BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF021L10

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    417   2e-142   Elaeis guineensis
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    417   3e-142   Oryza brachyantha
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     416   5e-142   Sesamum indicum [beniseed]
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                413   2e-141   Erythranthe guttata [common monkey flower]
ref|NP_001265946.1|  Hop-interacting protein THI032                     414   2e-141   Solanum lycopersicum
gb|KJB83533.1|  hypothetical protein B456_013G252200                    412   3e-141   Gossypium raimondii
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    414   4e-141   
gb|AAL47679.1|  aminotransferase 1                                      414   5e-141   Cucumis melo [Oriental melon]
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    414   6e-141   Cucumis sativus [cucumbers]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             413   9e-141   Prunus persica
gb|KJB54393.1|  hypothetical protein B456_009G074800                    409   1e-140   Gossypium raimondii
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    412   1e-140   Solanum tuberosum [potatoes]
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     412   1e-140   Prunus mume [ume]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     412   2e-140   Pyrus x bretschneideri [bai li]
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     412   2e-140   Gossypium hirsutum [American cotton]
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     412   3e-140   Nicotiana tomentosiformis
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     412   3e-140   Fragaria vesca subsp. vesca
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     412   3e-140   Nicotiana sylvestris
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       411   4e-140   Gossypium arboreum [tree cotton]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     411   7e-140   Malus domestica [apple tree]
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     410   8e-140   
gb|AAQ56192.1|  aminotransferase 1                                      410   1e-139   Cucumis melo [Oriental melon]
gb|KJB54389.1|  hypothetical protein B456_009G074800                    410   1e-139   Gossypium raimondii
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         410   1e-139   Ricinus communis
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                410   2e-139   Cucumis melo [Oriental melon]
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             404   2e-139   
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      409   4e-139   
ref|NP_001062170.1|  Os08g0502700                                       409   5e-139   
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     409   6e-139   Elaeis guineensis
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             405   6e-139   
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     408   7e-139   Tarenaya hassleriana [spider flower]
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          408   7e-139   Amborella trichopoda
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     408   8e-139   Eucalyptus grandis [rose gum]
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             408   1e-138   Fritillaria agrestis
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     408   1e-138   Nelumbo nucifera [Indian lotus]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    408   1e-138   Sesamum indicum [beniseed]
dbj|BAJ90006.1|  predicted protein                                      407   1e-138   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     407   2e-138   Phoenix dactylifera
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         407   2e-138   Jatropha curcas
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  407   2e-138   Citrus sinensis [apfelsine]
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     405   3e-138   Peperomia schizandra
gb|ABQ81924.1|  aminotransferase 2                                      407   3e-138   Cucumis sativus [cucumbers]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    406   4e-138   Citrus sinensis [apfelsine]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     406   4e-138   Triticum urartu
gb|ABQ81922.1|  aminotransferase 2                                      406   4e-138   Cucumis sativus [cucumbers]
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    406   4e-138   Cucumis melo [Oriental melon]
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       406   6e-138   Gossypium arboreum [tree cotton]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            406   6e-138   Cucumis melo [Oriental melon]
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    400   8e-138   
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     404   9e-138   Peperomia bracteata
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             405   1e-137   Citrus clementina [clementine]
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     405   1e-137   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     403   1e-137   Peperomia cerrateae
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     403   2e-137   Peperomia cerrateae
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     403   2e-137   Peperomia cerrateae
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             404   2e-137   Populus trichocarpa [western balsam poplar]
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           404   2e-137   Cucumis melo [Oriental melon]
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     402   3e-137   Peperomia bracteata
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     402   4e-137   Peperomia cavispicata
gb|ABK24112.1|  unknown                                                 404   4e-137   Picea sitchensis
gb|ACN39798.1|  unknown                                                 404   4e-137   Picea sitchensis
gb|ABQ81925.1|  aminotransferase 2                                      404   4e-137   Cucumis melo [Oriental melon]
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     402   5e-137   Peperomia bracteata
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     402   5e-137   Peperomia bracteata
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     402   5e-137   Peperomia radiatinervosa
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     402   5e-137   Peperomia ayacuchoana
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     402   5e-137   Peperomia radiatinervosa
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     403   6e-137   Populus euphratica
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     402   7e-137   Peperomia bracteata
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     402   7e-137   Peperomia parvisagittata
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     401   9e-137   Peperomia radiatinervosa
gb|AAQ56193.1|  aminotransferase 2                                      403   9e-137   Cucumis melo [Oriental melon]
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     401   1e-136   Peperomia bracteata
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    402   1e-136   Cucumis sativus [cucumbers]
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    402   1e-136   Glycine max [soybeans]
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      402   1e-136   Genlisea aurea
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     400   2e-136   Peperomia parvisagittata
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     402   2e-136   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI24214.3|  unnamed protein product                                401   2e-136   Vitis vinifera
emb|CDP08481.1|  unnamed protein product                                402   2e-136   Coffea canephora [robusta coffee]
ref|NP_001237048.1|  enzymatic resistance protein                       402   2e-136   
gb|AFK37194.1|  unknown                                                 395   2e-136   Medicago truncatula
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     400   2e-136   Peperomia andina
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    402   3e-136   Glycine max [soybeans]
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                401   3e-136   Medicago truncatula
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     400   4e-136   Peperomia pseudoverruculosa
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     399   5e-136   Peperomia questionis
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     401   5e-136   Vitis vinifera
gb|ACN36238.1|  unknown                                                 398   6e-136   Zea mays [maize]
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    400   7e-136   Setaria italica
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    400   8e-136   
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     399   9e-136   Peperomia verruculosa
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     399   9e-136   Peperomia verruculosa
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     402   1e-135   Brachypodium distachyon [annual false brome]
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     400   1e-135   Glycine soja [wild soybean]
emb|CAN84001.1|  hypothetical protein VITISV_007680                     400   1e-135   Vitis vinifera
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    400   1e-135   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK40703.1|  unknown                                                 400   1e-135   Medicago truncatula
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           400   1e-135   Glycine max [soybeans]
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      400   1e-135   Spirodela polyrhiza
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     398   2e-135   Peperomia bracteata
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    399   2e-135   Glycine max [soybeans]
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    400   3e-135   
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     397   3e-135   Peperomia parvifolia
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     397   3e-135   Peperomia peruviana
ref|NP_001148339.1|  LOC100281949                                       399   3e-135   Zea mays [maize]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             399   4e-135   Phaseolus vulgaris [French bean]
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     397   5e-135   Peperomia rupiseda
ref|XP_002313371.1|  aminotransferase 2 family protein                  398   6e-135   
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    397   1e-134   Phaseolus vulgaris [French bean]
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     396   1e-134   Peperomia chutanka
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     395   1e-134   Peperomia sp. JN-2011
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          397   2e-134   Sorghum bicolor [broomcorn]
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             397   2e-134   
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    397   2e-134   Populus euphratica
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     397   2e-134   Brassica rapa
emb|CDX81443.1|  BnaC09g08540D                                          397   2e-134   
emb|CDY37208.1|  BnaA09g08290D                                          397   2e-134   Brassica napus [oilseed rape]
gb|KJB54391.1|  hypothetical protein B456_009G074800                    389   3e-134   Gossypium raimondii
dbj|BAJ33858.1|  unnamed protein product                                397   4e-134   Eutrema halophilum
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     394   4e-134   Peperomia cyclaminoides
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     394   5e-134   Peperomia aff. gracillima JN-2011
gb|ABK96624.1|  unknown                                                 395   6e-134   Populus trichocarpa x Populus deltoides
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     393   1e-133   Peperomia putlaensis
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    394   2e-133   Brassica rapa
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     392   5e-133   Peperomia peruviana
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     391   9e-133   Peperomia pugnicaudex
emb|CDX89604.1|  BnaC03g45180D                                          392   1e-132   
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     390   3e-132   Peperomia polycephala
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    391   3e-132   Camelina sativa [gold-of-pleasure]
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     389   4e-132   Peperomia peruviana
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    391   5e-132   Camelina sativa [gold-of-pleasure]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  390   1e-131   Arabidopsis thaliana [mouse-ear cress]
gb|ABF70331.1|  aminotransferase 1                                      389   3e-131   Cucumis sativus [cucumbers]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             388   5e-131   
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             385   8e-130   Capsella rubella
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     377   2e-127   Peperomia cyclaminoides
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     377   2e-127   Peperomia putlaensis
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     375   6e-127   Peperomia cyclaminoides
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    379   9e-127   Camelina sativa [gold-of-pleasure]
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     375   1e-126   Peperomia peruviana
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     374   1e-126   Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     374   2e-126   Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     374   2e-126   Peperomia aff. ovatopeltata JN-2011
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     373   5e-126   Peperomia peruviana
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     372   8e-126   Peperomia cyclaminoides
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     373   9e-126   Peperomia peruviana
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     372   1e-125   Peperomia peruviana
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     371   5e-125   Peperomia sp. JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     370   1e-124   Peperomia radiatinervosa
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     368   7e-124   Peperomia sp. JN-2011
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     366   3e-123   Peperomia aff. ovatopeltata JN-2011
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     366   3e-123   Peperomia exclamationis
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    360   8e-120   Cicer arietinum [garbanzo]
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     355   2e-119   Peperomia gigantea
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     355   5e-119   Peperomia aff. pinoi JN-2011
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                356   2e-118   Medicago truncatula
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     351   1e-117   Peperomia jalcaensis
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     352   2e-117   Peperomia parvisagittata
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     351   2e-117   Peperomia elatior
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     350   9e-117   Peperomia wernerrauhii
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             351   2e-116   Selaginella moellendorffii
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     348   2e-116   Peperomia schizandra
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     348   3e-116   Peperomia cerrateae
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             349   9e-116   
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     346   1e-115   Peperomia dolabella
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     347   1e-115   Peperomia basiradicans
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     346   2e-115   Peperomia cerrateae
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     345   7e-115   Peperomia klopfensteinii
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     344   8e-115   Peperomia wernerrauhii
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     329   2e-109   Peperomia sp. JN-2011
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             332   5e-109   Selaginella moellendorffii
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                330   8e-109   Morus notabilis
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             331   2e-108   Selaginella moellendorffii
ref|XP_001755667.1|  predicted protein                                  330   2e-108   
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     327   5e-108   Peperomia aff. ovatopeltata JN-2011
ref|XP_001783551.1|  predicted protein                                  328   1e-107   
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             325   2e-106   
gb|ABR16109.1|  unknown                                                 323   4e-106   Picea sitchensis
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              318   6e-106   
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                324   7e-106   
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  322   1e-105   Citrus sinensis [apfelsine]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              316   3e-103   
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                307   7e-100   
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     298   4e-97    
gb|AEA48973.1|  glyoxylate aminotransferase                             290   1e-95    Rosa roxburghii [chestnut rose]
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                295   3e-95    
ref|XP_001763095.1|  predicted protein                                  295   3e-94    
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946              270   5e-88    
gb|ABR26184.1|  serine-glyoxylate aminotransferase                      258   1e-83    Oryza sativa Indica Group [Indian rice]
gb|ABS86859.1|  alanine glyoxylate aminotransferase                     256   7e-83    Phaseolus vulgaris [French bean]
gb|ABS86860.1|  alanine glyoxylate aminotransferase                     254   6e-82    Phaseolus vulgaris [French bean]
gb|AGN53916.1|  glyoxylate aminotransferase                             244   4e-78    Silene latifolia
gb|AGN53900.1|  glyoxylate aminotransferase                             243   9e-78    Silene latifolia
gb|AGN53915.1|  glyoxylate aminotransferase                             243   1e-77    Silene latifolia
gb|AGN53917.1|  glyoxylate aminotransferase                             243   1e-77    Silene latifolia
gb|AGN53906.1|  glyoxylate aminotransferase                             243   1e-77    Silene latifolia
gb|AGN53895.1|  glyoxylate aminotransferase                             241   4e-77    Silene latifolia
gb|AGN53914.1|  glyoxylate aminotransferase                             241   5e-77    Silene latifolia
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     249   6e-77    Methyloceanibacter caenitepidi
gb|AGN53923.1|  glyoxylate aminotransferase                             241   8e-77    Silene latifolia
gb|AGN53897.1|  glyoxylate aminotransferase                             240   1e-76    Silene latifolia
gb|AGN54050.1|  glyoxylate aminotransferase                             240   1e-76    Silene vulgaris [maiden's-tears]
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                249   1e-76    
gb|AGN53921.1|  glyoxylate aminotransferase                             239   2e-76    Silene latifolia
gb|AGN54049.1|  glyoxylate aminotransferase                             239   3e-76    Silene vulgaris [maiden's-tears]
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                246   1e-75    Methylocapsa aurea
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    245   4e-75    Methylobacterium aquaticum
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    243   2e-74    Methylocystaceae
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                242   6e-74    Methylosinus sp. LW4
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                242   6e-74    Methylosinus
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                240   2e-73    Methylocaldum szegediense
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 239   3e-73    Auxenochlorella protothecoides
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                240   5e-73    Methylocapsa acidiphila
ref|XP_005709273.1|  serine--glyoxylate transaminase                    239   6e-73    Galdieria sulphuraria
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                239   1e-72    Methylocella silvestris
gb|AEW08188.1|  hypothetical protein 2_2585_01                          230   1e-72    Pinus lambertiana
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                238   1e-72    Methylosinus
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                238   5e-72    Paraburkholderia sacchari
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              237   1e-71    Volvox carteri f. nagariensis
gb|AFG57258.1|  hypothetical protein 2_2585_01                          227   2e-71    Pinus taeda
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      235   2e-71    Hyphomicrobium nitrativorans NL23
gb|AEW08187.1|  hypothetical protein 2_2585_01                          226   2e-71    Pinus radiata
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                235   2e-71    Hyphomicrobium nitrativorans
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                234   8e-71    Methylobacterium nodulans
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                234   1e-70    Paraburkholderia phymatum
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     233   1e-70    Methylorubrum extorquens DM4
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                233   2e-70    Methylobacteriaceae
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                233   3e-70    Methylorubrum extorquens
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                233   3e-70    Methylobacterium sp. MB200
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                232   4e-70    Methylorubrum populi
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                232   5e-70    Methylocystis parvus
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                232   5e-70    Methylobacteriaceae
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                232   5e-70    Methylobacterium sp. WSM2598
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                232   6e-70    Paraburkholderia terrae
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                232   6e-70    Methylobacterium sp. 4-46
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                232   6e-70    Caballeronia glathei
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                231   1e-69    Methyloversatilis universalis
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                231   1e-69    Burkholderia sp. UYPR1.413
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                231   2e-69    Paraburkholderia hospita
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    221   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                231   2e-69    Paraburkholderia caribensis
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                231   2e-69    Paraburkholderia mimosarum
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                231   2e-69    Burkholderiaceae
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                230   2e-69    Methylocystis sp. ATCC 49242
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                230   3e-69    Dongia sp. URHE0060
gb|KIZ03753.1|  serine--glyoxylate transaminase                         229   8e-69    Monoraphidium neglectum
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    228   1e-68    Methylobacterium
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                228   1e-68    Granulibacter bethesdensis
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                228   1e-68    Granulibacter bethesdensis
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    228   2e-68    Methylibium
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                228   2e-68    Ferrovum
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                228   2e-68    
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      228   2e-68    Methylibium petroleiphilum PM1
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                227   3e-68    Hyphomicrobium zavarzinii
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                227   3e-68    Methyloversatilis universalis
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        228   4e-68    Granulibacter bethesdensis CGDNIH4
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                227   4e-68    Methylobacterium
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     228   4e-68    Granulibacter bethesdensis
ref|WP_010687105.1|  Aminotransferase class V                           227   4e-68    Methylobacterium mesophilicum
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                226   7e-68    Granulibacter bethesdensis
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                226   8e-68    Methylohalobius crimeensis
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                227   8e-68    Paraburkholderia oxyphila
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                226   1e-67    Methyloversatilis discipulorum
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                226   1e-67    Methylobacterium sp. 88A
emb|CAM59875.2|  alanine:glyoxylate aminotransferase                    216   2e-67    Prunus avium [gean]
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        226   2e-67    Granulibacter bethesdensis
gb|AID30749.1|  serine--glyoxylate aminotransferase                     221   2e-67    Mesorhizobium huakuii 7653R
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                225   2e-67    Methyloversatilis discipulorum
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                225   2e-67    Ensifer sojae
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                225   2e-67    Rhizobium leucaenae
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    225   2e-67    Hyphomicrobium methylovorum
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                224   3e-67    Sinorhizobium fredii
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                225   3e-67    Lutibaculum baratangense
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                224   3e-67    Sinorhizobium fredii
ref|WP_037447404.1|  serine--glyoxylate aminotransferase                220   4e-67    Sinorhizobium fredii
ref|WP_037437034.1|  serine--glyoxylate aminotransferase                220   4e-67    
ref|WP_037429341.1|  serine--glyoxylate aminotransferase                220   5e-67    Sinorhizobium fredii
ref|WP_037460312.1|  serine--glyoxylate aminotransferase                219   6e-67    Sinorhizobium fredii
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                224   6e-67    
ref|WP_037399704.1|  serine--glyoxylate aminotransferase                220   6e-67    
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                224   8e-67    
emb|CAM59874.1|  alanine:glyoxylate aminotransferase                    214   1e-66    
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                223   1e-66    
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                223   1e-66    
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                223   1e-66    
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                223   1e-66    
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 224   2e-66    
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                223   2e-66    
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                222   2e-66    
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                222   3e-66    
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                222   3e-66    
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                221   4e-66    
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                221   4e-66    
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                222   5e-66    
emb|CAM59878.2|  alanine:glyoxylate aminotransferase                    212   5e-66    
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                221   6e-66    
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                221   6e-66    
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                221   6e-66    
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                221   6e-66    
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    221   6e-66    
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                221   6e-66    
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                221   8e-66    
emb|CAM59876.2|  alanine:glyoxylate aminotransferase                    212   9e-66    
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                221   1e-65    
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                220   1e-65    
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    220   1e-65    
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                220   1e-65    
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    220   2e-65    
gb|AIQ91949.1|  Aminotransferase class V                                221   2e-65    
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                219   2e-65    
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                219   2e-65    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                219   2e-65    
ref|WP_020188076.1|  hypothetical protein                               219   3e-65    
ref|WP_020592928.1|  hypothetical protein                               219   3e-65    
emb|CAM59877.2|  alanine:glyoxylate aminotransferase                    210   3e-65    
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    219   3e-65    
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                219   3e-65    
emb|CAM59872.1|  alanine:glyoxylate aminotransferase                    210   4e-65    
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                219   4e-65    
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                219   5e-65    
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                219   5e-65    
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                219   5e-65    
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                219   5e-65    
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                219   6e-65    
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                218   6e-65    
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                218   9e-65    
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                218   1e-64    
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                218   1e-64    
emb|CAM84338.1|  alanine:glyoxylate aminotransferase                    209   1e-64    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                218   1e-64    
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                217   2e-64    
emb|CAM59873.1|  alanine:glyoxylate aminotransferase                    208   2e-64    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                217   2e-64    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                217   2e-64    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                217   3e-64    
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                217   3e-64    
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                216   3e-64    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                216   4e-64    
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                216   5e-64    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                216   5e-64    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                216   6e-64    
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                216   6e-64    
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                216   7e-64    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                216   7e-64    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                215   8e-64    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                216   8e-64    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                216   9e-64    
emb|CAM59868.2|  alanine:glyoxylate aminotransferase                    206   1e-63    
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    215   1e-63    
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                215   1e-63    
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                215   2e-63    
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            215   2e-63    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                215   2e-63    
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                214   2e-63    
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 216   3e-63    
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 215   3e-63    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                214   3e-63    
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                214   4e-63    
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                214   4e-63    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                214   4e-63    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                214   5e-63    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                214   5e-63    
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                213   7e-63    
emb|CAM59869.2|  alanine:glyoxylate aminotransferase                    204   8e-63    
emb|CAM59871.2|  alanine:glyoxylate aminotransferase                    204   8e-63    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    213   1e-62    
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                213   1e-62    
gb|AGL09526.1|  alanine-glyoxylate aminotransferase                     209   1e-62    
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    213   1e-62    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                213   1e-62    
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     209   1e-62    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    213   1e-62    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    213   1e-62    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    213   1e-62    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                213   1e-62    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    212   2e-62    
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    212   2e-62    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                212   2e-62    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 212   2e-62    
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                212   3e-62    
emb|CAM59870.2|  alanine:glyoxylate aminotransferase                    202   3e-62    
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                211   3e-62    
gb|AGL09523.1|  alanine-glyoxylate aminotransferase                     208   3e-62    
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                211   3e-62    
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                211   3e-62    
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                211   4e-62    
gb|AGL09525.1|  alanine-glyoxylate aminotransferase                     207   4e-62    
ref|WP_020058450.1|  hypothetical protein                               211   4e-62    
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                211   4e-62    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                211   5e-62    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    211   5e-62    
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                211   6e-62    
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                210   7e-62    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                211   7e-62    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    211   7e-62    
gb|EBA13502.1|  Serine--glyoxylate transaminase                         211   8e-62    
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                210   9e-62    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                210   9e-62    
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                210   1e-61    
ref|WP_039187206.1|  serine--glyoxylate aminotransferase                210   1e-61    
gb|AGL09524.1|  alanine-glyoxylate aminotransferase                     207   1e-61    
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...    210   1e-61    
ref|WP_039194170.1|  serine--glyoxylate aminotransferase                210   2e-61    
ref|WP_019294507.1|  MULTISPECIES: septum site-determining protein      209   2e-61    
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    209   2e-61    
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                209   2e-61    
ref|WP_027260136.1|  serine--glyoxylate aminotransferase                209   3e-61    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                209   3e-61    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                208   4e-61    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                208   4e-61    
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    209   4e-61    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                209   4e-61    
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              210   5e-61    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                208   5e-61    
gb|EEE42985.1|  aminotransferase, class V superfamily                   208   5e-61    
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                208   6e-61    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                208   6e-61    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                208   7e-61    
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                208   7e-61    
gb|AGL09528.1|  alanine-glyoxylate aminotransferase                     204   9e-61    
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_024092553.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                207   1e-60    
ref|WP_007817284.1|  serine--glyoxylate aminotransferase                207   2e-60    
ref|WP_009178240.1|  serine--glyoxylate aminotransferase                207   2e-60    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             209   2e-60    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                206   3e-60    
ref|WP_015498822.1|  serine--glyoxylate aminotransferase                206   3e-60    
ref|WP_027233841.1|  serine--glyoxylate aminotransferase                206   3e-60    
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                206   4e-60    
ref|WP_015494023.1|  serine--glyoxylate aminotransferase                206   5e-60    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                206   6e-60    
ref|WP_020180326.1|  serine--glyoxylate aminotransferase                206   6e-60    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                205   6e-60    
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                206   7e-60    
ref|WP_009812827.1|  serine--glyoxylate aminotransferase                205   7e-60    
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...    205   9e-60    
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_029357831.1|  serine--glyoxylate aminotransferase                205   1e-59    
ref|WP_003594239.1|  serine--glyoxylate aminotransferase                204   1e-59    
gb|KJF70525.1|  serine--glyoxylate aminotransferase                     204   1e-59    
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                204   1e-59    
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                204   1e-59    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_008209359.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_006311601.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                204   2e-59    
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    204   2e-59    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    204   3e-59    
ref|WP_039135088.1|  serine--glyoxylate aminotransferase                203   4e-59    
ref|WP_009827863.1|  serine--glyoxylate aminotransferase                203   5e-59    
ref|WP_020919828.1|  serine--glyoxylate aminotransferase                203   5e-59    
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                203   5e-59    
ref|WP_037279938.1|  serine--glyoxylate aminotransferase                203   6e-59    
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                203   6e-59    
gb|KIX16576.1|  serine--glyoxylate aminotransferase                     202   9e-59    
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                202   9e-59    
ref|WP_042251598.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_037263007.1|  serine--glyoxylate aminotransferase                202   1e-58    
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                202   2e-58    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                202   2e-58    
ref|WP_010686651.1|  serine--glyoxylate transaminase                    201   2e-58    
ref|WP_023665384.1|  serine--glyoxylate aminotransferase                201   2e-58    
ref|WP_007427777.1|  serine--glyoxylate aminotransferase                201   3e-58    
ref|WP_020950386.1|  serine-glyoxylate transaminase                     201   3e-58    
ref|WP_039523955.1|  serine--glyoxylate aminotransferase                201   4e-58    
ref|WP_011540013.1|  serine--glyoxylate aminotransferase                201   4e-58    



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   417 bits (1073),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/225 (93%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKDIGYPVKLGSGV AA+AYLQNTTPMIPSRI
Sbjct  357  LQLLGCLSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPSRI  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   417 bits (1071),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/225 (93%), Positives = 220/225 (98%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  178  VSSICAVDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWAD  237

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RHTRLGTATRLAV+AWGLKN
Sbjct  238  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIKRHTRLGTATRLAVEAWGLKN  297

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVPSYIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  298  CTQKEEWFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  357

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  358  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   416 bits (1070),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 222/225 (99%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGIDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDN+IARHTRLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNIIARHTRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAVV+PSYIDS+EIV++AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPLIPSRI  401



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   413 bits (1062),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/225 (92%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTA SVRVFFDW D
Sbjct  135  VSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTATSVRVFFDWND  194

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+G+YWPYTPSIQLLYGLRA LDLLFEEGLDNVIARHTRL  ATRLAV AWGLKN
Sbjct  195  YLKFYKLGSYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHTRLAKATRLAVDAWGLKN  254

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  255  CTQKEEWFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  314

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYPV LGSGVAAASA+LQNTTP+IPSRI
Sbjct  315  LQLLGCLAGVEMVLKDVGYPVTLGSGVAAASAFLQNTTPLIPSRI  359



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/225 (93%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   412 bits (1058),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW D
Sbjct  118  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWND  177

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKN
Sbjct  178  YLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKN  237

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  238  CTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  297

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  298  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  342



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   414 bits (1063),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 208/225 (92%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNTPLIPSRI  401



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   414 bits (1063),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 207/225 (92%), Positives = 220/225 (98%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   414 bits (1063),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 220/225 (98%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   413 bits (1062),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNE
Sbjct  297  CTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   409 bits (1052),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW D
Sbjct  82   VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWND  141

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKN
Sbjct  142  YLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKN  201

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  202  CTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNE  261

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  262  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  306



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/225 (93%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGSLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNE
Sbjct  297  CTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLVFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNE
Sbjct  297  CTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   412 bits (1058),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/225 (92%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   412 bits (1058),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPS+QLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSVQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSR+
Sbjct  357  LQLLGCLAGVEMVLRDLGYPVKLGSGVAAASAYLQNNTPLIPSRV  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   412 bits (1058),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/225 (92%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   411 bits (1057),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/225 (92%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCAS KALEA+KTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASQKALEATKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   411 bits (1056),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNE
Sbjct  297  CTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   410 bits (1055),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 207/225 (92%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVL+D+GY VKLGSGVAAASAYLQN TP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLRDVGYXVKLGSGVAAASAYLQNNTPLIPSRI  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   410 bits (1055),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF IGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFSIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   410 bits (1054),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   410 bits (1054),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGL N
Sbjct  237  YLKFYKMGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLNN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   410 bits (1053),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKAL ASKT+KSV+VFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALVASKTSKSVKVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   404 bits (1037),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 215/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKD
Sbjct  20   VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKD  79

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  80   YLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKN  139

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  140  CTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  199

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  200  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  244



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   409 bits (1051),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPS+QLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVITRHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQNT PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI  401



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   409 bits (1050),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKD
Sbjct  178  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWKD  237

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKN
Sbjct  238  YLKFYKMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKN  297

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  298  CTQKEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  357

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQL+G L+GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  358  LQLMGALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   409 bits (1050),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK AKS+RVFFDW D
Sbjct  178  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKMAKSLRVFFDWND  237

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  238  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKN  297

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQK+EWFSDTVTAVVVP YIDS+++V+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  298  CTQKDEWFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  357

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEM+LKD+GYPVKLGSGVAAA+AYLQNTTPMIPSRI
Sbjct  358  LQLLGCLSGVEMILKDVGYPVKLGSGVAAAAAYLQNTTPMIPSRI  402



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   405 bits (1040),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 215/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKD
Sbjct  87   VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKD  146

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  147  YLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKN  206

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  207  CTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  266

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  267  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  311



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   408 bits (1049),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWSD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVQAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAVVVP +IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+L+D+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILRDVGYPVKLGSGVAAACAYLQNNVPLIPSRI  401



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   408 bits (1049),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWG+DVALTGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGIDVALTGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YL+FYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLRFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVV+P+ IDSSEIV+RAW RYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEM+LKD+GYPVKLGSGVAAASAYLQN+ PMI SRI
Sbjct  357  LQLLGCLSGVEMILKDVGYPVKLGSGVAAASAYLQNSIPMIASRI  401



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   408 bits (1049),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 205/225 (91%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS +VFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSYKVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY+MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RL T TRLAV+AWGLKN
Sbjct  237  YLKFYQMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLATGTRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YI+SSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYP+KLGSGV AASAY QNTTP+I SRI
Sbjct  357  LQLLGCLAGVEMVLKDVGYPIKLGSGVGAASAYFQNTTPLIASRI  401



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   408 bits (1048),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 201/225 (89%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWG+DVALTGSQKALS+PTG+G +CASPKALEASKTA+S RVFFDW D
Sbjct  177  VSSICALDFRMDEWGIDVALTGSQKALSMPTGMGFICASPKALEASKTAQSARVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQ+LYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKIGTYWPYTPSIQMLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+ YLQN+TPMIPSRI
Sbjct  357  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAATYLQNSTPMIPSRI  401



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   408 bits (1048),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKSAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   408 bits (1048),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCAS KAL A+KTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASAKALRATKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGQATRLAVQAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAVVVPS IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPYIPSRI  401



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   407 bits (1047),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 210/225 (93%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CT+KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  357  LQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   407 bits (1047),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASK AKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIICASPKALEASKMAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEM+LKD+G PVKLGSGVAAA+AYLQNT PMIPSRI
Sbjct  357  LQLLGCLSGVEMILKDLGCPVKLGSGVAAAAAYLQNTIPMIPSRI  401



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   407 bits (1046),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTA+SVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTARSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP  IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+L+D+GYPVKLGSGVAAASA+LQN TP+IPSRI
Sbjct  357  LQLLGCLAGVEMLLRDVGYPVKLGSGVAAASAFLQNNTPLIPSRI  401



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   407 bits (1046),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKD
Sbjct  177  VSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            Y+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKN
Sbjct  237  YIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   405 bits (1041),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 216/221 (98%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWG DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGXDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   407 bits (1045),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   406 bits (1044),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKD
Sbjct  177  VSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            Y+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKN
Sbjct  237  YIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   406 bits (1044),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 210/225 (93%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  357  LQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   406 bits (1044),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   406 bits (1044),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   406 bits (1043),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLD+VIARH R+G ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDSVIARHNRMGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   406 bits (1043),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLR  LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   400 bits (1028),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKD
Sbjct  38   VSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKD  97

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL N
Sbjct  98   YLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSN  157

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  158  CCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  217

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  218  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  262



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   404 bits (1038),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   405 bits (1041),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/225 (89%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKD
Sbjct  177  VSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            Y+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKN
Sbjct  237  YIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP +I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   405 bits (1040),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 200/225 (89%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKA+EA+KTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKAMEAAKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEWFSDTVTAVVVPSYI+S+++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQREEWFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVL+D+GYPVKLGSGVAAA+AYL+N+TPMI SRI
Sbjct  357  LQLLGCLSGVEMVLRDVGYPVKLGSGVAAAAAYLRNSTPMITSRI  401



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   403 bits (1036),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   403 bits (1036),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   403 bits (1036),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/221 (91%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 215/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  401



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   404 bits (1039),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            V SICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKD
Sbjct  177  VPSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   402 bits (1034),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   402 bits (1032),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  122  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  181

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  182  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  241

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  242  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  301

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  302  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  342



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   404 bits (1038),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW D
Sbjct  177  VSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  357  LQLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   404 bits (1037),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW D
Sbjct  177  VSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  357  LQLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   404 bits (1037),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 201/225 (89%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMD+WGVDVALTGSQK LSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDDWGVDVALTGSQKVLSLPTGIGIVCASPRALEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAVVVP Y+DS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   402 bits (1033),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   402 bits (1033),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   402 bits (1032),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  133  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  192

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  193  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  252

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  253  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  312

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  313  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  353



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   402 bits (1032),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  131  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  190

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  191  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  250

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  251  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  310

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  311  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  351



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   402 bits (1032),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  130  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  189

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  190  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  249

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  250  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  309

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  310  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  350



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   403 bits (1036),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGLREALDLLFLEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRI  401



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   402 bits (1032),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   402 bits (1032),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   401 bits (1031),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 201/221 (91%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGRATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   403 bits (1035),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 201/225 (89%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMD+WGV VALTGSQKALSLPTG+GIVCASP+ALEASKTAKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDDWGVGVALTGSQKALSLPTGVGIVCASPRALEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   401 bits (1031),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   402 bits (1034),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/225 (89%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMD+WGVDVALTGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDDWGVDVALTGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAV+VP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+Y QN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYFQNNIPLIPSRI  401



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   402 bits (1034),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/225 (89%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   402 bits (1034),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GI+CASPKALEA+K+AKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGIDVALTGSQKALSLPTGLGILCASPKALEATKSAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLVFEEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ EEW SDTVTA++VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQSEEWVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVE+VL+D+GYPVKLGSGVAAASAY QN+TP+I SRI
Sbjct  357  LQLLGCLAGVELVLRDVGYPVKLGSGVAAASAYFQNSTPLISSRI  401



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   400 bits (1029),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQEEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   402 bits (1033),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/225 (89%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFR DEWGVDVALTGSQKALSLPTG+GI+ ASPKALEA+KTAKSVRVFFDW D
Sbjct  177  VSSICALDFRQDEWGVDVALTGSQKALSLPTGMGIISASPKALEATKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP +IDS+E+VKRAW+RYN+SLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  297  CTQKEEWFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLNKVAGKVFRIGHLGNINE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLG LAGVEM+LKD+GYPVKLGSGVAAA+AYLQN+TPMI SRI
Sbjct  357  LQLLGALAGVEMILKDVGYPVKLGSGVAAAAAYLQNSTPMITSRI  401



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   401 bits (1030),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW D
Sbjct  150  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWND  209

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKN
Sbjct  210  YLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKN  269

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN+
Sbjct  270  CTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLND  329

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            +QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  330  VQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  374



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   402 bits (1032),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLK YK+GTYWPYTPSI LLYGLRA LDL+FEEGL+NV ARH RL  ATRLA++AWGLKN
Sbjct  237  YLKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP  IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVLKD+GYPVKLGSGV AA AYLQNTTP+IPSRI
Sbjct  357  LQLLGCLAGVEMVLKDVGYPVKLGSGVGAACAYLQNTTPLIPSRI  401



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   402 bits (1032),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY++GTYWPYTPSI LLYGLRA L+L+FEEGL+NVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYQLGTYWPYTPSIHLLYGLRAALNLIFEEGLENVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   395 bits (1016),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/222 (89%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  740  ICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLK  561
            ICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLK
Sbjct  17   ICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLK  76

Query  560  FYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQ  381
            FYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ
Sbjct  77   FYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQ  136

Query  380  KEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  201
            +EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL
Sbjct  137  EEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  196

Query  200  LGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  197  LGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  238



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   400 bits (1028),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 215/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRATLDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYI+S+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   402 bits (1032),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   401 bits (1031),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/225 (89%), Positives = 215/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  357  LQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   400 bits (1027),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 213/221 (96%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   399 bits (1026),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 200/219 (91%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   401 bits (1030),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN+
Sbjct  297  CTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLND  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            +QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  357  VQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   398 bits (1022),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 196/225 (87%), Positives = 213/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKD
Sbjct  104  VSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKD  163

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL N
Sbjct  164  YLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSN  223

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  224  CCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  283

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  284  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  328



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   400 bits (1029),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  178  VSSICALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWND  237

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKN
Sbjct  238  YLKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKN  297

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  298  CTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  357

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  358  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   400 bits (1029),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 215/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKA SLPTGIGIV ASPKA+EASK+AKS+RVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKAXSLPTGIGIVVASPKAIEASKSAKSLRVFFDWSD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ EEW+SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQSEEWYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYP+K GSGVAAASAYLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPIKYGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   399 bits (1024),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  131  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  190

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  191  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  250

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  251  CTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  310

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   399 bits (1025),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   402 bits (1034),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 208/225 (92%), Positives = 219/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASP+ALEASKTAKSVRVFFDWKD
Sbjct  237  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPRALEASKTAKSVRVFFDWKD  296

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRAGLDL+FEEGLDNVI RHTRLGTATR+AV+AWGLKN
Sbjct  297  YLKFYKMGTYWPYTPSIQLLYGLRAGLDLIFEEGLDNVIKRHTRLGTATRMAVEAWGLKN  356

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  357  CTQKEENFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  416

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N TP+IPSRI
Sbjct  417  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNATPLIPSRI  461



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            +LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  HLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 215/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCA PKALEASK A+SVR FFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCAGPKALEASKXAQSVRFFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN+
Sbjct  297  CTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLND  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            +QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  357  VQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/225 (89%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICAIDFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEA+K+AKSVRVFFDW D
Sbjct  177  VSSICAIDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPKALEAAKSAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYG RA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGFRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP +I+SS++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLN+
Sbjct  297  CTQKEEWFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLND  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVL+D+GY VKLGSGVAAA+AYLQNT PMI SRI
Sbjct  357  LQLLGCLSGVEMVLRDVGYQVKLGSGVAAAAAYLQNTIPMISSRI  401



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 215/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEWFSDTVTAVVVP YID +EIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  357  LQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL GVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  357  LQLLGCLTGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   400 bits (1027),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/225 (91%), Positives = 218/225 (97%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLGTATRLAV+AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIRRHSRLGTATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDSSEIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  297  CTQKEEWFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNVNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVL+D+GYP KLGSGVAAA+AYL N TP+IPSRI
Sbjct  357  LQLLGCLSGVEMVLRDVGYPAKLGSGVAAAAAYLLNNTPLIPSRI  401



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   398 bits (1022),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  131  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  190

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+A GLKN
Sbjct  191  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEARGLKN  250

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  251  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  310

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  311  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   399 bits (1026),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 217/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   400 bits (1029),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 203/225 (90%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  213  VSSICALDFRMDEWGVDVALTGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWND  272

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKN
Sbjct  273  YLKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKN  332

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  333  CTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  392

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  393  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  437



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   397 bits (1021),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 214/221 (97%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  NLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   397 bits (1021),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   399 bits (1025),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 196/225 (87%), Positives = 213/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKD
Sbjct  179  VSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKD  238

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL N
Sbjct  239  YLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSN  298

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  299  CCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  358

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  359  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  403



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   399 bits (1024),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKN
Sbjct  237  YLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNE
Sbjct  297  CTQKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  357  LQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   397 bits (1019),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 198/217 (91%), Positives = 211/217 (97%), Gaps = 0/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   398 bits (1023),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 200/225 (89%), Positives = 213/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 216/225 (96%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKN
Sbjct  237  YLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CT+KEEW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNE
Sbjct  297  CTEKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  357  LQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/217 (92%), Positives = 210/217 (97%), Gaps = 0/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 198/217 (91%), Positives = 211/217 (97%), Gaps = 0/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYLQNT
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLQNT  358



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 213/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCAS KALEASK A+SVRVFFDWKD
Sbjct  178  VSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASSKALEASKAARSVRVFFDWKD  237

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YL+FY+MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATR AV+AWGLKN
Sbjct  238  YLRFYEMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVKRHNRLGTATRFAVEAWGLKN  297

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C QKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  298  CCQKEECFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  357

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  358  LQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 213/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   389 bits (1000),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  719  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  540
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTF  60

Query  539  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  360
            WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEEW+SD
Sbjct  61   WPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEEWYSD  120

Query  359  TVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  180
            TVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV
Sbjct  121  TVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  180

Query  179  EMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            EM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  181  EMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  215



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   397 bits (1021),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  214  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  273

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  274  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  333

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  334  CTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  393

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  394  LQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  438



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   394 bits (1013),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 198/217 (91%), Positives = 211/217 (97%), Gaps = 0/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGEATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   394 bits (1013),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 198/217 (91%), Positives = 211/217 (97%), Gaps = 0/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   395 bits (1016),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 199/225 (88%), Positives = 212/225 (94%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R G ATRLAV+AWGLKN
Sbjct  237  YLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARPGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  357  LQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   393 bits (1010),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/217 (91%), Positives = 211/217 (97%), Gaps = 0/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   392 bits (1006),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 197/218 (90%), Positives = 209/218 (96%), Gaps = 0/218 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTT  96
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTT
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTT  359



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   391 bits (1004),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  105
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQ
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQ  356



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   392 bits (1008),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/225 (87%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   390 bits (1001),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 0/215 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  105
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQ
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQ  356



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   391 bits (1005),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/225 (85%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NE
Sbjct  297  CTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQNHIPLIPSRI  401



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   389 bits (1000),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 196/217 (90%), Positives = 208/217 (96%), Gaps = 0/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   391 bits (1004),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 191/225 (85%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NE
Sbjct  297  CTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLIPSRI  401



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   390 bits (1002),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/225 (85%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  297  CTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   389 bits (998),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 196/216 (91%), Positives = 209/216 (97%), Gaps = 0/216 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKD
Sbjct  170  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKD  229

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGLKN
Sbjct  230  YLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRPAVEAWGLKN  289

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  290  CTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  349

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  102
            LQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS  L N
Sbjct  350  LQLLGCLAGVEMILKDVGYPVKLGSGVAAASESLVN  385



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   388 bits (997),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 192/225 (85%), Positives = 214/225 (95%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IAR+ RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARNARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAV+VP +ID SEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  297  CTQKEEWISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   385 bits (989),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 190/225 (84%), Positives = 212/225 (94%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAV+VP  ID SE+V+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  297  CTQKEEWISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+I SRI
Sbjct  357  LQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLILSRI  401



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/210 (91%), Positives = 203/210 (97%), Gaps = 0/210 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  120
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  351



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   377 bits (968),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVA  126
            LQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   375 bits (964),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  130  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  189

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  190  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  249

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  250  CTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  309

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAA  123
            LQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  310  LQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   379 bits (974),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NE
Sbjct  297  CTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            LQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P
Sbjct  357  LQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIP  395



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   375 bits (964),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAA  123
            LQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVAA  350



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   374 bits (961),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/210 (90%), Positives = 201/210 (96%), Gaps = 0/210 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  121  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  180

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  181  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKN  240

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKV GKVFRIGHLGN+NE
Sbjct  241  CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVXGKVFRIGHLGNVNE  300

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  120
            LQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  301  LQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  330



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   374 bits (961),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  130  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  189

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  190  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKN  249

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  250  CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  309

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAA  123
            LQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  310  LQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   374 bits (959),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  122  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  181

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  182  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  241

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  242  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  301

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSG  132
            LQLLGCL+GVEMVLKD+GYPVK GSG
Sbjct  302  LQLLGCLSGVEMVLKDVGYPVKFGSG  327



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   373 bits (957),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  121  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  180

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  181  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKN  240

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  241  CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  300

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVA  126
            LQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  301  LQLLGCLSGVEMVLKDVGYPVKFGSGVA  328



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   372 bits (956),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKA SLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  122  VSSICALDFRMDEWGVDVALTGSQKAPSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  181

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  182  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  241

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  242  CTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  301

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAA  123
            LQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  302  LQLLGCLSGVEMVLKDVGYPVKFGSGVAA  330



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   373 bits (957),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVA  126
            LQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   372 bits (955),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  125  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  184

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  185  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKN  244

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  245  CTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  304

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVA  126
            LQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  305  LQLLGCLSGVEMVLKDVGYPVKFGSGVA  332



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   371 bits (952),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVKLG  138
            LQLLGCL+GVEMVLKD+GYPVK G
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVKFG  345



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   370 bits (949),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  131  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  190

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  191  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  250

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  251  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  310

Query  209  LQLLGCLAGVEMVLKDIGYPVKLG  138
            LQLLGCL+GVEMVLKD+GYPVK G
Sbjct  311  LQLLGCLSGVEMVLKDVGYPVKFG  334



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   368 bits (944),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPVK  144
            LQLLGCL+GVEMVLKD+GYPVK
Sbjct  322  LQLLGCLSGVEMVLKDVGYPVK  343



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   366 bits (940),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPV  147
            LQLLGCL+GVEMVLKD+GYPV
Sbjct  322  LQLLGCLSGVEMVLKDVGYPV  342



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   366 bits (940),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 196/201 (98%), Gaps = 0/201 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVLKDIGYPV  147
            LQLLGCL+GVEMVLKD+GYPV
Sbjct  322  LQLLGCLSGVEMVLKDVGYPV  342



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   360 bits (923),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI A+DFRMDEWG+DVA+T SQKALSLPTG+GIVCASPKA+EASK A S+R +FDW  
Sbjct  177  VSSIGALDFRMDEWGIDVAVTSSQKALSLPTGMGIVCASPKAIEASKHATSLRSYFDWNG  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI+RH RL  ATRLAV+AWGLKN
Sbjct  237  YLKCYNLGTYWPYTPSIQLLYGLRATLDLIFEEGLENVISRHKRLAKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C Q +E +SD+VTAVVVP+ IDS EIV RAWK+YNLSLG+GLNKVAGKVFRIGHLGN+NE
Sbjct  297  CCQNKESYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLNKVAGKVFRIGHLGNINE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEMVL+D+GYP+K GSGVAAASAYL NT P+IPSRI
Sbjct  357  LQLLGCLAGVEMVLRDVGYPIKFGSGVAAASAYLHNTIPLIPSRI  401



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/195 (92%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  118  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  177

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  178  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  237

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  238  CTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  297

Query  209  LQLLGCLAGVEMVLK  165
            LQLLGCL+GVEMVLK
Sbjct  298  LQLLGCLSGVEMVLK  312



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   355 bits (911),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 189/194 (97%), Gaps = 0/194 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW SDTVTAVV+PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEEWSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVL  168
            LQLLGCL+GVEMVL
Sbjct  322  LQLLGCLSGVEMVL  335



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+EA+K+A SVR FFDW  
Sbjct  177  VSSIGALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIEATKSATSVRSFFDWNG  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKN
Sbjct  237  YLKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRHKRLAKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C QKEEW+S +VTA+VVP  IDS EIV RAWKRYNLSLG GLNKVAGKVFRIGH+G+LNE
Sbjct  297  CCQKEEWYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGHLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM LKD+GYPVKLGSGVAAASAYL N  P+IPSRI
Sbjct  357  LQLLGCLAGVEMTLKDVGYPVKLGSGVAAASAYLLNNVPLIPSRI  401



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   351 bits (901),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 189/194 (97%), Gaps = 0/194 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  130  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  189

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  190  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  249

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  250  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  309

Query  209  LQLLGCLAGVEMVL  168
            LQLLGCL+GVEMVL
Sbjct  310  LQLLGCLSGVEMVL  323



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   352 bits (902),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 189/194 (97%), Gaps = 0/194 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVL  168
            LQLLGCL+GVEMVL
Sbjct  322  LQLLGCLSGVEMVL  335



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   351 bits (901),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 189/194 (97%), Gaps = 0/194 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVL  168
            LQLLGCL+GVEMVL
Sbjct  322  LQLLGCLSGVEMVL  335



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   350 bits (897),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 188/194 (97%), Gaps = 0/194 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSD VTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVEMVL  168
            LQLLGCL+GVEMVL
Sbjct  322  LQLLGCLSGVEMVL  335



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   351 bits (900),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW D
Sbjct  177  VSSIGAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWAD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK 
Sbjct  237  YLKFYKLGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKL  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CT++ EW SDTVTAVVVP YI+S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NE
Sbjct  297  CTKRPEWNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  357  LQLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   348 bits (894),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGV  180
            LQLLGCL+GV
Sbjct  322  LQLLGCLSGV  331



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   348 bits (892),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/191 (92%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVE  177
            LQLLGCL+GVE
Sbjct  322  LQLLGCLSGVE  332



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   349 bits (896),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI AI+F+MDEWGVDVALTGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW D
Sbjct  177  VSSIGAIEFKMDEWGVDVALTGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWAD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK 
Sbjct  237  YLKFYKVGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKL  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CT++ EW SDTVTAVVVP Y++S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NE
Sbjct  297  CTKRPEWNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  357  LQLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   346 bits (887),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  121  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  180

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  181  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  240

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  241  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  300

Query  209  LQLLGCLAGVE  177
            LQLLGCL+GVE
Sbjct  301  LQLLGCLSGVE  311



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   347 bits (889),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/191 (92%), Positives = 186/191 (97%), Gaps = 0/191 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGVE  177
            LQLLGCL+GVE
Sbjct  322  LQLLGCLSGVE  332



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   346 bits (887),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGV  180
            LQLLGCL+GV
Sbjct  322  LQLLGCLSGV  331



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   345 bits (884),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAG  183
            LQLLGCL+G
Sbjct  322  LQLLGCLSG  330



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   344 bits (883),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLGCLAGV  180
            LQLLGCL+GV
Sbjct  322  LQLLGCLSGV  331



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 178/183 (97%), Gaps = 0/183 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW D
Sbjct  119  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWND  178

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKN
Sbjct  179  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKN  238

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  239  CTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  298

Query  209  LQL  201
            LQL
Sbjct  299  LQL  301



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   332 bits (851),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  
Sbjct  177  VSSIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSA  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ 
Sbjct  237  YLKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLEL  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNE
Sbjct  297  CVKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQL+  LAGVEM LKD+G+PVKLGSGVAAA AYLQ +TP+IPSR+
Sbjct  357  LQLISALAGVEMALKDVGFPVKLGSGVAAAQAYLQESTPLIPSRL  401



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   330 bits (846),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  L  207
            +
Sbjct  357  V  357



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI A+ FRMDEW VDVALTGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  
Sbjct  177  VSSIGALAFRMDEWKVDVALTGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSA  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ 
Sbjct  237  YLKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLEL  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNE
Sbjct  297  CIKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNE  356

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQL+  LAGVEM LKD+G+PVKLGSGV+AA AYLQ +TP+IPSR+
Sbjct  357  LQLISALAGVEMALKDVGFPVKLGSGVSAAQAYLQESTPLIPSRL  401



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKAL A+K +KS RVFFDW D
Sbjct  177  VSSIGAIDFRMDDWKVDVALTGSQKALSLPTGLGIVCASPKALAAAKQSKSTRVFFDWGD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLK  393
            YLKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RLG ATR AV+AWGL 
Sbjct  237  YLKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLGEATRQAVKAWGLT  296

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             CTQ  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+N
Sbjct  297  LCTQDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLNKVAGKVFRIGHLGNVN  356

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            ELQ+LG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  357  ELQMLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLISSRI  402



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   327 bits (838),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D
Sbjct  142  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWND  201

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRL V+AWGLKN
Sbjct  202  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLXVEAWGLKN  261

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CT KEE FSDTVTAV++PSYIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLGN+NE
Sbjct  262  CTPKEECFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLGLGLNKVAGKVFRIGHLGNVNE  321

Query  209  LQLLG  195
            LQLLG
Sbjct  322  LQLLG  326



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI AIDFRMD+W VDVALTGSQKALSLPTG+GIVCASPKALEA+K +KS RVFFDW D
Sbjct  177  VSSIGAIDFRMDDWRVDVALTGSQKALSLPTGLGIVCASPKALEAAKRSKSTRVFFDWGD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLK  393
            YLKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RL  ATR AV+AWGL 
Sbjct  237  YLKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLAEATRQAVRAWGLT  296

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             CT+  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+N
Sbjct  297  LCTKDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGLNKVAGKVFRIGHLGNVN  356

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            ELQLLG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  357  ELQLLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLIVSRI  402



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/184 (89%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKD
Sbjct  177  VSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLL  198
            +  +
Sbjct  357  VTFI  360



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   323 bits (829),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+CAIDFRMDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW D
Sbjct  177  VSSVCAIDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWND  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKN
Sbjct  237  YLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score =   318 bits (815),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKD
Sbjct  38   VSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKD  97

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL N
Sbjct  98   YLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSN  157

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  158  CCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  217

Query  209  L  207
            +
Sbjct  218  V  218



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVA+TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW D
Sbjct  177  VSSICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKN
Sbjct  237  YLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  297  CTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356

Query  209  LQLL  198
            + L+
Sbjct  357  VTLI  360



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 176/183 (96%), Gaps = 0/183 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICAIDFRMDEWG+DVALTGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKD
Sbjct  177  VSSICAIDFRMDEWGIDVALTGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            Y+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKN
Sbjct  237  YIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKN  296

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            CTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE
Sbjct  297  CTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356

Query  209  LQL  201
            +  
Sbjct  357  VMF  359



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSICA+DFRMDEWGVDVALTGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKD
Sbjct  179  VSSICALDFRMDEWGVDVALTGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKD  238

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL N
Sbjct  239  YLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSN  298

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  299  CCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  358

Query  209  L  207
            +
Sbjct  359  V  359



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 164/226 (73%), Positives = 184/226 (81%), Gaps = 15/226 (7%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            V SI A+DFRMDEWGVDV +T SQKALSLPTG+GIVCA PKA+E                
Sbjct  139  VFSIGALDFRMDEWGVDVVVTSSQKALSLPTGMGIVCAGPKAIE--------------NG  184

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLK Y +GTYWPYTPSI LLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKN
Sbjct  185  YLKCYNLGTYWPYTPSIPLLYGLRAALDLIFEEGFENVILRHKRLTKATRLAVEAWGLKN  244

Query  389  CTQKEE-WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
            C Q+EE W+S +VTA++VP  ID+ EIV RAWKRYNLSLG GLNKVAGKVFRIGH+GNLN
Sbjct  245  CCQQEEEWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLN  304

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            ELQLLGCLAGVEM+LK++GY +KLGSGVAAASAYL N  P+IPSRI
Sbjct  305  ELQLLGCLAGVEMILKEVGYLLKLGSGVAAASAYLLNNVPLIPSRI  350



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -2

Query  626  ALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIAR  447
               A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI R
Sbjct  107  GFSAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKR  166

Query  446  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  267
            HTRLGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLG
Sbjct  167  HTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLG  226

Query  266  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LNKVAGKVFRIGHLG+LNELQLLGCL G EMVLKDIGYPVKLGSGVAAA+AYL N+TP+I
Sbjct  227  LNKVAGKVFRIGHLGHLNELQLLGCLGGGEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLI  286

Query  86   PSRI  75
            PSRI
Sbjct  287  PSRI  290



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   290 bits (741),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -2

Query  575  KDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGL  396
            ++YLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGL
Sbjct  2    ENYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRHAVEAWGL  61

Query  395  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  216
            KNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNL
Sbjct  62   KNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNL  121

Query  215  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            NELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN  P+IPSR+
Sbjct  122  NELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNIPLIPSRV  168



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   295 bits (754),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 179/225 (80%), Gaps = 19/225 (8%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI A+DFRMDEWGVDV +T SQKALSL TG+GIVCA PKA+EASK+A S+R FFDW  
Sbjct  138  VSSIGALDFRMDEWGVDVVVTSSQKALSLSTGMGIVCAGPKAIEASKSATSLRSFFDWNG  197

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH       +L V       
Sbjct  198  YLKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRH-------KLVV-------  243

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
                 EW+S +VTA+V P  IDS EIV RAWKR NLSLG GLNKVAGKVFRIGH+G+LNE
Sbjct  244  -----EWYSASVTAIVGPPNIDSGEIVSRAWKRCNLSLGGGLNKVAGKVFRIGHVGHLNE  298

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LQLLGCLAGVEM LKD+GYPV+LGSGVAAASAYL N  P+IPSRI
Sbjct  299  LQLLGCLAGVEMTLKDVGYPVQLGSGVAAASAYLLNNVPIIPSRI  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 186/226 (82%), Gaps = 1/226 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ A+DFRMD+WGVDVALTGSQKALSLPTG+GI+CAS KA+E SK AK  R +FDW +
Sbjct  177  VSSVGAMDFRMDDWGVDVALTGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAE  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLK  393
            YLK YK GTY PYTPS+QLLYGLRA LD++  +EGL+NVIARH RL  ATR AV+AWGL 
Sbjct  237  YLKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLT  296

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +K +W S  VT VVVPS +DS++++K AWK+YNLSLGLGL +V GKVFRIGHLG +N
Sbjct  297  VCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVN  356

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            ELQLLG LAGVE+VL ++GYPV  GSGVAAA A+L   TP+I SR+
Sbjct  357  ELQLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPIIASRL  402



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score =   270 bits (690),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  1    MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  60

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSD VTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  61   WFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  120

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  159



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  530  TPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVT  351
            TPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVT
Sbjct  1    TPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVT  60

Query  350  AVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMV  171
            AVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMV
Sbjct  61   AVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMV  120

Query  170  LKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  152



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   256 bits (655),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = -2

Query  719  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  540
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  539  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  360
            WPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+KEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKEEWHSD  120

Query  359  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  273
            TVTAVVVPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVVVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   254 bits (648),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  719  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  540
            MDEWGVDVA+TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTY
Sbjct  1    MDEWGVDVAITGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTY  60

Query  539  WPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSD  360
            WPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTAT LAV+AWGLKNCTQKEEW SD
Sbjct  61   WPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATGLAVEAWGLKNCTQKEEWHSD  120

Query  359  TVTAVVVPSYIDSSEIVKRAWKRYNLSLG  273
            TVTAV+VPSYIDS+EIV+RAWKRYNLSLG
Sbjct  121  TVTAVIVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|AGN53916.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   244 bits (622),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53900.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53924.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (620),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            VV+P YIDS+EIVKRAWKRYN
Sbjct  121  VVIPPYIDSAEIVKRAWKRYN  141



>gb|AGN53917.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53918.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVI+RH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVISRHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            V+VP YI+SS+IVKRAWKRYN
Sbjct  121  VIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53906.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53920.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            V+VP YI+SS+IVK+AWKRYN
Sbjct  121  VIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53895.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53896.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53901.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53902.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53905.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53913.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53925.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53926.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53927.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53928.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (616),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            VV+P YIDS+EIVK+AWKRYN
Sbjct  121  VVIPPYIDSAEIVKKAWKRYN  141



>gb|AGN53914.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (615),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            VV+P YIDSS+IVK+AWKRYN
Sbjct  121  VVIPPYIDSSDIVKKAWKRYN  141



>dbj|BAQ18801.1| serine-glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=372

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 166/225 (74%), Gaps = 1/225 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI +IDFR DEWGVD+A+TGSQK + LP G+GIVCASPKAL    TA   R +F+  D
Sbjct  146  VSSIGSIDFRFDEWGVDLAITGSQKGMMLPAGLGIVCASPKALARMDTATCTRAYFNLAD  205

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            + K    G Y+PYTP++ LLYGLR  L ++FEEGLDN+ ARH  L + TR AV AWGL  
Sbjct  206  HFK-ANAGGYFPYTPALPLLYGLRESLAMMFEEGLDNIFARHRYLASGTRAAVDAWGLSL  264

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W SDTV+A++VP+  + ++++ RA++RYNL+LG GL++VAGK+FRIGHLG+LNE
Sbjct  265  CAKEPKWQSDTVSAIMVPAGFNGADVIDRAYRRYNLALGAGLSEVAGKLFRIGHLGDLNE  324

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            L LLG ++G EM ++D+G  V+ GSGVAAA  Y +N       R+
Sbjct  325  LMLLGAISGAEMSMRDVGIQVEPGSGVAAAQEYFRNAHGAADQRL  369



>gb|AGN53923.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   241 bits (614),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN53897.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53898.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53899.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53903.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53904.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53907.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53908.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53909.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53910.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53911.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53912.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53919.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53929.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53930.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53931.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53932.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53933.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53934.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54050.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            VV+P YI+SSEIVK AWKRYN
Sbjct  121  VVIPPYINSSEIVKMAWKRYN  141



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMDEWGVD+A+ GSQK   LP G+ IV AS KALEA  TAK  RVFF+++D
Sbjct  180  VSSIGCIDFRMDEWGVDLAVAGSQKGFMLPAGLAIVGASQKALEARHTAKCARVFFNFED  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             +K    G Y+PYTPS+ LLYGLR  + ++FEEG +NV  RH  L +  R AV AWGLKN
Sbjct  240  MIKSNATG-YFPYTPSLPLLYGLRESMKMMFEEGQENVFQRHHYLASGVRAAVSAWGLKN  298

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C  + +WFSDTVTA+VVP   + ++++  A++RYNL+LG GL KVAGKVFRIGHLG+LNE
Sbjct  299  CATEPKWFSDTVTAIVVPEGFNGADVIATAYRRYNLALGAGLAKVAGKVFRIGHLGDLNE  358

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            L +LG LAG EM + DIG  ++ GSGVAAA  Y +++  +I
Sbjct  359  LMVLGALAGAEMSMLDIGIKIEPGSGVAAAQNYFRSSNSVI  399



>gb|AGN53921.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53922.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DY+KFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYMKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            VV+P YIDS+EIVK+AWK+YN
Sbjct  121  VVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54049.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   239 bits (610),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -2

Query  707  GVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYT  528
            GVDVALTGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYT
Sbjct  1    GVDVALTGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYT  60

Query  527  PSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTA  348
            PSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTA
Sbjct  61   PSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTA  120

Query  347  VVVPSYIDSSEIVKRAWKRYN  285
            VV+P YI+S+EIVK AWKRYN
Sbjct  121  VVIPPYINSAEIVKMAWKRYN  141



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI ++DFR DEW VD+A+ GSQK L LP G+GIVCASP+ALEASKTA   RVFFD+ D
Sbjct  172  VSSIGSLDFRTDEWRVDLAIAGSQKGLMLPAGLGIVCASPRALEASKTAGLKRVFFDFND  231

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             +K    G Y+PYTP++ +LYGLR  L +LFEE L++V  RH  L    R AV+AWGLK 
Sbjct  232  MIKANATG-YFPYTPALPMLYGLRESLKILFEEKLEHVFERHHVLAGGVRAAVKAWGLKP  290

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C  + +W+SDTVTA+VVP  I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+
Sbjct  291  CATEPKWYSDTVTAIVVPPGINGADVIDAAYRRYNLSLGAGLSQVAGKVFRIGHLGDLND  350

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  105
            L +LG + G EM + D+G  VKLGSGV AA A+ +
Sbjct  351  LMVLGAIGGAEMAMADVGIDVKLGSGVGAAQAHFR  385



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 167/217 (77%), Gaps = 1/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VS+I +IDFR +EW VD A+TGSQK L LP G+GIVCAS +ALEASKTA+  RVFFD+ D
Sbjct  177  VSAIGSIDFRAEEWRVDCAITGSQKGLMLPAGLGIVCASKRALEASKTAECRRVFFDFGD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
              K    G Y+PYTP++ +LYGLR  L  + +EGL+NV ARH RL  +TR AV+AWGL  
Sbjct  237  QAKANATG-YFPYTPALPMLYGLREALRCVEDEGLENVFARHRRLADSTRAAVEAWGLTL  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++E+W+SDTV+AV+VP  ++ +E++  A+KRYNL+LG GL++VAGK+FRIGH+G+LNE
Sbjct  296  CAKEEKWYSDTVSAVMVPDGVNGAEVIDIAYKRYNLALGAGLSQVAGKLFRIGHIGDLNE  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            L LLG LAGVEM + D G  ++ GSGVAAA   L+ +
Sbjct  356  LMLLGALAGVEMAMLDAGIRIEPGSGVAAAQKSLRGS  392



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ ++DF+ DEWGVDVA++GSQK   LP G+ I+  S KAL+A +TAK  R +FD++D
Sbjct  177  VSSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLAIMSVSQKALKAGETAKLHRAYFDFQD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            ++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK 
Sbjct  237  HVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKP  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNE
Sbjct  296  CAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNE  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  114
            L LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  356  LMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D
Sbjct  177  VSSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            ++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK 
Sbjct  237  HVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKP  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNE
Sbjct  296  CAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNE  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  114
            L LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  356  LMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D
Sbjct  177  VSSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            ++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK 
Sbjct  237  HVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKP  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNE
Sbjct  296  CAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNE  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  114
            L LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  356  LMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 160/224 (71%), Gaps = 1/224 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI +IDFRMDEWG+D+ L GSQK   LP G+ ++C S KALEA  TAKS R F D +D
Sbjct  172  VSSIASIDFRMDEWGIDIGLAGSQKGFMLPAGLALLCFSQKALEARHTAKSRRCFLDIQD  231

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            ++     G Y+PYTPSI LLYGLR  +DLL EEGL NV ARH RL    R AV+AWGL+ 
Sbjct  232  HITNNASG-YFPYTPSIPLLYGLRKAIDLLLEEGLQNVFARHQRLAEGVRRAVKAWGLEL  290

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C +  +W+S+TV+A+VVP   D+ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNE
Sbjct  291  CARDPKWYSNTVSAIVVPQGYDARDVMHYAYHRYNLSLGAGLSEVAGKVFRIGHLGDLNE  350

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  78
            L L   +AG EM ++D+G  V  GSGVAAA  Y + T P +  R
Sbjct  351  LMLCSAIAGAEMAMRDVGIQVTPGSGVAAACEYWRETAPAVKPR  394



>ref|XP_011399157.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26261.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
Length=377

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 163/224 (73%), Gaps = 1/224 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ A+ F+ D+W VDVA+TGSQKALSLPTG+GIV AS KAL+A  +AK  RV+F + D
Sbjct  150  VSSVGALPFKFDDWRVDVAVTGSQKALSLPTGLGIVAASDKALDARSSAKLKRVYFSFDD  209

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             LK  K G   PYTP + LL+GL+A L LL  EGLDNV ARH RL   TR AV AWGLK 
Sbjct  210  MLKTNKNGGV-PYTPILPLLHGLKASLGLLNAEGLDNVFARHHRLAEGTRAAVAAWGLKL  268

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
              ++  W SDT+T V VP  +DS +IV  A+ +YNLSLGLGL +V GKVFRIGHLGN++E
Sbjct  269  LCREPRWQSDTLTVVEVPEGLDSQKIVDTAFAKYNLSLGLGLAEVQGKVFRIGHLGNMDE  328

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  78
            L L G L GVEM L+D+G P++LGSGV AA    Q  TP+IP+R
Sbjct  329  LMLAGALGGVEMTLRDVGLPIELGSGVGAALKVWQEGTPVIPTR  372



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI ++DFR DEW VD+A+ GSQK L LP G+GIVCASP+AL A+KTA   RV+FD+ D
Sbjct  172  VSSIGSLDFRADEWRVDLAIAGSQKGLMLPAGLGIVCASPRALAATKTAGLKRVYFDFAD  231

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             +K    G Y+PYTP++ +LYGLR  + +LFEE L++V  RH  L    R AV+AWGL  
Sbjct  232  MIKANATG-YFPYTPALPMLYGLRESMRILFEEKLEHVFERHHVLAGGVRAAVKAWGLHP  290

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W SDTVTA+VVP+ I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+
Sbjct  291  CAKEAKWDSDTVTAIVVPAGINGADVIDTAYRRYNLSLGAGLSQVAGKVFRIGHLGDLND  350

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            L +LG +AG EM ++D+G  ++LGSGV AA  + ++T
Sbjct  351  LMVLGAIAGAEMAMRDVGIDIQLGSGVGAAQEHFRST  387



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI +I F+MDEW VD+A+TGSQK L LP G+G+VCAS KALE SK     RVFF ++D
Sbjct  174  VSSIASIPFKMDEWKVDLAITGSQKGLMLPAGLGMVCASEKALERSKKNNLHRVFFSFED  233

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             +    +G Y+PYTPSI LLYGL+  L +L EEGL++V  RH RL    R AV+AWGLK 
Sbjct  234  MIVNNDVG-YFPYTPSIPLLYGLKESLAMLMEEGLESVYVRHRRLAHGVRRAVEAWGLKT  292

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C +  + +SDTVTAVVVP   D+ ++++ A+++YNLSLG GL KV G+VFRIGHLG+LNE
Sbjct  293  CCKNPKEYSDTVTAVVVPEGFDAQQVIRIAYEKYNLSLGAGLMKVRGRVFRIGHLGDLNE  352

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            L +L  LAG EM + ++G P+KLGSGVAAAS Y   T+  +
Sbjct  353  LMVLATLAGTEMAMLEVGIPIKLGSGVAAASEYYMKTSKQV  393



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ ++DFR DEWGVD+A++GSQK L LP G+G++  S KAL ASKTA S R +FD+ D
Sbjct  172  VSSLGSLDFRQDEWGVDLAVSGSQKGLMLPAGLGVLGVSQKALAASKTATSKRCYFDFDD  231

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             +K    G Y+PYTP + LLYGLR  L ++ +EGL+N+  RH+ L    R AV+AWGL  
Sbjct  232  MIKANATG-YFPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSHLAGGVRAAVKAWGLTP  290

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W+SDTVTA+VVP   ++ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNE
Sbjct  291  CAKEPKWYSDTVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQVAGKVFRIGHLGDLNE  350

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  90
            L +LG LAG EM + D+G PV LGSGV AA ++ +   P+
Sbjct  351  LMVLGALAGAEMAMADVGIPVTLGSGVGAAQSFYRAAAPV  390



>gb|AEW08188.1| hypothetical protein 2_2585_01, partial [Pinus lambertiana]
Length=135

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = -2

Query  719  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  540
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYL+FYKMGTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLRFYKMGTY  60

Query  539  WPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            WPYTPSIQLLYGLRA LDL+  EEGLDNVIARH RLGTATRLAV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWYS  120

Query  362  DTVTAVVVPSYIDSS  318
            DTVTAV+VP YIDS+
Sbjct  121  DTVTAVIVPPYIDSA  135



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ ++DF+ DEWGVDVA++GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D
Sbjct  177  VSSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
            ++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK 
Sbjct  237  HVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKP  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W SDTVTA++VP   D++++++ A+KRYNL+LG GL+KVAGKVFRIGHLG+LNE
Sbjct  296  CAKESKWNSDTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLSKVAGKVFRIGHLGDLNE  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  114
            L LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  356  LMLLGAIAGAEMAMLDVGIPVTPGSGVAAAQA  387



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 163/221 (74%), Gaps = 2/221 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMD+W VD+A+TGSQK L LP G+GI+C SPKAL+A +TAKS R +FD  D
Sbjct  180  VSSIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSPKALKAIETAKSKRCYFDLGD  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLK  393
             +K    G Y+PYTP++ LLYGLR  LDL+F+EGLDNV ARH  L    R AV + WGL+
Sbjct  240  MIKANATG-YFPYTPALSLLYGLRTALDLIFQEGLDNVFARHHHLAQGVRAAVTEGWGLE  298

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +  +W+SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LN
Sbjct  299  LCAKGPKWYSDTVSAIVVPQGFNAANVIDRAFRRYNLALGAGLSKVAGKVFRIGHLGDLN  358

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  90
            EL L   +AG EM + D+G  V+ GSG  AA+ Y +   P+
Sbjct  359  ELMLTSAIAGAEMAMLDVGIDVRPGSGTGAATQYWRTHDPL  399



>ref|XP_002953765.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
 gb|EFJ45089.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
Length=449

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 163/224 (73%), Gaps = 1/224 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI A++FRMD+W VDVA+TGSQKALSLPTG+  V ASPKALEA K+AK  RV++D+ D
Sbjct  222  VSSIGALEFRMDDWRVDVAVTGSQKALSLPTGLAFVAASPKALEAMKSAKLKRVYYDFAD  281

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             L+    G   PYTPS+ +LYG+R  + +L EEG++NV ARH RLG   R AV+ WGLK 
Sbjct  282  MLRTNPSGNV-PYTPSLAMLYGMRESIKMLREEGMENVFARHHRLGEGARRAVEGWGLKL  340

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
              +   W SD++T V VP  IDS++IVK A+ +Y+LSLG+GL ++ GKVFRIGHLGN+NE
Sbjct  341  LCKNPRWRSDSLTVVEVPEGIDSNKIVKVAYAKYDLSLGIGLAQINGKVFRIGHLGNMNE  400

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  78
            L L+  LAG EM + D G P++ GSGV  A  Y Q T+ +I +R
Sbjct  401  LMLVSALAGAEMAMIDAGVPIRPGSGVGKAIEYWQQTSSVIKTR  444



>gb|AFG57258.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57259.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57260.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57261.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57262.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57263.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57264.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57265.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57266.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57267.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57268.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57269.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57270.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57271.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57272.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57273.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57274.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57275.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
Length=135

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -2

Query  719  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  540
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTY  60

Query  539  WPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            WPYTPSIQLLYGLRA LDL+  EEGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVITRHSRLGTATRFAVEAWGLKNCTQKEEWYS  120

Query  362  DTVTAVVVPSYIDSS  318
            DTVTAVVVP YIDS+
Sbjct  121  DTVTAVVVPPYIDSA  135



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 161/225 (72%), Gaps = 4/225 (2%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDW  576
            VS + ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W
Sbjct  174  VSGVGSLDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSW  233

Query  575  KDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGL  396
            +D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGL
Sbjct  234  EDMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGL  292

Query  395  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  216
            K C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L
Sbjct  293  KLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGAL  352

Query  215  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  81
            +E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  353  DEYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  396



>gb|AEW08187.1| hypothetical protein 2_2585_01, partial [Pinus radiata]
Length=135

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -2

Query  719  MDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTY  540
            MDEWGVDVALTGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTY
Sbjct  1    MDEWGVDVALTGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTY  60

Query  539  WPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            WPYTPSIQLLYGLRA LDL+  EEGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+S
Sbjct  61   WPYTPSIQLLYGLRAALDLILVEEGLDNVIIRHSRLGTATRFAVEAWGLKNCTQKEEWYS  120

Query  362  DTVTAVVVPSYIDSS  318
            DTVTAVVVP YIDS+
Sbjct  121  DTVTAVVVPPYIDSA  135



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 161/225 (72%), Gaps = 4/225 (2%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDW  576
            VS + ++D RM EWGVD  ++GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W
Sbjct  171  VSGVGSLDMRMGEWGVDCCVSGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSW  230

Query  575  KDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGL  396
            +D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGL
Sbjct  231  EDMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGL  289

Query  395  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  216
            K C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L
Sbjct  290  KLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGAL  349

Query  215  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  81
            +E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  350  DEYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  393



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 159/217 (73%), Gaps = 1/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D
Sbjct  177  VSSIGSIDFRASEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
              K    G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  
Sbjct  237  MSKANATG-YFPYTPALPLLYGLRESMACLFEEGLERVFERHRVLADGCRAAVKAWGLTL  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W+SDTV+A++VP  I+ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+
Sbjct  296  CAKEPKWYSDTVSAIMVPEGINGADVIDIAFRRYNLALGAGLSKVAGKLFRIGHLGDLND  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            L LLG LAG EM + D G  ++ GSGVAAA  + + T
Sbjct  356  LMLLGALAGAEMSMLDAGIKIEPGSGVAAAQQHFRET  392



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 161/220 (73%), Gaps = 2/220 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D
Sbjct  180  VSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLAD  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLK  393
             ++    G Y+PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L    R AV + WGL+
Sbjct  240  MVRTNATG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLAAGVRAAVTEGWGLE  298

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +   W SDTV+A+VVP  +++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LN
Sbjct  299  LCAKAPRWHSDTVSAIVVPEGVNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLN  358

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            EL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  359  ELMLMSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 159/222 (72%), Gaps = 6/222 (3%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVF  585
            VSSI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+
Sbjct  154  VSSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVY  213

Query  584  FDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQA  405
            FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV A
Sbjct  214  FDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAA  272

Query  404  WGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHL  225
            WGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+
Sbjct  273  WGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHV  332

Query  224  GNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  333  GDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  374



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 159/222 (72%), Gaps = 6/222 (3%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVF  585
            VSSI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+
Sbjct  177  VSSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVY  236

Query  584  FDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQA  405
            FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV A
Sbjct  237  FDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAA  295

Query  404  WGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHL  225
            WGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+
Sbjct  296  WGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHV  355

Query  224  GNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  356  GDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 159/222 (72%), Gaps = 6/222 (3%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVF  585
            VSSI ++ F+ DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+
Sbjct  177  VSSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVY  236

Query  584  FDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQA  405
            FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV A
Sbjct  237  FDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAA  295

Query  404  WGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHL  225
            WGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+
Sbjct  296  WGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHV  355

Query  224  GNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  356  GDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 159/222 (72%), Gaps = 6/222 (3%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVF  585
            VSSI ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+
Sbjct  177  VSSIGSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVY  236

Query  584  FDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQA  405
            FDW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV A
Sbjct  237  FDWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAA  295

Query  404  WGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHL  225
            WGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+
Sbjct  296  WGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHV  355

Query  224  GNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  356  GDLNELSLLGAIAGAEMSLLDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 159/222 (72%), Gaps = 6/222 (3%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVF  585
            VSSI ++ F  DEW VD A+ GSQK L LP G+G++C S KAL+A+     +  +  RV+
Sbjct  177  VSSIGSLPFYADEWKVDCAIAGSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVY  236

Query  584  FDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQA  405
            FDW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV A
Sbjct  237  FDWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAA  295

Query  404  WGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHL  225
            WGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+
Sbjct  296  WGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHV  355

Query  224  GNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  356  GDLNELSLLGAIAGAEMSLLDNGVNVTPGSGVAAASSYLREN  397



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ +++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA++A KT K  R +F+++D
Sbjct  177  VSSVASLEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIDAGKTNKGRRAYFEFQD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L   TR AV AWGLK 
Sbjct  237  MIAQNANG-YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGTRAAVAAWGLKT  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W SDTVTA+VVP   D+ ++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNE
Sbjct  296  CAKEPKWNSDTVTAIVVPEGYDAVKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNE  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  105
            L LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  356  LMLLGAIAGAEMAMLDNGIKIEAGSGVAAAQAVFR  390



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 159/222 (72%), Gaps = 6/222 (3%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVF  585
            VSSI ++ F+ DEW VD A+ GSQK L LP G+G++C S +AL+A+     +  +  RV+
Sbjct  177  VSSIGSLPFKADEWKVDCAIAGSQKGLMLPAGLGVICVSQRALKAAEGQSGRNDRLARVY  236

Query  584  FDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQA  405
            FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV A
Sbjct  237  FDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAA  295

Query  404  WGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHL  225
            WGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+
Sbjct  296  WGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHV  355

Query  224  GNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  356  GDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_026190999.1| serine--glyoxylate aminotransferase [Methylobacterium sp. WSM2598]
Length=417

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 158/217 (73%), Gaps = 1/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D
Sbjct  177  VSSIGSIDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
              K    G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  
Sbjct  237  MSKANATG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTL  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+
Sbjct  296  CAKEPKWYSDTVSAIMVPEGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLND  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            L LLG LAG EM + D G  ++ GSGV AA  + + T
Sbjct  356  LMLLGALAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_042306504.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
Length=422

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 161/220 (73%), Gaps = 2/220 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D
Sbjct  180  VSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLAD  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLK  393
             ++    G Y+PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L +  R A+ + WGL+
Sbjct  240  MVRTNATG-YFPYTPALSLLYGLRAALDLLFEEGLDNVFARHHYLASGVRAAITEGWGLE  298

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LN
Sbjct  299  VCAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLN  358

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            EL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  359  ELMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_012336184.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 4-46]
 gb|ACA20808.1| Serine--glyoxylate transaminase [Methylobacterium sp. 4-46]
Length=417

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 158/217 (73%), Gaps = 1/217 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI +IDFR  EWGVD A+TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D
Sbjct  177  VSSIGSIDFRATEWGVDCAITGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
              K    G Y+PYTP++ LLYGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  
Sbjct  237  MSKANATG-YFPYTPALPLLYGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTL  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W+SDTV+A++VP  ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+
Sbjct  296  CAKEPKWYSDTVSAIMVPDGVNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLND  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            L LLG LAG EM + D G  ++ GSGV AA  + + T
Sbjct  356  LMLLGALAGAEMAMLDAGIRIEPGSGVGAAQKHFRET  392



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 158/214 (74%), Gaps = 2/214 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMD+W VD+A+TGSQK L LP G+GI+C S KAL+AS+TA S R +FD  D
Sbjct  180  VSSIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCVSQKALKASETATSRRCYFDLAD  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLK  393
             +K    G Y+PYTP++ LLYGLR  LDLLFEEGLDNV ARH  L    R A+ + W L 
Sbjct  240  MIKANATG-YFPYTPALPLLYGLRTALDLLFEEGLDNVFARHHYLAQGVRAAITEGWDLG  298

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +  +W SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LN
Sbjct  299  VCAKAPKWHSDTVSAIVVPEKFNAAHVIDRAYRRYNLALGAGLSKVAGKVFRIGHLGDLN  358

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  111
            EL L+G +AG EM + DIG  V+ GSG  AA+ Y
Sbjct  359  ELMLMGAIAGAEMAMLDIGIDVRPGSGTGAAAQY  392



>ref|WP_008058631.1| serine--glyoxylate aminotransferase [Methyloversatilis universalis]
 gb|EGK73403.1| Serine-glyoxylate aminotransferase [Methyloversatilis universalis 
FAM5]
Length=396

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 157/220 (71%), Gaps = 2/220 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ +IDFRMDEWGVD A++GSQK   LP G+GI+  SPKAL+A +TA S R +FD  D
Sbjct  175  VSSLVSIDFRMDEWGVDCAVSGSQKGFMLPAGMGILGVSPKALKAMETATSRRCYFDLGD  234

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQ-AWGLK  393
             LK    G Y+PYTPSI +LYG+R  L+ +FEEGL+N+ ARH  L +  R AVQ  W L 
Sbjct  235  MLKNNATG-YFPYTPSIPMLYGMRESLNTIFEEGLENIFARHNYLASGVRAAVQEGWKLN  293

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +  EW+SDTV+A++VP   D+++++  A+ +YNLSLG GL+KVAGKVFRIGHLG+LN
Sbjct  294  LCAKAPEWYSDTVSAILVPEGFDATKVISNAYAKYNLSLGAGLSKVAGKVFRIGHLGDLN  353

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
             L L+  +AG EM + D G  V  GSGVAAAS Y +   P
Sbjct  354  ALSLMSAIAGAEMSMLDNGINVTPGSGVAAASTYWRTHAP  393



>ref|WP_028367172.1| serine--glyoxylate aminotransferase [Burkholderia sp. UYPR1.413]
Length=421

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 159/220 (72%), Gaps = 2/220 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D
Sbjct  180  VSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLAD  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLK  393
             ++    G Y+PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L +  R AV + WGL 
Sbjct  240  MVRTNATG-YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLASGVRAAVTEGWGLS  298

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +   W SDTV+A+VVP  ++ ++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LN
Sbjct  299  LCAKAPRWHSDTVSAIVVPEGVNGAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLN  358

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            EL L+  +AG EM + D G  V  GSGV AA  Y +  TP
Sbjct  359  ELMLMSAIAGAEMAMLDAGIDVCPGSGVGAAGQYWRTHTP  398



>ref|WP_007585769.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
 gb|EIM98368.1| serine--glyoxylate transaminase [Burkholderia terrae BS001]
Length=422

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 161/220 (73%), Gaps = 2/220 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D
Sbjct  180  VSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLAD  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLK  393
             ++    G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+
Sbjct  240  MVRTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLE  298

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LN
Sbjct  299  VCAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLN  358

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            EL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  359  ELMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score =   221 bits (564),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  446  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  267
            H RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLG
Sbjct  1    HARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLG  60

Query  266  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+I
Sbjct  61   LNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLI  120

Query  86   PSRI  75
            PSRI
Sbjct  121  PSRI  124



>ref|WP_035994918.1| serine--glyoxylate aminotransferase [Burkholderia caribensis]
 gb|ETY83415.1| Serine--glyoxylate aminotransferase [Burkholderia caribensis 
MBA4]
Length=422

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 161/220 (73%), Gaps = 2/220 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D
Sbjct  180  VSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLAD  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLK  393
             ++    G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+
Sbjct  240  MVRTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLE  298

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LN
Sbjct  299  VCAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLN  358

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            EL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  359  ELMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_028212654.1| serine--glyoxylate aminotransferase [Burkholderia mimosarum]
Length=419

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 159/214 (74%), Gaps = 2/214 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMD+W VD+A+TGSQK L LP G+GI+CASPKAL+A + A+S R +FD  D
Sbjct  180  VSSIGCIDFRMDDWRVDLAVTGSQKGLMLPAGLGILCASPKALKAMEHAQSRRCYFDLGD  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLK  393
             +K    G Y+PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L    R AV + WGL+
Sbjct  240  MIKANATG-YFPYTPALSLLYGLRASLDLLFEEGLDNVFARHHYLAAGVRAAVTEGWGLE  298

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +  +W SDTVTA+VVP   +++ ++  A++RYNL+LG GL+KVAGKVFRIGHLG+LN
Sbjct  299  LCAKAPKWHSDTVTAIVVPQGFNAAHVIDTAFRRYNLALGAGLSKVAGKVFRIGHLGDLN  358

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  111
            EL L   ++G EM + D+G  V+ GSG  AA+ Y
Sbjct  359  ELMLTSAISGAEMAMLDVGIDVRPGSGTGAATQY  392



>ref|WP_007742731.1| serine--glyoxylate aminotransferase [Burkholderia sp. BT03]
 gb|EUC15360.1| Serine--glyoxylate transaminase [Burkholderia sp. BT03]
Length=422

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 161/220 (73%), Gaps = 2/220 (1%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI  IDFRMDEWGVD+A+TGSQK L LP G+GI+C S KAL+    AKS R +FD  D
Sbjct  180  VSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKALKTIGHAKSRRCYFDLAD  239

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLK  393
             ++    G Y+PYTP++ LLYGLRA LDLLF+EGLDNV ARH  L +  R A+ + WGL+
Sbjct  240  MVRTNATG-YFPYTPALSLLYGLRAALDLLFQEGLDNVFARHHYLASGVRAAITEGWGLE  298

Query  392  NCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  213
             C +  +W SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LN
Sbjct  299  VCAKAPKWHSDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLN  358

Query  212  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            EL L+  +AG EM + D G  V+ GSGV AA  Y +  TP
Sbjct  359  ELMLVSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 158/215 (73%), Gaps = 1/215 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSS+ +++F+MDEWGVDV ++GSQK   LP G+ ++ ASPKA+E  KT K  R +F+++D
Sbjct  177  VSSVASLEFKMDEWGVDVIVSGSQKGFMLPAGLLLMAASPKAIEKGKTNKGRRAYFEFQD  236

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L    R AV AWGLK 
Sbjct  237  MIAQNANG-YFPYTPSVPLLYGLKEALSILFEEGLDQVYKRHHHLAEGCRAAVAAWGLKT  295

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNE
Sbjct  296  CAKEPKWNSDTVTAIVVPEGFDAAKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNE  355

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  105
            L LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  356  LMLLGAIAGAEMAMLDNGIKIQPGSGVAAAQAVFR  390



>ref|WP_028097617.1| serine--glyoxylate aminotransferase [Dongia sp. URHE0060]
Length=397

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 155/216 (72%), Gaps = 1/216 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI +IDFRMDEWGVD+A+ GSQK   LP G+ I+C SPKAL+ +K +K  R +FD+ D
Sbjct  172  VSSIASIDFRMDEWGVDIAVCGSQKGFMLPGGLAILCVSPKALDTAKNSKLHRCYFDFAD  231

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             +K  K G ++PYTP +QL+ GLR  +D+L  EGL+NV ARH RLG   R AV AW +K 
Sbjct  232  MIKTNKDG-FFPYTPPMQLIRGLRTSVDMLLSEGLENVFARHHRLGEGVRRAVAAWNMKL  290

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
              +++ W SDTV+A+ +    DS+ +V+ A++RY LSLG+GL ++ GKVFRIGHLG+LNE
Sbjct  291  VAKEKRWQSDTVSAIQITDGFDSNSLVRHAYRRYGLSLGVGLARLNGKVFRIGHLGDLNE  350

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  102
            L +L  L GVE+ ++D+G P+K GSGV AA  Y   
Sbjct  351  LMVLSALGGVELAMRDVGVPIKAGSGVGAAVDYFHQ  386



>gb|KIZ03753.1| serine--glyoxylate transaminase [Monoraphidium neglectum]
Length=425

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 159/224 (71%), Gaps = 1/224 (0%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKD  570
            VSSI A++F+ D+W VDVA+TGSQKALSLPTG+ ++C S KAL+A KTAK  R+++ W D
Sbjct  201  VSSIGALEFKFDDWRVDVAVTGSQKALSLPTGLALLCVSDKALDARKTAKLPRIYYSWDD  260

Query  569  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  390
             L     G   PYTPS+ LL+GL+  L LL EEG DNV+ARH RL   TR AV+ WGLK 
Sbjct  261  QLNTNPSGNV-PYTPSLMLLHGLKESLALLREEGFDNVVARHHRLAEGTRKAVEGWGLKL  319

Query  389  CTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
              +   W SD++T + VP+ IDS+ IVK A+ +YNLS+G+GL+KV GKVFRIGHLGN++E
Sbjct  320  LCKHPRWQSDSLTVIEVPAGIDSNLIVKNAYSKYNLSIGIGLSKVNGKVFRIGHLGNMDE  379

Query  209  LQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  78
            L +   L+G EM + D G  +  GSGV  A  Y Q T+ +IP+R
Sbjct  380  LMMCSALSGAEMAMLDAGMKITPGSGVGRAIEYWQKTSKVIPTR  423



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 161/222 (73%), Gaps = 6/222 (3%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASK--TAKSVRV---F  585
            +SSI ++ F+MDEWGVD A+ GSQK   LP G+G++C SPKAL+ ++  T ++ R+   +
Sbjct  177  ISSIGSLPFKMDEWGVDCAIAGSQKGFMLPAGLGLICISPKALKIAEGGTGRNDRLGHAY  236

Query  584  FDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQA  405
            F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV A
Sbjct  237  FAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQAVAA  295

Query  404  WGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHL  225
            WGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHL
Sbjct  296  WGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHL  355

Query  224  GNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            G+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  356  GDLNELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_038511699.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
Length=394

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 159/218 (73%), Gaps = 6/218 (3%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS----VRVFF  582
            VSSI +IDFRMD+W VD  +TGSQK L LP G+GI   S KALEA K A++     RV+F
Sbjct  172  VSSIGSIDFRMDDWKVDAIITGSQKGLMLPAGLGIAVVSQKALEAQKAARANNPLRRVYF  231

Query  581  DWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQA  405
            D++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R AV+A
Sbjct  232  DFEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKA  290

Query  404  WGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHL  225
            WGL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHL
Sbjct  291  WGLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHL  350

Query  224  GNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  111
            G+LNEL  LG + G EM ++DIG  VK GSG AAA  Y
Sbjct  351  GDLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEY  388



>ref|WP_011630756.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
 gb|ABI60946.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis 
CGDNIH1]
Length=394

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 159/218 (73%), Gaps = 6/218 (3%)
 Frame = -2

Query  749  VSSICAIDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKS----VRVFF  582
            VSSI +IDFRMD+W VD  +TGSQK L LP G+GI   S KALEA K A++     RV+F
Sbjct  172  VSSIGSIDFRMDDWKVDAIITGSQKGLMLPAGLGIAVVSQKALEAQKAARANNPLRRVYF  231

Query  581  DWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQA  405
            D++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R AV+A
Sbjct  232  DFEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKA  290

Query  404  WGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHL  225
            WGL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHL
Sbjct  291  WGLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHL  350

Query  224  GNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  111
            G+LNEL  LG + G EM ++DIG  VK GSG AAA  Y
Sbjct  351  GDLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEY  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840