sbjct  166  RQLCAGLKHMHNLGPPYAHNDVKPGNVLLSHRKGKCPLAILMDFGSARPARKQIRSRSEA  225

Query  600  LQLQEWASEHVSAPFRA  550
            LQLQ W       PFR 
Sbjct  226  LQLQVWG-----IPFRV  237



>ref|XP_004196658.1| Piso0_003883 [Millerozyma farinosa CBS 7064]
 ref|XP_004197689.1| Piso0_003883 [Millerozyma farinosa CBS 7064]
 emb|CCE84339.1| Piso0_003883 [Millerozyma farinosa CBS 7064]
 emb|CCE83308.1| Piso0_003883 [Millerozyma farinosa CBS 7064]
Length=358

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 98/161 (61%), Gaps = 7/161 (4%)
 Frame = -3

Query  756  HMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWAS  577
             +  F P YAH D+KP NV+L+  +G P   +L+D GS   AR  +++R +AL + ++A+
Sbjct  196  ELQEFAP-YAHRDIKPANVMLSA-EGLP---VLVDLGSCSKARLSVKNRQQALAITDFAA  250

Query  576  EHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIV  397
            EH + P+RAPEL D   +++I E+TDIWSLGC +YA  +G SPFE    E G +L LAI 
Sbjct  251  EHCTLPYRAPELLDVAVNSEITEKTDIWSLGCLVYACCFGFSPFEKLEVEQGANLNLAIT  310

Query  396  NAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
              +   P+      Y + L   +  ML  ++T RP ID+I+
Sbjct  311  QGRYNIPS--DQNGYSDELINLIKDMLVLESTQRPSIDEIL  349



>ref|XP_005676997.1| PREDICTED: serine/threonine-protein kinase 16-like, partial [Capra 
hircus]
Length=223

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 97/163 (60%), Gaps = 11/163 (7%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C GL+ +H     YAH D+KP N+LL   +GQP   +LMD GS   A   +    +AL 
Sbjct  50   ICRGLEAIHT--KGYAHRDLKPTNILLGD-EGQP---VLMDLGSMNQACIHVEGSRQALA  103

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            LQ+WA++  +  +RAPEL+   SH  IDERTD+WSLGC LYA+M+G  P++    + G S
Sbjct  104  LQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVF-QKGDS  162

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHI  286
            + LA+ N Q+  P     P++  AL Q +T M+      RPHI
Sbjct  163  VALAVQN-QLSIP---QSPRHSSALRQLLTSMMTVDPQQRPHI  201



>emb|CCM04252.1| predicted protein [Fibroporia radiculosa]
Length=417

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 97/161 (60%), Gaps = 9/161 (6%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++    G P   ILMDFGS   AR +I +RS+AL  Q+ A+E  +  +R
Sbjct  261  YAHRDLKPGNVMIAD-DGSP---ILMDFGSTMKARIKIENRSQALLQQDIAAEQSTMAYR  316

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE-YALGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTL+A+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  317  APELFDVKTGVTLDEKVDIWSLGCTLFALAYSHSPFENMQTTEQGGSIAMAVMNAQYKHP  376

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
            +      Y + L   +  ML+     RP I  ++   D+ +
Sbjct  377  SS----AYSQGLKNLIDSMLKSNPQDRPDIHQVIEMTDRAL  413



>emb|CDS07418.1| hypothetical protein LRAMOSA01367 [Absidia idahoensis var. thermophila]
Length=386

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 93/159 (58%), Gaps = 5/159 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KP N+L+    G  P  IL DFGS   AR  I++R EAL  Q+ A+EH +  +R
Sbjct  220  YAHRDLKPSNILIAD-DGHTP--ILTDFGSITRARMNIKTRREALLQQDLAAEHSTMAYR  276

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPF-EYALGESGGSLQLAIVNAQVKWP  376
            +PEL+D      +DE+ DIWSLGC LYA  YG SPF E  + + GGS+ LA++N Q K+P
Sbjct  277  SPELYDVQVGTQLDEKMDIWSLGCLLYATAYGQSPFSETNMHQVGGSMSLAVLNGQYKFP  336

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDK  259
               +DP Y E     +  ML      R  I  ++  VD+
Sbjct  337  PAENDP-YSEGFRALIRSMLVVDRKERADIQSVIATVDR  374



>gb|KIK10008.1| hypothetical protein K443DRAFT_136030 [Laccaria amethystina LaAM-08-1]
Length=420

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 97/165 (59%), Gaps = 8/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++      P   ILMDFGS   AR  + +RS+AL  Q+ A+E  +  +R
Sbjct  263  YAHRDLKPGNVMIADDGVTP---ILMDFGSTMKARIVVDNRSQALYQQDIAAEQSTMSYR  319

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  320  APELFDVKTGQTLDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP  379

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                   Y + L   +  ML+     RP I+ ++   D+++   +
Sbjct  380  QS----AYSQGLKDLIDSMLKVNPKERPDINKVIEMTDRVLQTLA  420



>gb|KDQ24429.1| hypothetical protein PLEOSDRAFT_1094292 [Pleurotus ostreatus 
PC15]
Length=416

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 97/165 (59%), Gaps = 8/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++      P   ILMDFGS   AR +I +RS+AL  Q+ A+E  +  +R
Sbjct  259  YAHRDLKPGNVMIADDGVTP---ILMDFGSTIKARIKIDTRSQALLQQDIAAEQSTMAYR  315

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTLYA+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  316  APELFDVKTGHTLDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP  375

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
                D  Y +     +  ML+     RP+I  ++   D ++   S
Sbjct  376  ----DSAYSQGSKDLIDSMLKVNPDDRPNIHQVIEKADAVLRSLS  416



>ref|XP_009994572.1| PREDICTED: serine/threonine-protein kinase 16 [Chaetura pelagica]
Length=284

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 103/173 (60%), Gaps = 11/173 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C+GL+ +H+    YAH D+KP NVLL     +    ILMD GS   AR ++ S  +A+ 
Sbjct  111  ICSGLQAIHS--KGYAHRDLKPTNVLLD----EDDRPILMDLGSMNKARIEVNSSRKAIA  164

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  P++ A+ + G S
Sbjct  165  VQDWAAQRCTISYRAPELFTVPSQCVIDERTDIWSLGCVLYCMMFGEGPYD-AVFQKGDS  223

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            + LA+ N     PT     +Y  AL   ++ M+      RP IDDI+  ++ L
Sbjct  224  VALAVQNPITVPPT----TRYSAALQHLLSSMMTLNPQARPSIDDILHQLEGL  272



>ref|XP_007846682.1| nak protein kinase [Moniliophthora roreri MCA 2997]
 gb|ESK93988.1| nak protein kinase [Moniliophthora roreri MCA 2997]
Length=418

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 98/165 (59%), Gaps = 8/165 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++      P   ILMDFGS   AR  I +RS+AL  Q+ A+E  +  +R
Sbjct  261  YAHRDIKPGNVMIADDGVTP---ILMDFGSTMKARIPIENRSQALLQQDIAAEQSTMAYR  317

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGCTL+A+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  318  APELFDVKTGITLDEKVDIWSLGCTLFALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP  377

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKFS  241
            +      Y + L   +  ML+     RP I +++   D+++   +
Sbjct  378  SS----AYSQGLKDLIDSMLKVNPQERPDIHEVIEMTDRVLQTLA  418



>dbj|GAC94527.1| likely protein kinase [Pseudozyma hubeiensis SY62]
Length=449

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 91/154 (59%), Gaps = 5/154 (3%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV++      P   ILMDFGS   AR  I++R EA+  Q+ A+E  S P+R
Sbjct  289  YAHRDIKPGNVMVADDGKTP---ILMDFGSTIKARVHIKTRREAVAHQDMAAERSSMPYR  345

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALG-ESGGSLQLAIVNAQVKWP  376
            APEL+D P+   + E  DIWSLGC LYA+ Y  SPFE     E GGS+ LA++N   K P
Sbjct  346  APELFDVPTETTLTESVDIWSLGCLLYALAYLHSPFETTQTIEQGGSIALAVLNGSYKTP  405

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIV  274
                DP Y E   + +   +Q +   RP +D ++
Sbjct  406  PSSEDP-YSEKTREIIKRCIQVKPDERPDVDAVI  438



>ref|XP_007677906.1| hypothetical protein BAUCODRAFT_541809 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC95445.1| hypothetical protein BAUCODRAFT_541809 [Baudoinia compniacensis 
UAMH 10762]
Length=430

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 105/183 (57%), Gaps = 22/183 (12%)
 Frame = -3

Query  735  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF  556
            SYAH D+KPGN++++    QP   +LMDFGS  P+   + SR+ ALQ+Q+ A+EH + P+
Sbjct  240  SYAHRDIKPGNIMISDNGTQP---VLMDFGSLAPSPTPVTSRALALQIQDQAAEHSTMPY  296

Query  555  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP  376
            RAPEL+D  +   ID + DIWSLGCTLYA + G SPFE    E+GGSL L ++    ++P
Sbjct  297  RAPELFDVKTGTVIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSLCVLGGDWRFP  356

Query  375  TG-----------LSDPKYP--------EALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
                         ++D + P        E + + V   L+ +   RP ID +   V++++
Sbjct  357  DEGPAEAKRGKQRVTDAEAPKKKEDVVSEPVKEVVRACLRVEPAERPDIDQLTAMVEEVV  416

Query  252  SKF  244
            +  
Sbjct  417  ASL  419



>ref|XP_010582413.1| PREDICTED: serine/threonine-protein kinase 16 [Haliaeetus leucocephalus]
Length=295

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 103/173 (60%), Gaps = 11/173 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C+GL+ +H     YAH D+KP NVLL     +P   +LMD GS   AR ++ S  EA+ 
Sbjct  122  ICSGLQAIHG--KGYAHRDLKPTNVLLDE-DDRP---VLMDLGSMNRARIEVNSSQEAMA  175

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  P++ A+ + G S
Sbjct  176  VQDWAAQRCTISYRAPELFTVPSQCVIDERTDIWSLGCVLYCMMFGEGPYD-AIFQKGDS  234

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            + LA+ N  V  PT     +Y  AL + +  M+      RP I DI+  +D L
Sbjct  235  VALAVQNPIVVPPT----TRYSAALQRLLFSMMTLNPQERPSISDILHQLDGL  283



>gb|KDE05248.1| NAK protein kinase [Microbotryum violaceum p1A1 Lamole]
Length=435

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 103/170 (61%), Gaps = 7/170 (4%)
 Frame = -3

Query  750  HNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEH  571
            +  EP +AH D+KP N++LT    +P   ILMDFGSA PAR  I +R  AL  Q+ A+EH
Sbjct  271  NGVEP-WAHRDIKPANIMLTD-DSRP---ILMDFGSALPARIPIPNRQIALLQQDLAAEH  325

Query  570  VSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYA-LGESGGSLQLAIVN  394
             S PFRAPEL+D  +   ++E+ DIWSLG TL+A+ YG SPFE     E GGS+ +A++N
Sbjct  326  CSMPFRAPELFDVKTGITLNEKVDIWSLGATLFAMAYGTSPFETTQQSEHGGSIAMAVMN  385

Query  393  AQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISKF  244
             +  +P   S+ ++ E     +  ML+     RP I  ++   + +I++ 
Sbjct  386  GKYDFPRS-SEGRHSEGFRDLIRMMLKVDPKQRPDIHQVITSTEAVIARL  434



>ref|XP_009080397.1| PREDICTED: serine/threonine-protein kinase 16, partial [Acanthisitta 
chloris]
 gb|KFP88053.1| Serine/threonine-protein kinase 16, partial [Acanthisitta chloris]
Length=276

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 102/173 (59%), Gaps = 11/173 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C GL+ +H+    YAH D+KP NVLL     QP   +LMD GS   AR ++ S  EA+ 
Sbjct  103  ICRGLQAIHS--KGYAHRDLKPTNVLLD-EDDQP---VLMDLGSMNHARIEVNSSREAMA  156

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  PF+ A+ + G S
Sbjct  157  VQDWAAQRCTISYRAPELFSVPSQCVIDERTDIWSLGCVLYCMMFGEGPFD-AIFQKGDS  215

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            + LA+ N     PT     +Y  AL   +  M+      RP I+DI+  ++ L
Sbjct  216  VALAVQNPITLPPT----TRYSAALQHLLFSMMTVNPQERPSINDILHQLEGL  264



>ref|XP_007300066.1| Pkinase-domain-containing protein [Stereum hirsutum FP-91666 
SS1]
 gb|EIM91316.1| Pkinase-domain-containing protein [Stereum hirsutum FP-91666 
SS1]
Length=433

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 96/161 (60%), Gaps = 8/161 (5%)
 Frame = -3

Query  732  YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPFR  553
            YAH D+KPGNV+L      P   ILMDFGS   AR  I +RS+AL  Q+ A+EH +  +R
Sbjct  280  YAHRDLKPGNVMLADDGVTP---ILMDFGSCMKARIPIENRSQALLQQDIAAEHSTMAYR  336

Query  552  APELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFE-YALGESGGSLQLAIVNAQVKWP  376
            APEL+D  +   +DE+ DIWSLGC L+A+ Y  SPFE     E GGS+ +A++NAQ K P
Sbjct  337  APELFDVKTGLTLDEKVDIWSLGCVLFALAYSHSPFENMQTTEQGGSIAMAVLNAQYKHP  396

Query  375  TGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLI  253
            +      Y       V  ML+   T RP I+ ++   ++L+
Sbjct  397  SS----GYSAGFKALVDSMLKVNPTERPDINQVLDATNRLL  433



>gb|KIW07925.1| hypothetical protein PV09_01833 [Verruconis gallopava]
Length=408

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 104/181 (57%), Gaps = 20/181 (11%)
 Frame = -3

Query  735  SYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQLQEWASEHVSAPF  556
            +YAH D+KPGNV++      P   ILMD GS  P+   I SRS+AL +Q+ A+EH + P+
Sbjct  225  AYAHRDIKPGNVMIADDGKTP---ILMDLGSLAPSPTPITSRSQALAVQDQAAEHSTMPY  281

Query  555  RAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSLQLAIVNAQVKWP  376
            RAPEL+D  + + ID + DIWSLGCTLYA + G SPFE    E+GGSL L ++    ++P
Sbjct  282  RAPELFDVKTGSTIDTKVDIWSLGCTLYACLVGKSPFEARSDETGGSLSLCVLGGDWRFP  341

Query  375  -TGL----------------SDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKLISK  247
              G+                 +    E++   V   L+ +   RP ID+++  V+K+I++
Sbjct  342  DEGVPKRRQSNKPAQQELRGDENAISESVKDVVRKCLRVEPAERPDIDELITIVEKVIAE  401

Query  246  F  244
             
Sbjct  402  L  402



>gb|EMC84229.1| Serine/threonine-protein kinase 16, partial [Columba livia]
Length=276

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 102/173 (59%), Gaps = 11/173 (6%)
 Frame = -3

Query  774  LCAGLKHMHNFEPSYAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARKQIRSRSEALQ  595
            +C GL+ +H+    YAH D+KP NVLL     QP   +LMD GS   AR ++ S  EA+ 
Sbjct  103  ICRGLQAIHS--KGYAHRDLKPTNVLLD-EDDQP---VLMDLGSMNQARIEVNSSREAVA  156

Query  594  LQEWASEHVSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGS  415
            +Q+WA++  +  +RAPEL+  PS   IDERTDIWSLGC LY +M+G  P++ A+ + G S
Sbjct  157  VQDWAAQRCTISYRAPELFTVPSQCVIDERTDIWSLGCVLYCMMFGEGPYD-AIFQKGDS  215

Query  414  LQLAIVNAQVKWPTGLSDPKYPEALHQFVTWMLQPQATVRPHIDDIVIHVDKL  256
            + LA+ N     PT     +Y  AL   +  M+      RP IDD++  ++ L
Sbjct  216  VALAVQNPITVPPT----TRYSAALQHLLLSMMTLNPQERPSIDDVLHQLEGL  264



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940