BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF021I05

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011007801.1|  PREDICTED: nicotinamide adenine dinucleotide...    320   2e-105   Populus euphratica
ref|XP_002302737.1|  mitochondrial substrate carrier family protein     320   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_009594055.1|  PREDICTED: nicotinamide adenine dinucleotide...    320   4e-105   Nicotiana tomentosiformis
gb|KJB06734.1|  hypothetical protein B456_001G141500                    315   2e-104   Gossypium raimondii
ref|XP_009784346.1|  PREDICTED: nicotinamide adenine dinucleotide...    317   3e-104   Nicotiana sylvestris
gb|KJB06735.1|  hypothetical protein B456_001G141500                    314   5e-104   Gossypium raimondii
gb|KDP28207.1|  hypothetical protein JCGZ_13978                         316   8e-104   Jatropha curcas
gb|KHG29129.1|  Mitochondrial nicotinamide adenine dinucleotide t...    316   1e-103   Gossypium arboreum [tree cotton]
ref|XP_010326568.1|  PREDICTED: nicotinamide adenine dinucleotide...    315   2e-103   Solanum lycopersicum
ref|XP_002320327.1|  mitochondrial substrate carrier family protein     315   3e-103   
ref|XP_006359875.1|  PREDICTED: nicotinamide adenine dinucleotide...    314   5e-103   Solanum tuberosum [potatoes]
gb|KJB06737.1|  hypothetical protein B456_001G141500                    314   6e-103   Gossypium raimondii
gb|KJB06733.1|  hypothetical protein B456_001G141500                    314   6e-103   Gossypium raimondii
gb|KDO87106.1|  hypothetical protein CISIN_1g021150mg                   311   7e-103   Citrus sinensis [apfelsine]
gb|KEH24421.1|  substrate carrier family protein                        310   8e-103   Medicago truncatula
ref|XP_010103406.1|  Mitochondrial substrate carrier family prote...    313   9e-103   Morus notabilis
ref|XP_007163152.1|  hypothetical protein PHAVU_001G210600g             313   1e-102   Phaseolus vulgaris [French bean]
emb|CDP17096.1|  unnamed protein product                                313   2e-102   Coffea canephora [robusta coffee]
gb|KEH24420.1|  substrate carrier family protein                        310   3e-102   Medicago truncatula
ref|XP_007200447.1|  hypothetical protein PRUPE_ppa008929mg             311   6e-102   Prunus persica
ref|XP_011041851.1|  PREDICTED: nicotinamide adenine dinucleotide...    311   1e-101   Populus euphratica
gb|KHN43485.1|  Mitochondrial substrate carrier family protein W        308   1e-101   Glycine soja [wild soybean]
gb|KDO87105.1|  hypothetical protein CISIN_1g021150mg                   310   1e-101   Citrus sinensis [apfelsine]
ref|XP_006444424.1|  hypothetical protein CICLE_v10024227mg             310   2e-101   
ref|XP_008451527.1|  PREDICTED: LOW QUALITY PROTEIN: nicotinamide...    310   2e-101   Cucumis melo [Oriental melon]
ref|XP_002273574.1|  PREDICTED: nicotinamide adenine dinucleotide...    310   2e-101   Vitis vinifera
ref|XP_008235160.1|  PREDICTED: nicotinamide adenine dinucleotide...    310   2e-101   Prunus mume [ume]
gb|KEH24418.1|  substrate carrier family protein                        310   2e-101   Medicago truncatula
ref|XP_004136010.1|  PREDICTED: mitochondrial substrate carrier f...    310   3e-101   Cucumis sativus [cucumbers]
ref|XP_004494928.1|  PREDICTED: nicotinamide adenine dinucleotide...    309   3e-101   
ref|XP_003521580.1|  PREDICTED: nicotinamide adenine dinucleotide...    309   5e-101   Glycine max [soybeans]
ref|XP_003554533.1|  PREDICTED: nicotinamide adenine dinucleotide...    308   8e-101   Glycine max [soybeans]
ref|XP_010259427.1|  PREDICTED: nicotinamide adenine dinucleotide...    305   1e-100   
ref|XP_006480018.1|  PREDICTED: nicotinamide adenine dinucleotide...    307   3e-100   Citrus sinensis [apfelsine]
gb|KDO87104.1|  hypothetical protein CISIN_1g021150mg                   306   9e-100   Citrus sinensis [apfelsine]
ref|XP_007051022.1|  NAD+ transporter 1                                 305   1e-99    
gb|EYU46767.1|  hypothetical protein MIMGU_mgv1a010350mg                305   2e-99    Erythranthe guttata [common monkey flower]
ref|XP_011079611.1|  PREDICTED: nicotinamide adenine dinucleotide...    305   3e-99    Sesamum indicum [beniseed]
ref|XP_010259426.1|  PREDICTED: nicotinamide adenine dinucleotide...    304   4e-99    Nelumbo nucifera [Indian lotus]
ref|XP_002523136.1|  mitochondrial carrier protein, putative            304   5e-99    Ricinus communis
ref|XP_010905688.1|  PREDICTED: nicotinamide adenine dinucleotide...    301   6e-98    Elaeis guineensis
ref|XP_008807764.1|  PREDICTED: nicotinamide adenine dinucleotide...    301   9e-98    Phoenix dactylifera
ref|XP_010684596.1|  PREDICTED: nicotinamide adenine dinucleotide...    299   4e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|AES61717.2|  substrate carrier family protein                        299   5e-97    Medicago truncatula
ref|XP_010559180.1|  PREDICTED: nicotinamide adenine dinucleotide...    297   2e-96    Tarenaya hassleriana [spider flower]
gb|KEH24419.1|  substrate carrier family protein                        292   1e-94    Medicago truncatula
ref|XP_006654293.1|  PREDICTED: nicotinamide adenine dinucleotide...    291   4e-94    Oryza brachyantha
ref|XP_004495929.1|  PREDICTED: nicotinamide adenine dinucleotide...    290   1e-93    Cicer arietinum [garbanzo]
ref|XP_010518453.1|  PREDICTED: nicotinamide adenine dinucleotide...    286   8e-93    Camelina sativa [gold-of-pleasure]
gb|KFK37525.1|  hypothetical protein AALP_AA4G268400                    288   8e-93    Arabis alpina [alpine rockcress]
ref|XP_010518452.1|  PREDICTED: nicotinamide adenine dinucleotide...    285   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_009414905.1|  PREDICTED: nicotinamide adenine dinucleotide...    287   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414904.1|  PREDICTED: nicotinamide adenine dinucleotide...    287   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67920.1|  hypothetical protein M569_06852                         286   5e-92    Genlisea aurea
ref|XP_002439632.1|  hypothetical protein SORBIDRAFT_09g017280          287   5e-92    Sorghum bicolor [broomcorn]
ref|XP_010518451.1|  PREDICTED: nicotinamide adenine dinucleotide...    285   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010507885.1|  PREDICTED: nicotinamide adenine dinucleotide...    285   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010507884.1|  PREDICTED: nicotinamide adenine dinucleotide...    285   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_006397944.1|  hypothetical protein EUTSA_v10001547mg             285   1e-91    Eutrema salsugineum [saltwater cress]
ref|XP_002880307.1|  mitochondrial substrate carrier family protein     285   1e-91    
ref|XP_010518450.1|  PREDICTED: nicotinamide adenine dinucleotide...    285   2e-91    Camelina sativa [gold-of-pleasure]
ref|XP_004962357.1|  PREDICTED: nicotinamide adenine dinucleotide...    285   2e-91    Setaria italica
ref|XP_006294636.1|  hypothetical protein CARUB_v10023674mg             282   1e-90    Capsella rubella
ref|NP_566102.1|  NAD+ transporter 1                                    282   2e-90    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ89038.1|  predicted protein                                      282   3e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009142527.1|  PREDICTED: nicotinamide adenine dinucleotide...    281   3e-90    Brassica rapa
dbj|BAJ85199.1|  predicted protein                                      282   5e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY57720.1|  BnaC04g51920D                                          280   9e-90    Brassica napus [oilseed rape]
ref|XP_009383544.1|  PREDICTED: nicotinamide adenine dinucleotide...    279   2e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006855345.1|  hypothetical protein AMTR_s00057p00101290          279   3e-89    Amborella trichopoda
gb|EMS54256.1|  hypothetical protein TRIUR3_07374                       280   5e-89    Triticum urartu
ref|NP_001131441.1|  uncharacterized protein LOC100192773               279   5e-89    Zea mays [maize]
gb|EEE63395.1|  hypothetical protein OsJ_18207                          279   6e-89    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055296.1|  Os05g0357200                                       279   6e-89    
ref|XP_008647348.1|  PREDICTED: uncharacterized protein LOC100192...    279   7e-89    Zea mays [maize]
gb|EMT02103.1|  Mitochondrial substrate carrier family protein W        281   7e-89    
ref|XP_003568632.1|  PREDICTED: nicotinamide adenine dinucleotide...    279   8e-89    Brachypodium distachyon [annual false brome]
ref|XP_010506785.1|  PREDICTED: nicotinamide adenine dinucleotide...    277   1e-88    
ref|XP_003591466.1|  Mitochondrial folate transporter/carrier           279   1e-88    
ref|XP_010905689.1|  PREDICTED: nicotinamide adenine dinucleotide...    276   2e-88    
gb|ACN28655.1|  unknown                                                 279   4e-88    Zea mays [maize]
ref|NP_001146478.1|  uncharacterized protein LOC100280066               276   7e-88    Zea mays [maize]
ref|XP_011082440.1|  PREDICTED: nicotinamide adenine dinucleotide...    273   5e-87    Sesamum indicum [beniseed]
gb|KJB48101.1|  hypothetical protein B456_008G053500                    266   7e-85    Gossypium raimondii
ref|XP_007153375.1|  hypothetical protein PHAVU_003G029900g             265   1e-84    Phaseolus vulgaris [French bean]
gb|KJB48098.1|  hypothetical protein B456_008G053500                    266   4e-84    Gossypium raimondii
ref|XP_007044248.1|  NAD+ transporter 2 isoform 1                       267   4e-84    
ref|XP_010523970.1|  PREDICTED: nicotinamide adenine dinucleotide...    265   7e-84    Tarenaya hassleriana [spider flower]
gb|KJB48097.1|  hypothetical protein B456_008G053500                    266   1e-83    Gossypium raimondii
ref|XP_010906995.1|  PREDICTED: nicotinamide adenine dinucleotide...    263   2e-83    
ref|XP_007153374.1|  hypothetical protein PHAVU_003G029900g             265   3e-83    Phaseolus vulgaris [French bean]
ref|XP_010906993.1|  PREDICTED: nicotinamide adenine dinucleotide...    263   6e-83    Elaeis guineensis
ref|XP_010264768.1|  PREDICTED: nicotinamide adenine dinucleotide...    263   1e-82    Nelumbo nucifera [Indian lotus]
ref|XP_006604086.1|  PREDICTED: nicotinamide adenine dinucleotide...    261   1e-82    Glycine max [soybeans]
gb|KHN47916.1|  Mitochondrial substrate carrier family protein W        262   2e-82    Glycine soja [wild soybean]
ref|XP_006587243.1|  PREDICTED: nicotinamide adenine dinucleotide...    263   3e-82    Glycine max [soybeans]
gb|KCW86299.1|  hypothetical protein EUGRSUZ_B02991                     261   4e-82    Eucalyptus grandis [rose gum]
ref|XP_010279335.1|  PREDICTED: nicotinamide adenine dinucleotide...    263   4e-82    Nelumbo nucifera [Indian lotus]
gb|KHG03180.1|  Mitochondrial substrate carrier family protein W        262   5e-82    Gossypium arboreum [tree cotton]
ref|XP_009383545.1|  PREDICTED: nicotinamide adenine dinucleotide...    259   6e-82    
ref|XP_008782321.1|  PREDICTED: nicotinamide adenine dinucleotide...    261   7e-82    Phoenix dactylifera
ref|XP_006842368.1|  hypothetical protein AMTR_s00079p00187170          261   7e-82    
ref|XP_003553860.1|  PREDICTED: nicotinamide adenine dinucleotide...    261   1e-81    Glycine max [soybeans]
ref|XP_004516758.1|  PREDICTED: nicotinamide adenine dinucleotide...    261   1e-81    Cicer arietinum [garbanzo]
ref|XP_008797621.1|  PREDICTED: nicotinamide adenine dinucleotide...    258   1e-81    
gb|AFK34832.1|  unknown                                                 257   2e-81    Lotus japonicus
ref|XP_008797620.1|  PREDICTED: nicotinamide adenine dinucleotide...    258   4e-81    Phoenix dactylifera
ref|XP_010099268.1|  hypothetical protein L484_015458                   257   9e-81    
ref|XP_010925998.1|  PREDICTED: nicotinamide adenine dinucleotide...    258   2e-80    Elaeis guineensis
ref|XP_006448416.1|  hypothetical protein CICLE_v10015617mg             258   3e-80    Citrus clementina [clementine]
ref|XP_008792834.1|  PREDICTED: nicotinamide adenine dinucleotide...    255   4e-80    
ref|XP_002315927.2|  hypothetical protein POPTR_0010s13120g             254   4e-80    
ref|XP_009407378.1|  PREDICTED: nicotinamide adenine dinucleotide...    254   9e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011076390.1|  PREDICTED: nicotinamide adenine dinucleotide...    255   2e-79    Sesamum indicum [beniseed]
ref|XP_010922196.1|  PREDICTED: nicotinamide adenine dinucleotide...    253   4e-79    Elaeis guineensis
ref|XP_010922189.1|  PREDICTED: nicotinamide adenine dinucleotide...    253   4e-79    
ref|XP_010644204.1|  PREDICTED: nicotinamide adenine dinucleotide...    255   4e-79    Vitis vinifera
ref|XP_010922203.1|  PREDICTED: nicotinamide adenine dinucleotide...    252   5e-79    
ref|XP_003614555.1|  Mitochondrial substrate carrier family prote...    254   7e-79    Medicago truncatula
ref|XP_010922181.1|  PREDICTED: nicotinamide adenine dinucleotide...    252   7e-79    Elaeis guineensis
ref|XP_010922172.1|  PREDICTED: nicotinamide adenine dinucleotide...    252   8e-79    Elaeis guineensis
gb|KDO76915.1|  hypothetical protein CISIN_1g016968mg                   254   1e-78    Citrus sinensis [apfelsine]
ref|XP_004147114.1|  PREDICTED: mitochondrial substrate carrier f...    253   2e-78    Cucumis sativus [cucumbers]
ref|XP_006645938.1|  PREDICTED: nicotinamide adenine dinucleotide...    251   3e-78    Oryza brachyantha
gb|KFK41256.1|  hypothetical protein AALP_AA2G105900                    251   3e-78    Arabis alpina [alpine rockcress]
gb|KDP29452.1|  hypothetical protein JCGZ_18373                         253   3e-78    Jatropha curcas
ref|XP_009409783.1|  PREDICTED: nicotinamide adenine dinucleotide...    251   5e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009105387.1|  PREDICTED: nicotinamide adenine dinucleotide...    249   7e-78    Brassica rapa
ref|XP_002527012.1|  mitochondrial carrier protein, putative            251   8e-78    Ricinus communis
gb|EEC70751.1|  hypothetical protein OsI_02162                          250   8e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_009105386.1|  PREDICTED: nicotinamide adenine dinucleotide...    249   1e-77    Brassica rapa
ref|XP_004968826.1|  PREDICTED: nicotinamide adenine dinucleotide...    249   2e-77    Setaria italica
ref|XP_011007410.1|  PREDICTED: nicotinamide adenine dinucleotide...    249   5e-77    Populus euphratica
emb|CDY38578.1|  BnaC06g30010D                                          248   6e-77    Brassica napus [oilseed rape]
emb|CDP00658.1|  unnamed protein product                                249   7e-77    Coffea canephora [robusta coffee]
emb|CDM83064.1|  unnamed protein product                                247   9e-77    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009109874.1|  PREDICTED: nicotinamide adenine dinucleotide...    248   1e-76    Brassica rapa
ref|XP_008467192.1|  PREDICTED: nicotinamide adenine dinucleotide...    248   1e-76    Cucumis melo [Oriental melon]
ref|XP_011022458.1|  PREDICTED: nicotinamide adenine dinucleotide...    248   1e-76    Populus euphratica
emb|CDX84985.1|  BnaC05g20700D                                          248   2e-76    
ref|XP_009115307.1|  PREDICTED: nicotinamide adenine dinucleotide...    248   2e-76    Brassica rapa
emb|CDY24409.1|  BnaCnng04760D                                          248   2e-76    Brassica napus [oilseed rape]
gb|EPS70095.1|  hypothetical protein M569_04665                         246   3e-76    Genlisea aurea
gb|KFK41414.1|  hypothetical protein AALP_AA2G127900                    241   5e-76    Arabis alpina [alpine rockcress]
ref|XP_006344160.1|  PREDICTED: nicotinamide adenine dinucleotide...    246   5e-76    Solanum tuberosum [potatoes]
ref|XP_008339642.1|  PREDICTED: nicotinamide adenine dinucleotide...    246   6e-76    Malus domestica [apple tree]
ref|XP_004238908.1|  PREDICTED: nicotinamide adenine dinucleotide...    246   7e-76    Solanum lycopersicum
gb|AAG50815.1|AC079281_17  mitochondrial carrier protein, putative      244   8e-76    Arabidopsis thaliana [mouse-ear cress]
gb|EYU40785.1|  hypothetical protein MIMGU_mgv1a008842mg                246   8e-76    Erythranthe guttata [common monkey flower]
gb|KFK44519.1|  hypothetical protein AALP_AA1G267200                    246   9e-76    Arabis alpina [alpine rockcress]
ref|XP_010046584.1|  PREDICTED: uncharacterized protein LOC104435557    259   1e-75    
ref|XP_010559229.1|  PREDICTED: nicotinamide adenine dinucleotide...    245   1e-75    Tarenaya hassleriana [spider flower]
ref|XP_002457880.1|  hypothetical protein SORBIDRAFT_03g017840          244   1e-75    Sorghum bicolor [broomcorn]
ref|XP_009356235.1|  PREDICTED: nicotinamide adenine dinucleotide...    245   2e-75    Pyrus x bretschneideri [bai li]
ref|XP_009357098.1|  PREDICTED: nicotinamide adenine dinucleotide...    245   2e-75    Pyrus x bretschneideri [bai li]
emb|CAN76447.1|  hypothetical protein VITISV_010118                     246   3e-75    Vitis vinifera
ref|XP_006304969.1|  hypothetical protein CARUB_v10012042mg             244   3e-75    Capsella rubella
emb|CAI38581.1|  mitochondrial carrier like protein                     244   5e-75    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564233.1|  NAD+ transporter 2                                    244   5e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299043.1|  PREDICTED: nicotinamide adenine dinucleotide...    244   5e-75    Fragaria vesca subsp. vesca
ref|XP_010681639.1|  PREDICTED: nicotinamide adenine dinucleotide...    243   6e-75    Beta vulgaris subsp. vulgaris [field beet]
gb|AAG28807.1|AC079374_10  unknown protein                              244   6e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415866.1|  hypothetical protein EUTSA_v10007992mg             243   8e-75    Eutrema salsugineum [saltwater cress]
ref|XP_008367006.1|  PREDICTED: nicotinamide adenine dinucleotide...    244   9e-75    
emb|CDX96021.1|  BnaA07g27100D                                          241   1e-74    
ref|XP_007223316.1|  hypothetical protein PRUPE_ppa007312mg             243   2e-74    
ref|XP_010499117.1|  PREDICTED: nicotinamide adenine dinucleotide...    242   2e-74    Camelina sativa [gold-of-pleasure]
ref|XP_002978962.1|  hypothetical protein SELMODRAFT_109819             240   3e-74    
ref|XP_010532254.1|  PREDICTED: nicotinamide adenine dinucleotide...    241   4e-74    Tarenaya hassleriana [spider flower]
ref|XP_002311469.1|  mitochondrial substrate carrier family protein     241   6e-74    Populus trichocarpa [western balsam poplar]
ref|XP_008243273.1|  PREDICTED: nicotinamide adenine dinucleotide...    241   1e-73    Prunus mume [ume]
ref|XP_002893428.1|  mitochondrial substrate carrier family protein     240   2e-73    
ref|XP_010477935.1|  PREDICTED: nicotinamide adenine dinucleotide...    240   2e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010460390.1|  PREDICTED: nicotinamide adenine dinucleotide...    239   6e-73    Camelina sativa [gold-of-pleasure]
ref|XP_009767034.1|  PREDICTED: nicotinamide adenine dinucleotide...    238   2e-72    Nicotiana sylvestris
ref|XP_009767035.1|  PREDICTED: nicotinamide adenine dinucleotide...    237   2e-72    Nicotiana sylvestris
ref|XP_009600753.1|  PREDICTED: nicotinamide adenine dinucleotide...    236   4e-72    Nicotiana tomentosiformis
ref|XP_009600754.1|  PREDICTED: nicotinamide adenine dinucleotide...    236   4e-72    Nicotiana tomentosiformis
ref|XP_001772029.1|  predicted protein                                  233   4e-71    
ref|XP_001763122.1|  predicted protein                                  231   2e-70    
gb|KFK43464.1|  hypothetical protein AALP_AA1G128600                    229   1e-69    Arabis alpina [alpine rockcress]
ref|XP_001754740.1|  predicted protein                                  225   4e-68    
ref|XP_002992842.1|  hypothetical protein SELMODRAFT_46825              221   2e-67    
ref|XP_002987576.1|  hypothetical protein SELMODRAFT_46815              221   4e-67    
dbj|BAD73080.1|  putative mitochondrial folate transporter              218   2e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007044249.1|  NAD+ transporter 2 isoform 2                       218   4e-65    
ref|NP_001043181.2|  Os01g0513200                                       197   7e-60    
ref|XP_010906994.1|  PREDICTED: nicotinamide adenine dinucleotide...    200   4e-59    Elaeis guineensis
gb|AFK40737.1|  unknown                                                 192   4e-58    Medicago truncatula
gb|AFW81645.1|  hypothetical protein ZEAMMB73_626020                    177   1e-51    
emb|CDY27484.1|  BnaC04g51250D                                          179   3e-51    Brassica napus [oilseed rape]
ref|XP_005644233.1|  mitochondrial carrier                              174   2e-48    Coccomyxa subellipsoidea C-169
ref|XP_001420486.1|  MC family transporter: folate                      171   5e-47    Ostreococcus lucimarinus CCE9901
ref|XP_007509429.1|  predicted protein                                  170   2e-46    Bathycoccus prasinos
ref|XP_003082002.1|  putative mitochondrial carrier protein (ISS)       168   2e-45    Ostreococcus tauri
ref|XP_002509046.1|  mitochondrial carrier family                       165   4e-45    Micromonas commoda
ref|XP_005848904.1|  hypothetical protein CHLNCDRAFT_51574              171   2e-44    Chlorella variabilis
ref|XP_002952313.1|  hypothetical protein VOLCADRAFT_62332              160   9e-44    Volvox carteri f. nagariensis
ref|XP_001701258.1|  hypothetical protein CHLREDRAFT_122344             160   2e-43    Chlamydomonas reinhardtii
gb|KJB48099.1|  hypothetical protein B456_008G053500                    151   1e-40    Gossypium raimondii
gb|EIE92451.1|  hypothetical protein RO3G_16973                         149   1e-40    Rhizopus delemar RA 99-880
ref|XP_009680639.1|  PREDICTED: mitochondrial folate transporter/...    149   9e-40    Struthio camelus australis
ref|XP_003061718.1|  mitochondrial carrier family                       152   1e-39    Micromonas pusilla CCMP1545
gb|AFK47776.1|  unknown                                                 145   1e-39    Medicago truncatula
gb|KFV85122.1|  Mitochondrial folate transporter/carrier                149   2e-39    Struthio camelus australis
ref|XP_003700146.1|  PREDICTED: mitochondrial folate transporter/...    150   2e-39    Megachile rotundata
ref|XP_004343599.2|  substrate carrier family protein                   152   2e-39    Capsaspora owczarzaki ATCC 30864
ref|XP_003287851.1|  hypothetical protein DICPUDRAFT_87783              148   5e-39    Dictyostelium purpureum
gb|KFO74010.1|  Mitochondrial folate transporter/carrier                147   8e-39    Cuculus canorus
gb|KFV65548.1|  Mitochondrial folate transporter/carrier                147   9e-39    Picoides pubescens
ref|XP_009911822.1|  PREDICTED: mitochondrial folate transporter/...    144   1e-38    Haliaeetus albicilla
ref|XP_009935817.1|  PREDICTED: mitochondrial folate transporter/...    146   1e-38    Opisthocomus hoazin [hoatzin]
gb|ETS62730.1|  hypothetical protein PaG_02468                          147   1e-38    Moesziomyces aphidis DSM 70725
ref|XP_003219480.1|  PREDICTED: mitochondrial folate transporter/...    148   1e-38    Anolis carolinensis [Carolina anole]
emb|CEG79270.1|  hypothetical protein RMATCC62417_13755                 147   2e-38    Rhizopus microsporus
gb|KFR01756.1|  Mitochondrial folate transporter/carrier                146   2e-38    Nipponia nippon
gb|KFR13075.1|  Mitochondrial folate transporter/carrier                146   2e-38    Opisthocomus hoazin [hoatzin]
ref|XP_010403479.1|  PREDICTED: mitochondrial folate transporter/...    146   2e-38    
dbj|GAK63323.1|  mitochondrial NAD transporter                          147   2e-38    Moesziomyces antarcticus
ref|XP_009556344.1|  PREDICTED: mitochondrial folate transporter/...    147   2e-38    Cuculus canorus
gb|KFO56811.1|  Mitochondrial folate transporter/carrier                146   2e-38    Corvus brachyrhynchos
ref|XP_010294543.1|  PREDICTED: mitochondrial folate transporter/...    143   3e-38    Phaethon lepturus
gb|KFQ30737.1|  Mitochondrial folate transporter/carrier                145   3e-38    Merops nubicus
ref|XP_009911820.1|  PREDICTED: mitochondrial folate transporter/...    145   3e-38    Haliaeetus albicilla
gb|KFW66445.1|  Mitochondrial folate transporter/carrier                145   3e-38    Pygoscelis adeliae
ref|XP_009321366.1|  PREDICTED: mitochondrial folate transporter/...    145   3e-38    Pygoscelis adeliae
ref|XP_010194050.1|  PREDICTED: mitochondrial folate transporter/...    145   4e-38    Colius striatus
ref|XP_010161870.1|  PREDICTED: mitochondrial folate transporter/...    145   4e-38    
gb|KFM06049.1|  Mitochondrial folate transporter/carrier                145   4e-38    Aptenodytes forsteri
ref|XP_009275444.1|  PREDICTED: mitochondrial folate transporter/...    145   4e-38    Aptenodytes forsteri
gb|KFP15573.1|  Mitochondrial folate transporter/carrier                145   4e-38    Egretta garzetta
gb|KFQ89150.1|  Mitochondrial folate transporter/carrier                145   5e-38    Phoenicopterus ruber ruber
ref|XP_009509434.1|  PREDICTED: mitochondrial folate transporter/...    145   5e-38    Phalacrocorax carbo [common cormorant]
ref|XP_009467694.1|  PREDICTED: mitochondrial folate transporter/...    146   5e-38    Nipponia nippon
gb|KFW78137.1|  Mitochondrial folate transporter/carrier                145   6e-38    Phalacrocorax carbo [common cormorant]
ref|XP_006122490.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    145   6e-38    
ref|XP_009805360.1|  PREDICTED: mitochondrial folate transporter/...    144   6e-38    Gavia stellata
dbj|GAN03363.1|  mitochondrial NAD transporter                          145   6e-38    Mucor ambiguus
ref|XP_010575435.1|  PREDICTED: mitochondrial folate transporter/...    145   6e-38    Haliaeetus leucocephalus
gb|KFP99838.1|  Mitochondrial folate transporter/carrier                145   6e-38    Haliaeetus albicilla
gb|KGL74093.1|  Mitochondrial folate transporter/carrier                145   6e-38    Tinamus guttatus
ref|XP_009874644.1|  PREDICTED: mitochondrial folate transporter/...    144   7e-38    Apaloderma vittatum
gb|KFP92228.1|  Mitochondrial folate transporter/carrier                145   7e-38    Apaloderma vittatum
gb|ETE73913.1|  Mitochondrial folate transporter/carrier                143   7e-38    Ophiophagus hannah
ref|XP_009989131.1|  PREDICTED: mitochondrial folate transporter/...    144   7e-38    Tauraco erythrolophus
ref|XP_010226229.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    145   7e-38    Tinamus guttatus
gb|KFZ46265.1|  Mitochondrial folate transporter/carrier                144   7e-38    Antrostomus carolinensis
gb|KFP24304.1|  Mitochondrial folate transporter/carrier                144   8e-38    Colius striatus
gb|EOB07891.1|  Mitochondrial folate transporter/carrier                144   8e-38    Anas platyrhynchos [duck]
gb|KFV20638.1|  Mitochondrial folate transporter/carrier                144   9e-38    Tauraco erythrolophus
ref|XP_008628941.1|  PREDICTED: mitochondrial folate transporter/...    145   1e-37    
gb|KFP58739.1|  Mitochondrial folate transporter/carrier                144   1e-37    Cathartes aura
emb|CEI99166.1|  hypothetical protein RMCBS344292_13258                 145   1e-37    Rhizopus microsporus
ref|XP_005010651.1|  PREDICTED: mitochondrial folate transporter/...    144   1e-37    
gb|KFV46812.1|  Mitochondrial folate transporter/carrier                144   1e-37    Gavia stellata
ref|XP_006028585.1|  PREDICTED: mitochondrial folate transporter/...    145   1e-37    Alligator sinensis
ref|XP_010294542.1|  PREDICTED: mitochondrial folate transporter/...    144   1e-37    Phaethon lepturus
ref|XP_010123136.1|  PREDICTED: mitochondrial folate transporter/...    142   1e-37    Chlamydotis macqueenii
emb|CEP14775.1|  hypothetical protein                                   145   1e-37    Parasitella parasitica
ref|XP_009636613.1|  PREDICTED: mitochondrial folate transporter/...    144   1e-37    Egretta garzetta
gb|KFQ47188.1|  Mitochondrial folate transporter/carrier                144   1e-37    Nestor notabilis
ref|XP_010010165.1|  PREDICTED: mitochondrial folate transporter/...    144   1e-37    Nestor notabilis
gb|EGA75284.1|  Yea6p                                                   142   1e-37    Saccharomyces cerevisiae AWRI796
ref|XP_010178129.1|  PREDICTED: mitochondrial folate transporter/...    144   1e-37    Mesitornis unicolor
ref|XP_009896510.1|  PREDICTED: mitochondrial folate transporter/...    145   2e-37    Picoides pubescens
gb|KFQ31245.1|  Mitochondrial folate transporter/carrier                144   2e-37    Mesitornis unicolor
gb|KFU96289.1|  Mitochondrial folate transporter/carrier                144   2e-37    Chaetura pelagica
emb|CDH58404.1|  mitochondrial nad transporter                          144   2e-37    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010707505.1|  PREDICTED: mitochondrial folate transporter/...    144   2e-37    
gb|ESA08977.1|  hypothetical protein GLOINDRAFT_81209                   144   2e-37    
gb|KFQ64990.1|  Mitochondrial folate transporter/carrier                143   2e-37    Phaethon lepturus
ref|XP_008922265.1|  PREDICTED: mitochondrial folate transporter/...    143   2e-37    
ref|XP_008939619.1|  PREDICTED: mitochondrial folate transporter/...    145   2e-37    Merops nubicus
gb|KFO04864.1|  Mitochondrial folate transporter/carrier                143   2e-37    Balearica regulorum gibbericeps
ref|XP_007056161.1|  PREDICTED: mitochondrial folate transporter/...    144   2e-37    Chelonia mydas [green seaturtle]
ref|XP_504023.1|  YALI0E16478p                                          144   3e-37    Yarrowia lipolytica CLIB122
gb|KFZ54866.1|  Mitochondrial folate transporter/carrier                143   3e-37    Podiceps cristatus
gb|EMC90650.1|  Mitochondrial folate transporter/carrier                143   3e-37    
ref|XP_009963895.1|  PREDICTED: mitochondrial folate transporter/...    143   3e-37    Tyto alba [Schleiereule]
gb|KFV39451.1|  Mitochondrial folate transporter/carrier                143   3e-37    
ref|XP_010123135.1|  PREDICTED: mitochondrial folate transporter/...    142   4e-37    
ref|XP_005150967.1|  PREDICTED: mitochondrial folate transporter/...    144   4e-37    
gb|KFH65804.1|  hypothetical protein MVEG_07907                         144   4e-37    
gb|KFW81058.1|  Mitochondrial folate transporter/carrier                142   4e-37    
gb|KFV95022.1|  Mitochondrial folate transporter/carrier                141   4e-37    
gb|EHN02815.1|  Yea6p                                                   144   4e-37    
ref|XP_005306075.1|  PREDICTED: mitochondrial folate transporter/...    144   4e-37    
gb|EJT42022.1|  YEA6-like protein                                       144   4e-37    
gb|KFQ60068.1|  Mitochondrial folate transporter/carrier                142   4e-37    
ref|XP_002074979.1|  GK22863                                            144   5e-37    
ref|XP_009478679.1|  PREDICTED: mitochondrial folate transporter/...    142   5e-37    
ref|XP_010154257.1|  PREDICTED: mitochondrial folate transporter/...    141   5e-37    
ref|XP_005499536.1|  PREDICTED: mitochondrial folate transporter/...    143   5e-37    
ref|XP_010083625.1|  PREDICTED: mitochondrial folate transporter/...    142   6e-37    
gb|KFP36899.1|  Mitochondrial folate transporter/carrier                142   6e-37    
gb|KFV02346.1|  Mitochondrial folate transporter/carrier                142   6e-37    
ref|NP_001026677.1|  mitochondrial folate transporter/carrier           143   7e-37    
ref|XP_010046517.1|  PREDICTED: nicotinamide adenine dinucleotide...    143   7e-37    
ref|XP_003690312.1|  PREDICTED: mitochondrial folate transporter/...    143   8e-37    
ref|XP_393549.3|  PREDICTED: mitochondrial folate transporter/car...    143   8e-37    
gb|EGA58942.1|  Yea6p                                                   142   1e-36    
ref|XP_005423554.1|  PREDICTED: mitochondrial folate transporter/...    141   1e-36    
ref|NP_001107692.1|  solute carrier family 25 (mitochondrial fola...    143   1e-36    
gb|KFP07696.1|  Mitochondrial folate transporter/carrier                141   1e-36    
gb|KGL98690.1|  Mitochondrial folate transporter/carrier                141   1e-36    
gb|AAI18860.1|  slc25a32 protein                                        143   1e-36    
gb|ESA23467.1|  hypothetical protein GLOINDRAFT_342148                  139   1e-36    
ref|XP_009699721.1|  PREDICTED: mitochondrial folate transporter/...    141   2e-36    
gb|EPB89321.1|  hypothetical protein HMPREF1544_03830                   142   2e-36    
ref|XP_003668383.1|  hypothetical protein NDAI_0B01060                  144   2e-36    
gb|KFP61001.1|  Mitochondrial folate transporter/carrier                141   2e-36    
gb|KCW86128.1|  hypothetical protein EUGRSUZ_B02821                     141   2e-36    
ref|XP_002199059.2|  PREDICTED: mitochondrial folate transporter/...    142   2e-36    
ref|XP_010300570.1|  PREDICTED: mitochondrial folate transporter/...    142   2e-36    
ref|XP_001652313.1|  AAEL006879-PB                                      142   2e-36    
ref|XP_002682488.1|  predicted protein                                  141   2e-36    
ref|NP_010910.1|  Yea6p                                                 142   2e-36    
gb|EMG49369.1|  hypothetical protein G210_5869                          143   2e-36    
gb|EIE86128.1|  hypothetical protein RO3G_10839                         141   2e-36    
ref|XP_010004831.1|  PREDICTED: mitochondrial folate transporter/...    142   2e-36    
ref|XP_009959383.1|  PREDICTED: mitochondrial folate transporter/...    140   3e-36    
gb|EGA87228.1|  Yea6p                                                   142   3e-36    
ref|XP_007231526.1|  PREDICTED: mitochondrial folate transporter/...    142   3e-36    
gb|KFP96275.1|  Mitochondrial folate transporter/carrier                140   3e-36    
ref|XP_009085652.1|  PREDICTED: mitochondrial folate transporter/...    140   3e-36    
ref|XP_003397569.1|  PREDICTED: mitochondrial folate transporter/...    142   3e-36    
gb|EEU08684.1|  Yea6p                                                   142   3e-36    
ref|XP_008500925.1|  PREDICTED: mitochondrial folate transporter/...    141   3e-36    
gb|KFO94541.1|  Mitochondrial folate transporter/carrier                140   3e-36    
ref|XP_003485771.1|  PREDICTED: mitochondrial folate transporter/...    142   4e-36    
ref|XP_006277397.1|  PREDICTED: mitochondrial folate transporter/...    141   5e-36    
ref|XP_005517030.1|  PREDICTED: mitochondrial folate transporter/...    141   5e-36    
ref|NP_001088720.1|  solute carrier family 25 (mitochondrial fola...    141   6e-36    
dbj|BAB03581.1|  hypothetical protein                                   137   6e-36    
ref|XP_005431890.1|  PREDICTED: mitochondrial folate transporter/...    139   7e-36    
ref|XP_005231089.1|  PREDICTED: mitochondrial folate transporter/...    139   8e-36    
dbj|BAG62417.1|  unnamed protein product                                137   9e-36    
ref|XP_004607837.1|  PREDICTED: mitochondrial folate transporter/...    140   9e-36    
ref|XP_005833561.1|  mitochondrial carrier protein                      140   1e-35    
gb|EXX55163.1|  Flx1p                                                   139   1e-35    
ref|XP_010142128.1|  PREDICTED: mitochondrial folate transporter/...    139   2e-35    
ref|XP_003479882.2|  PREDICTED: mitochondrial folate transporter/...    139   2e-35    
ref|XP_002121509.1|  PREDICTED: mitochondrial folate transporter/...    139   2e-35    
ref|XP_009890211.1|  PREDICTED: mitochondrial folate transporter/...    140   2e-35    
emb|CDS12517.1|  hypothetical protein LRAMOSA04711                      139   2e-35    
ref|XP_457354.2|  DEHA2B09284p                                          140   3e-35    
ref|XP_005479754.1|  PREDICTED: mitochondrial folate transporter/...    139   3e-35    
emb|CDH57170.1|  mitochondrial nad transporter                          138   4e-35    
ref|XP_004541680.1|  PREDICTED: mitochondrial folate transporter/...    139   4e-35    
ref|NP_724769.2|  CG8026, isoform D                                     139   4e-35    
ref|XP_005042476.1|  PREDICTED: mitochondrial folate transporter/...    139   4e-35    
ref|XP_004679731.1|  PREDICTED: mitochondrial folate transporter/...    138   4e-35    
gb|EPB90832.1|  hypothetical protein HMPREF1544_02249                   142   5e-35    
ref|XP_006794856.1|  PREDICTED: mitochondrial folate transporter/...    139   5e-35    
ref|XP_001862889.1|  folate carrier protein                             139   6e-35    
ref|XP_002436273.1|  folate carrier protein, putative                   138   6e-35    
ref|XP_005741333.1|  PREDICTED: mitochondrial folate transporter/...    138   8e-35    
ref|XP_005382053.1|  PREDICTED: mitochondrial folate transporter/...    139   8e-35    
ref|XP_007465375.1|  PREDICTED: mitochondrial folate transporter/...    137   8e-35    
gb|EHH64354.1|  Solute carrier family 25 member 32                      137   8e-35    
ref|XP_010352823.1|  PREDICTED: mitochondrial folate transporter/...    137   9e-35    
ref|XP_002588650.1|  hypothetical protein BRAFLDRAFT_101561             138   9e-35    
ref|XP_002616917.1|  hypothetical protein CLUG_02361                    138   1e-34    
ref|XP_007873372.1|  hypothetical protein PNEG_01432                    136   1e-34    
ref|XP_010980224.1|  PREDICTED: mitochondrial folate transporter/...    137   1e-34    
ref|XP_002759376.1|  PREDICTED: mitochondrial folate transporter/...    137   1e-34    
ref|XP_003256134.1|  PREDICTED: mitochondrial folate transporter/...    137   1e-34    
dbj|BAG54205.1|  unnamed protein product                                137   1e-34    
ref|XP_002710772.1|  PREDICTED: mitochondrial folate transporter/...    137   1e-34    
ref|XP_635668.1|  mitochondrial substrate carrier family protein        137   1e-34    
ref|NP_001253667.1|  mitochondrial folate transporter/carrier           137   2e-34    
gb|KDE08552.1|  hypothetical protein MVLG_01329                         137   2e-34    
gb|KDQ62172.1|  hypothetical protein JAAARDRAFT_30075                   137   2e-34    
emb|CCJ31162.1|  unnamed protein product                                137   2e-34    
dbj|GAM21369.1|  hypothetical protein SAMD00019534_045440               137   2e-34    
ref|XP_004047457.1|  PREDICTED: mitochondrial folate transporter/...    137   2e-34    
gb|AAG37834.1|AF283645_1  folate transporter/carrier                    136   2e-34    
ref|NP_110407.2|  mitochondrial folate transporter/carrier              136   2e-34    
ref|XP_006212220.1|  PREDICTED: mitochondrial folate transporter/...    136   2e-34    
ref|XP_447792.1|  hypothetical protein                                  137   2e-34    
ref|XP_001156320.1|  PREDICTED: mitochondrial folate transporter/...    136   2e-34    
ref|XP_007427666.1|  PREDICTED: mitochondrial folate transporter/...    137   2e-34    
ref|XP_008202006.1|  PREDICTED: mitochondrial folate transporter/...    136   3e-34    
ref|XP_004275362.1|  PREDICTED: mitochondrial folate transporter/...    136   3e-34    
ref|XP_002114406.1|  hypothetical protein TRIADDRAFT_50511              136   3e-34    
ref|XP_007518929.1|  PREDICTED: mitochondrial folate transporter/...    136   3e-34    
ref|XP_007173446.1|  PREDICTED: mitochondrial folate transporter/...    136   3e-34    
gb|EFA76024.1|  mitochondrial substrate carrier family protein          139   4e-34    
emb|CDS04125.1|  hypothetical protein LRAMOSA07080                      135   4e-34    
ref|XP_004311380.1|  PREDICTED: mitochondrial folate transporter/...    135   4e-34    
ref|XP_010347600.1|  PREDICTED: mitochondrial folate transporter/...    136   4e-34    
ref|XP_007119104.1|  PREDICTED: mitochondrial folate transporter/...    135   4e-34    
ref|XP_001494387.1|  PREDICTED: mitochondrial folate transporter/...    135   4e-34    
ref|XP_008849768.1|  PREDICTED: mitochondrial folate transporter/...    135   5e-34    
ref|XP_003674253.1|  hypothetical protein NCAS_0A13150                  137   5e-34    
ref|XP_004663078.1|  PREDICTED: mitochondrial folate transporter/...    135   5e-34    
emb|CDS12124.1|  hypothetical protein LRAMOSA04319                      135   5e-34    
emb|CDH57249.1|  mitochondrial folate transporter carrier-like          135   5e-34    
ref|XP_003453553.1|  PREDICTED: mitochondrial folate transporter/...    135   5e-34    
ref|XP_004903968.1|  PREDICTED: mitochondrial folate transporter/...    135   6e-34    
gb|EHB15026.1|  Mitochondrial folate transporter/carrier                135   6e-34    
ref|XP_004011846.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    135   6e-34    
ref|XP_005689236.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    135   7e-34    
ref|XP_006000467.1|  PREDICTED: mitochondrial folate transporter/...    135   7e-34    
ref|XP_005954634.1|  PREDICTED: mitochondrial folate transporter/...    135   7e-34    
ref|XP_004431295.1|  PREDICTED: mitochondrial folate transporter/...    135   7e-34    
ref|XP_008051082.1|  PREDICTED: mitochondrial folate transporter/...    135   8e-34    
ref|NP_984088.1|  ADL009Wp                                              136   8e-34    
ref|XP_007670953.1|  PREDICTED: mitochondrial folate transporter/...    133   8e-34    
ref|NP_001166805.1|  mitochondrial folate transporter/carrier           135   8e-34    
ref|XP_002295443.1|  hypothetical protein THAPS_38111                   134   9e-34    
ref|XP_004697504.1|  PREDICTED: mitochondrial folate transporter/...    135   9e-34    
ref|XP_006194862.1|  PREDICTED: mitochondrial folate transporter/...    134   9e-34    
ref|XP_004850304.1|  PREDICTED: mitochondrial folate transporter/...    135   9e-34    
gb|EUC63233.1|  NAD transporter                                         135   9e-34    
ref|XP_006065139.1|  PREDICTED: mitochondrial folate transporter/...    135   1e-33    
ref|XP_003782472.1|  PREDICTED: mitochondrial folate transporter/...    135   1e-33    
ref|XP_003583099.1|  PREDICTED: mitochondrial folate transporter/...    135   1e-33    
ref|XP_008544649.1|  PREDICTED: mitochondrial folate transporter/...    135   1e-33    
ref|XP_006957017.1|  mitochondrial NAD transporter                      134   1e-33    
gb|KFM62615.1|  Mitochondrial folate transporter/carrier                135   1e-33    
ref|XP_004580718.1|  PREDICTED: mitochondrial folate transporter/...    134   1e-33    
ref|XP_011153737.1|  PREDICTED: mitochondrial folate transporter/...    134   1e-33    
gb|ACN11492.1|  Mitochondrial folate transporter/carrier                135   1e-33    
gb|EHJ66181.1|  hypothetical protein KGM_13704                          134   1e-33    
ref|XP_003408313.1|  PREDICTED: mitochondrial folate transporter/...    134   1e-33    
emb|CEL62761.1|  Mitochondrial nicotinamide adenine dinucleotide ...    134   1e-33    
ref|XP_004457634.1|  PREDICTED: mitochondrial folate transporter/...    134   1e-33    
dbj|BAB55368.1|  unnamed protein product                                134   2e-33    
ref|XP_007568741.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_003646350.1|  hypothetical protein Ecym_4494                     135   2e-33    
ref|NP_001233717.1|  mitochondrial folate transporter/carrier           134   2e-33    
ref|XP_004077651.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_006093410.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_008322355.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_974708.1|  PREDICTED: mitochondrial folate transporter/car...    134   2e-33    
ref|XP_011340757.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_010954097.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_007901405.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_004000083.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_011340747.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_003903100.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    134   2e-33    
gb|KEQ86445.1|  mitochondrial carrier                                   135   2e-33    
ref|XP_007075878.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_006830688.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
gb|AGO11765.1|  AaceriADL009Wp                                          135   2e-33    
ref|XP_008687456.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_002930488.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
gb|EFB17549.1|  hypothetical protein PANDA_020944                       134   2e-33    
gb|KJA20107.1|  hypothetical protein HYPSUDRAFT_43459                   133   2e-33    
ref|XP_004402379.1|  PREDICTED: mitochondrial folate transporter/...    134   2e-33    
ref|XP_532298.3|  PREDICTED: mitochondrial folate transporter/car...    134   3e-33    
ref|XP_006749459.1|  PREDICTED: mitochondrial folate transporter/...    134   3e-33    
ref|XP_007867010.1|  mitochondrial NAD transporter                      134   3e-33    
ref|XP_004535676.1|  PREDICTED: mitochondrial folate transporter/...    134   3e-33    
ref|XP_005879355.1|  PREDICTED: mitochondrial folate transporter/...    134   3e-33    
ref|XP_010794751.1|  PREDICTED: mitochondrial folate transporter/...    134   3e-33    
ref|XP_008146704.1|  PREDICTED: mitochondrial folate transporter/...    133   3e-33    
ref|XP_007932989.1|  PREDICTED: mitochondrial folate transporter/...    133   3e-33    
ref|XP_010735261.1|  PREDICTED: mitochondrial folate transporter/...    134   3e-33    
dbj|BAB41176.1|  hypothetical protein                                   133   4e-33    
ref|XP_002547687.1|  conserved hypothetical protein                     134   4e-33    
ref|XP_008277393.1|  PREDICTED: mitochondrial folate transporter/...    133   4e-33    
ref|XP_010610432.1|  PREDICTED: mitochondrial folate transporter/...    135   4e-33    
ref|XP_006636156.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    134   4e-33    
ref|XP_003481414.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    133   4e-33    
ref|XP_011103950.1|  YIL006W                                            134   4e-33    
ref|XP_004768920.1|  PREDICTED: mitochondrial folate transporter/...    133   4e-33    
ref|XP_005807557.1|  PREDICTED: mitochondrial folate transporter/...    133   4e-33    
ref|XP_011153736.1|  PREDICTED: mitochondrial folate transporter/...    133   5e-33    
ref|XP_011264048.1|  PREDICTED: mitochondrial folate transporter/...    133   5e-33    
ref|XP_003683366.1|  hypothetical protein TDEL_0H02960                  134   5e-33    
ref|XP_006760330.1|  PREDICTED: mitochondrial folate transporter/...    133   6e-33    
ref|NP_956550.1|  mitochondrial folate transporter/carrier              133   6e-33    
ref|NP_765990.2|  mitochondrial folate transporter/carrier              132   6e-33    
ref|XP_002836831.1|  hypothetical protein                               132   6e-33    
gb|KFK43463.1|  hypothetical protein AALP_AA1G128600                    130   7e-33    
ref|XP_007738192.1|  hypothetical protein A1O3_09911                    133   7e-33    
ref|XP_011166360.1|  PREDICTED: mitochondrial folate transporter/...    133   7e-33    
ref|XP_007768692.1|  mitochondrial NAD transporter                      133   8e-33    
emb|CCG84512.1|  protein of unknown function                            133   8e-33    
ref|XP_002418843.1|  mitochondrial NAD+ transporter, putative           133   8e-33    
emb|CCE44804.1|  hypothetical protein CPAR2_406070                      134   8e-33    
emb|CEP60397.1|  LALA0S01e09824g1_1                                     134   8e-33    
ref|XP_005367594.1|  PREDICTED: mitochondrial folate transporter/...    132   8e-33    
ref|XP_006982885.1|  PREDICTED: mitochondrial folate transporter/...    132   8e-33    
ref|XP_007404089.1|  hypothetical protein MELLADRAFT_46330              133   9e-33    
ref|XP_008539342.1|  PREDICTED: mitochondrial folate transporter/...    134   9e-33    
ref|XP_008430084.1|  PREDICTED: mitochondrial folate transporter/...    132   9e-33    
ref|XP_003959601.1|  hypothetical protein KAFR_0K01110                  132   1e-32    
ref|XP_001361631.3|  GA20774, isoform B                                 132   1e-32    
ref|XP_010897303.1|  PREDICTED: mitochondrial folate transporter/...    132   1e-32    
ref|XP_005103524.1|  PREDICTED: mitochondrial folate transporter/...    132   1e-32    
gb|KIJ17919.1|  hypothetical protein PAXINDRAFT_167842                  132   1e-32    
ref|XP_007725598.1|  hypothetical protein A1O1_06530                    133   1e-32    
ref|XP_011290425.1|  PREDICTED: mitochondrial folate transporter/...    132   1e-32    
ref|XP_002732491.1|  PREDICTED: mitochondrial folate transporter/...    132   1e-32    
gb|KIW52609.1|  hypothetical protein PV05_08239                         133   2e-32    
ref|XP_007758640.1|  hypothetical protein A1O7_06448                    132   2e-32    
ref|XP_783090.1|  PREDICTED: mitochondrial folate transporter/car...    131   2e-32    



>ref|XP_011007801.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Populus euphratica]
Length=322

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWVV TRLQTQGMR G VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  137  TIFTNPLWVVKTRLQTQGMRVGVVPYRSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA  196

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFPTYEKIK+YLA+RDNT+MDKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG H
Sbjct  197  IQFPTYEKIKMYLASRDNTAMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHH  256

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            SEKRYSGV+DC++KVFQQEG+PGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV++ PPD
Sbjct  257  SEKRYSGVVDCIKKVFQQEGLPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLSPPD  316

Query  231  PQPQPL  214
            PQPQ L
Sbjct  317  PQPQTL  322


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 90/176 (51%), Gaps = 10/176 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVA  592
            L V+ TR Q  G+         ++G+L  S+L +I + EG+RG+Y GL P  LA + + A
Sbjct  39   LDVIKTRFQVHGLPKLDVAANSFKGSLIISSLEQIFQREGLRGMYRGLSPTVLALLPNWA  98

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  YE++K +L + D      LS     +A+S +    +  T P  VV++RLQ QG+ 
Sbjct  99   VYFTIYEQLKSFLCSNDEG--HHLSIGANMIAASGAGAVTTIFTNPLWVVKTRLQTQGMR  156

Query  411  -SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                 Y   +  +R++  +EGI G Y G    L   +  A I F ++E I  +L S
Sbjct  157  VGVVPYRSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKMYLAS  211



>ref|XP_002302737.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE82010.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=322

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMRAG VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  138  IFTNPLWVVKTRLQTQGMRAGVVPYRSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  197

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK+YLA RDNT+MDKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  198  QFPTYEKIKMYLATRDNTAMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  257

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV+DC++KVFQQEG+PGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV++ PPDP
Sbjct  258  EKRYSGVVDCIKKVFQQEGLPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLSPPDP  317

Query  228  QPQPL  214
            QPQ L
Sbjct  318  QPQTL  322


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 91/176 (52%), Gaps = 10/176 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVA  592
            L V+ TR Q  G+         ++G+L  S+L +I R EG+RG+Y GL P  LA + + A
Sbjct  39   LDVIKTRFQVHGLPKLDVAANSFKGSLIVSSLEQIFRREGLRGMYRGLAPTVLALLPNWA  98

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  YE++K +L + D      LS     +A+S +    +  T P  VV++RLQ QG+ 
Sbjct  99   VYFTIYEQLKSFLCSNDEG--HHLSIGANMIAASGAGAVTAIFTNPLWVVKTRLQTQGMR  156

Query  411  SEKR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
            +    Y   +  +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  157  AGVVPYRSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKMYLAT  211



>ref|XP_009594055.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=315

 Score =   320 bits (819),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQG+RAG  PYRGTLSALRRIA EEGIRGLYSGLVPALAGVSHVAI
Sbjct  131  IATNPLWVVKTRLQTQGIRAGLEPYRGTLSALRRIACEEGIRGLYSGLVPALAGVSHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIKIYLA RDNTS DKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  191  QFPTYEKIKIYLAKRDNTSTDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQGRHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGVIDC++KVF QEGI GFYRGCATNLIRTTPAAVITFTSFEMIHRFLV++FPPDP
Sbjct  251  EKRYSGVIDCIKKVFHQEGIQGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLFPPDP  310

Query  228  QPQPL  214
             P PL
Sbjct  311  HPHPL  315


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 95/172 (55%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ + G    RG+L   +L +I + EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPKLGNANVRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K +L + D +   +LS     +A+S +    +  T P  VV++RLQ QG+ + 
Sbjct  94   FTIYEQLKSFLGSDDGS--HQLSIGANMLAASGAGAATTIATNPLWVVKTRLQTQGIRAG  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             + Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  LEPYRGTLSALRRIACEEGIRGLYSGLVPALAGVSHVA-IQFPTYEKIKIYL  202



>gb|KJB06734.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
Length=227

 Score =   315 bits (806),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMRAG VPYRGT SALRRIA EEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  45   TNPLWVVKTRLQTQGMRAGVVPYRGTFSALRRIAHEEGIRGLYSGLVPALAGISHVAIQF  104

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            PTYEKIK YLAN+DNT MDKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEK
Sbjct  105  PTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEK  164

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSGV+DC+RKVFQQEG  GFYRGCATNL+RTTPAAVITFTSFEM+HRFLV++FP DPQP
Sbjct  165  RYSGVVDCIRKVFQQEGFAGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVNLFPSDPQP  224

Query  222  QPL  214
              L
Sbjct  225  HTL  227



>ref|XP_009784346.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AHI58944.1| chloroplast nicotinamide adenine dinucleotide transporter 1 [Nicotiana 
tabacum]
Length=315

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGM+AG  PYRGTLSALRRIA EEGIRGLYSGLVPALAGVSHVAI
Sbjct  131  IATNPLWVVKTRLQTQGMKAGLEPYRGTLSALRRIACEEGIRGLYSGLVPALAGVSHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIKIYLA RDNTS DKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  191  QFPTYEKIKIYLAKRDNTSTDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQGRHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGVIDC++KVF QEGI GFYRGCATNLIRTTPAAVITFTSFEMIHRFLV++FP DP
Sbjct  251  EKRYSGVIDCIKKVFHQEGIQGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLFPADP  310

Query  228  QPQPL  214
             P PL
Sbjct  311  HPHPL  315


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 95/172 (55%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ + G    RG+L   +L +I + EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPKIGTANVRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K +L + D +   +LS     +A+S +    +  T P  VV++RLQ QG+ + 
Sbjct  94   FTIYEQLKSFLGSDDGS--HQLSIGANMLAASGAGAATTIATNPLWVVKTRLQTQGMKAG  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             + Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  LEPYRGTLSALRRIACEEGIRGLYSGLVPALAGVSHVA-IQFPTYEKIKIYL  202



>gb|KJB06735.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
 gb|KJB06736.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
 gb|KJB06738.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
Length=241

 Score =   314 bits (804),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMRAG VPYRGT SALRRIA EEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  59   TNPLWVVKTRLQTQGMRAGVVPYRGTFSALRRIAHEEGIRGLYSGLVPALAGISHVAIQF  118

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            PTYEKIK YLAN+DNT MDKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEK
Sbjct  119  PTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEK  178

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSGV+DC+RKVFQQEG  GFYRGCATNL+RTTPAAVITFTSFEM+HRFLV++FP DPQP
Sbjct  179  RYSGVVDCIRKVFQQEGFAGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVNLFPSDPQP  238

Query  222  QPL  214
              L
Sbjct  239  HTL  241



>gb|KDP28207.1| hypothetical protein JCGZ_13978 [Jatropha curcas]
Length=312

 Score =   316 bits (810),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMR G VPYRGTLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  128  IFTNPLWVVKTRLQTQGMREGVVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVAI  187

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFP YE IKIYLANRDNTS DKLSA +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  188  QFPAYETIKIYLANRDNTSADKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  247

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV+DC++KVFQQ+G+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLV++FPPDP
Sbjct  248  EKRYSGVVDCIKKVFQQDGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPPDP  307

Query  228  QPQPL  214
             P  L
Sbjct  308  HPHTL  312


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 91/173 (53%), Gaps = 9/173 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQF  583
            L V+ TR Q  G+       +G+L   +L +I R EG+RG+Y GL P  LA + + A+ F
Sbjct  34   LDVIKTRFQVHGL-PKHRNIKGSLIVGSLEQIFRREGLRGMYRGLGPTVLALLPNWAVYF  92

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-HSE  406
              YE++K +L++ D    + LS     +A+S +    +  T P  VV++RLQ QG+    
Sbjct  93   SIYEQLKSFLSSNDE---NHLSIGANVIAASGAGAATTIFTNPLWVVKTRLQTQGMREGV  149

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
              Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  150  VPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPAYETIKIYLAN  201



>gb|KHG29129.1| Mitochondrial nicotinamide adenine dinucleotide transporter 1 
[Gossypium arboreum]
Length=315

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMRAG VPYRGT SALRRIAREEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  133  TNPLWVVKTRLQTQGMRAGVVPYRGTFSALRRIAREEGIRGLYSGLVPALAGISHVAIQF  192

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            PTYEKIK YLAN+DNT MDKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEK
Sbjct  193  PTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEK  252

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSGV+DC+RKVFQQEG  GFYRGCATNL+RTTPAAVITFTSFEM+HRFLV++FP DPQP
Sbjct  253  RYSGVVDCIRKVFQQEGFAGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVNLFPSDPQP  312

Query  222  QPL  214
              L
Sbjct  313  HTL  315


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 93/174 (53%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ + G    R +L   +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPKLGNSTIRRSLIVGSLEQIFQKEGLRGMYRGLAPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L + D     +LS     +A+S +    +  T P  VV++RLQ QG+ + 
Sbjct  94   FTMYEQLKDCLCSNDGK--HQLSVGANMLAASGAGAATTCFTNPLWVVKTRLQTQGMRAG  151

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y G    +R++ ++EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  152  VVPYRGTFSALRRIAREEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKCYLAN  204



>ref|XP_010326568.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Solanum lycopersicum]
Length=313

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR GF PYRGTLSALRRIA EEGIRGLYSGLVPALAGVSHVAI
Sbjct  129  IATNPLWVVKTRLQTQGMRTGFEPYRGTLSALRRIAYEEGIRGLYSGLVPALAGVSHVAI  188

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIKIYLA R NTS DKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  189  QFPTYEKIKIYLAKRANTSTDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQGRHS  248

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV+DC++KVF QEGI GFYRGCATNLIRTTPAAVITFTSFEMIHRFLV++FPPDP
Sbjct  249  EKRYSGVVDCIKKVFHQEGITGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTMFPPDP  308

Query  228  QPQPL  214
             P  L
Sbjct  309  HPHTL  313


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 94/172 (55%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ + G    RG+L    L  I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  32   LDVIKTRLQVHGLPKLGNANVRGSLIVGNLEHIFQKEGLRGMYRGLSPTVLALLPNWAVY  91

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y+++K +L + D +   +L+     +A+S +    +  T P  VV++RLQ QG+ + 
Sbjct  92   FTIYDQLKRFLGSDDGS--HQLTIGANMLAASGAGAATTIATNPLWVVKTRLQTQGMRTG  149

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             + Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  150  FEPYRGTLSALRRIAYEEGIRGLYSGLVPALAGVSHVA-IQFPTYEKIKIYL  200



>ref|XP_002320327.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE98642.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=322

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMRAG VPYR TLSALRRIA EEG+RGLYSGLVPALAGVSHVAI
Sbjct  138  IFTNPLWVVKTRLQTQGMRAGIVPYRSTLSALRRIAHEEGMRGLYSGLVPALAGVSHVAI  197

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK+YLA R NT+MDKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  198  QFPTYEKIKMYLATRGNTTMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGFHS  257

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV+DC+ KVFQQEG+PGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV++F PDP
Sbjct  258  EKRYSGVVDCINKVFQQEGLPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLFLPDP  317

Query  228  QPQPL  214
            QP  L
Sbjct  318  QPHTL  322


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 89/176 (51%), Gaps = 10/176 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVA  592
            L V+ TR Q  G+          +G+L   +L +I R EG+RG+Y GL P  LA + + A
Sbjct  39   LDVIKTRFQVHGLPKYDVATSSIKGSLIVGSLEQIFRREGLRGMYRGLAPTVLAMLPNWA  98

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  YE+ K +L + D +    LS     +A+S +    +  T P  VV++RLQ QG+ 
Sbjct  99   VYFTIYEQFKSFLCSNDES--HHLSIGANMIAASGAGAATTIFTNPLWVVKTRLQTQGMR  156

Query  411  SE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
            +    Y   +  +R++  +EG+ G Y G    L   +  A I F ++E I  +L +
Sbjct  157  AGIVPYRSTLSALRRIAHEEGMRGLYSGLVPALAGVSHVA-IQFPTYEKIKMYLAT  211



>ref|XP_006359875.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Solanum tuberosum]
Length=316

 Score =   314 bits (805),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR GF PYRGTLSALRRIA EEGIRGLYSGLVPALAGVSHVAI
Sbjct  132  IATNPLWVVKTRLQTQGMRTGFEPYRGTLSALRRIAYEEGIRGLYSGLVPALAGVSHVAI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIKIYLA R NTS DKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  192  QFPTYEKIKIYLAKRANTSTDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  251

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV+DC++KVF QEG+ GFYRGCATNLIRTTPAAVITFTSFEMIHRFLV++FPPDP
Sbjct  252  EKRYSGVVDCIKKVFHQEGMTGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTMFPPDP  311

Query  228  QPQPL  214
             P  L
Sbjct  312  HPHTL  316


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 94/172 (55%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ + G    RG+L    L  I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  35   LDVIKTRLQVHGLPKLGNANVRGSLIVGNLEHIFQKEGLRGMYRGLSPTVLALLPNWAVY  94

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y+++K +L + D +   +L+     +A+S +    +  T P  VV++RLQ QG+ + 
Sbjct  95   FTIYDQLKRFLGSDDGS--HQLTIGANMLAASGAGAATTIATNPLWVVKTRLQTQGMRTG  152

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             + Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  153  FEPYRGTLSALRRIAYEEGIRGLYSGLVPALAGVSHVA-IQFPTYEKIKIYL  203



>gb|KJB06737.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
Length=317

 Score =   314 bits (804),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMRAG VPYRGT SALRRIA EEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  135  TNPLWVVKTRLQTQGMRAGVVPYRGTFSALRRIAHEEGIRGLYSGLVPALAGISHVAIQF  194

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            PTYEKIK YLAN+DNT MDKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEK
Sbjct  195  PTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEK  254

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSGV+DC+RKVFQQEG  GFYRGCATNL+RTTPAAVITFTSFEM+HRFLV++FP DPQP
Sbjct  255  RYSGVVDCIRKVFQQEGFAGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVNLFPSDPQP  314

Query  222  QPL  214
              L
Sbjct  315  HTL  317


 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 92/173 (53%), Gaps = 8/173 (5%)
 Frame = -2

Query  750  WVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQF  583
            +V+ TRLQ  G+ + G    R +L   +L +I ++EG+RG+Y GL P  LA + + A+ F
Sbjct  37   YVIKTRLQVHGLPKLGNATIRRSLIVGSLEQIFQKEGLRGMYRGLAPTVLALLPNWAVYF  96

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
              YE++K  L + D     +LS     +A+S +    +  T P  VV++RLQ QG+ +  
Sbjct  97   TMYEQLKDCLCSNDGK--HQLSVGANMLAASGAGAATTCFTNPLWVVKTRLQTQGMRAGV  154

Query  402  R-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
              Y G    +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  155  VPYRGTFSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKCYLAN  206



>gb|KJB06733.1| hypothetical protein B456_001G141500 [Gossypium raimondii]
Length=315

 Score =   314 bits (804),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMRAG VPYRGT SALRRIA EEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  133  TNPLWVVKTRLQTQGMRAGVVPYRGTFSALRRIAHEEGIRGLYSGLVPALAGISHVAIQF  192

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            PTYEKIK YLAN+DNT MDKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEK
Sbjct  193  PTYEKIKCYLANQDNTPMDKLGARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEK  252

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSGV+DC+RKVFQQEG  GFYRGCATNL+RTTPAAVITFTSFEM+HRFLV++FP DPQP
Sbjct  253  RYSGVVDCIRKVFQQEGFAGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVNLFPSDPQP  312

Query  222  QPL  214
              L
Sbjct  313  HTL  315


 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 92/174 (53%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ + G    R +L   +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPKLGNATIRRSLIVGSLEQIFQKEGLRGMYRGLAPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L + D     +LS     +A+S +    +  T P  VV++RLQ QG+ + 
Sbjct  94   FTMYEQLKDCLCSNDGK--HQLSVGANMLAASGAGAATTCFTNPLWVVKTRLQTQGMRAG  151

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y G    +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  152  VVPYRGTFSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKCYLAN  204



>gb|KDO87106.1| hypothetical protein CISIN_1g021150mg [Citrus sinensis]
Length=241

 Score =   311 bits (797),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFPTY  574
            LWVV TRLQTQGM+AG VPYR TLSAL RIA+EEGIRGLYSGLVPALAG+SHVAIQFPTY
Sbjct  62   LWVVKTRLQTQGMKAGVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVAIQFPTY  121

Query  573  EKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKRYS  394
            EKIK++LA++ NTSMDKLSA +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEKRYS
Sbjct  122  EKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYS  181

Query  393  GVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQPQPL  214
            GV+DC++KVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FPPDPQP  L
Sbjct  182  GVVDCIKKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPPDPQPHTL  241



>gb|KEH24421.1| substrate carrier family protein [Medicago truncatula]
Length=220

 Score =   310 bits (794),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            T+ TN LWVV TRLQTQGMR+G VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  35   TLFTNPLWVVKTRLQTQGMRSGVVPYRSTLSALRRIASEEGIRGLYSGLVPALAGISHVA  94

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YE IK YLAN+D+ ++DKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG H
Sbjct  95   IQFPMYETIKFYLANQDDAAVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHH  154

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            SEKRYSG+IDC+RKVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FP D
Sbjct  155  SEKRYSGMIDCIRKVFQQEGVPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSHFPSD  214

Query  231  PQPQPL  214
            PQP  L
Sbjct  215  PQPHIL  220



>ref|XP_010103406.1| Mitochondrial substrate carrier family protein W [Morus notabilis]
 gb|EXB95725.1| Mitochondrial substrate carrier family protein W [Morus notabilis]
Length=315

 Score =   313 bits (803),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPYR TLSAL RIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRLQTQGMRPGVVPYRSTLSALSRIAHEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE+IK+YLA+R+NT+MDKLSA +VA+ASS+SKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  191  QFPTYERIKLYLADRENTTMDKLSARDVAIASSISKIFASTLTYPHEVVRSRLQEQGHHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV DCV+KVFQQ+G+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FP DP
Sbjct  251  EKRYSGVADCVKKVFQQDGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSSFPSDP  310

Query  228  QPQPL  214
            QP  L
Sbjct  311  QPHTL  315


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L +I R+EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGIPTLNHGNIKGSLIVGSLEQIFRKEGLRGMYRGLAPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE++K  L + D     +LS     +A+S +       T P  VV++RLQ QG+   
Sbjct  94   FSMYEQLKSLLCSDDE--HHQLSVGANVIAASCAGAATIIATNPLWVVKTRLQTQGMRPG  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  + ++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  VVPYRSTLSALSRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYERIKLYL  202



>ref|XP_007163152.1| hypothetical protein PHAVU_001G210600g [Phaseolus vulgaris]
 gb|ESW35146.1| hypothetical protein PHAVU_001G210600g [Phaseolus vulgaris]
Length=318

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQG+R+G VPYRGTLSALRRIA EEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  136  TNPLWVVKTRLQTQGIRSGVVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVAIQF  195

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            PTYE IK YLAN+D+T+MDKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HSE+
Sbjct  196  PTYETIKFYLANQDDTAMDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHSER  255

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSGVIDC+RKVFQQEGI GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS+FP DPQP
Sbjct  256  RYSGVIDCIRKVFQQEGISGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSLFPSDPQP  315

Query  222  QPL  214
              L
Sbjct  316  HIL  318


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 94/174 (54%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G   +  G V     + +L +I R+EG+RG+Y GL P  LA + + A+ 
Sbjct  37   LDVIKTRFQVHGVPQLTNGSVKGSIIVGSLEQIFRKEGLRGMYRGLAPTVLALLPNWAVY  96

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F TYE++K +L + D++    LS  +  +A+S +    +  T P  VV++RLQ QG+ S 
Sbjct  97   FSTYEQLKSFLHSDDDS--HHLSIGSNMIAASGAGAATTMFTNPLWVVKTRLQTQGIRSG  154

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  155  VVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYETIKFYLAN  207



>emb|CDP17096.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 172/183 (94%), Gaps = 1/183 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G +PYRGTLSALRRIA EEGIRGLYSGLVPALAG+SHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGMRNGVMPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKR  400
             YEKIK+YLANR+NT+MDKL+A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEKR
Sbjct  195  AYEKIKLYLANRENTTMDKLTARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGRHSEKR  254

Query  399  YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV-SVFPPDPQP  223
            YSGV+DC++KVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFL+ ++FPPDPQ 
Sbjct  255  YSGVVDCIKKVFQQEGVPGFYRGCATNLVRTTPAAVITFTSFEMIHRFLINNLFPPDPQR  314

Query  222  QPL  214
             PL
Sbjct  315  HPL  317


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 94/174 (54%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ +      +G++   +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  35   LDVIKTRLQVHGLPKLAGANIKGSIIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVY  94

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L + D  +  +LS     +A++ +    +  T P  VV++RLQ QG+ + 
Sbjct  95   FTIYEQLKSLLCS-DGVN-HQLSIGANMLAATGAGAATTIATNPLWVVKTRLQTQGMRNG  152

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  153  VMPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPAYEKIKLYLAN  205



>gb|KEH24420.1| substrate carrier family protein [Medicago truncatula]
Length=241

 Score =   310 bits (793),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            T+ TN LWVV TRLQTQGMR+G VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  56   TLFTNPLWVVKTRLQTQGMRSGVVPYRSTLSALRRIASEEGIRGLYSGLVPALAGISHVA  115

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YE IK YLAN+D+ ++DKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG H
Sbjct  116  IQFPMYETIKFYLANQDDAAVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHH  175

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            SEKRYSG+IDC+RKVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FP D
Sbjct  176  SEKRYSGMIDCIRKVFQQEGVPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSHFPSD  235

Query  231  PQPQPL  214
            PQP  L
Sbjct  236  PQPHIL  241



>ref|XP_007200447.1| hypothetical protein PRUPE_ppa008929mg [Prunus persica]
 gb|EMJ01646.1| hypothetical protein PRUPE_ppa008929mg [Prunus persica]
Length=313

 Score =   311 bits (797),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  132  IATNPLWVVKTRLQTQGMRPGVVPYRSTLSALRRIAHEEGIRGLYSGLVPALAGISHVAI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLANRDNT++DKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  192  QFPTYEKIKFYLANRDNTTVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHS  251

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            EKRYSGV+DC+RKVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLV++FPP
Sbjct  252  EKRYSGVVDCIRKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPP  309


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 89/174 (51%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ R G    +G+L    L +I  +EG+RG+Y GL P  LA + + A+ 
Sbjct  35   LDVIKTRLQVHGLPRLGNGNVKGSLIVGYLEQIFHKEGLRGMYRGLSPTVLALLPNWAVY  94

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y+++K +L + D      L      +A+S +    +  T P  VV++RLQ QG+   
Sbjct  95   FTIYDQLKNFLCSDDEN--HHLPVGANMLAASGAGAATTIATNPLWVVKTRLQTQGMRPG  152

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  153  VVPYRSTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKFYLAN  205



>ref|XP_011041851.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Populus euphratica]
Length=322

 Score =   311 bits (796),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMRAG VPYR TLSALRRIA EEG+RGLYSGL+PALAGVSHVAI
Sbjct  138  IFTNPLWVVKTRLQTQGMRAGIVPYRSTLSALRRIAHEEGMRGLYSGLIPALAGVSHVAI  197

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK+YLA R NT+MDKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  198  QFPTYEKIKMYLAARGNTTMDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGFHS  257

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV+DC+ KVFQQEG+ GFYRGCATNLIRTTPAAVITFTSFEMIHRFLV++F PDP
Sbjct  258  EKRYSGVVDCINKVFQQEGLLGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVTLFLPDP  317

Query  228  QPQPL  214
            QP  L
Sbjct  318  QPHTL  322


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 89/176 (51%), Gaps = 10/176 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVA  592
            L V+ TR Q  G+          +G+L   +L +I R EG+RG+Y GL P  LA + + A
Sbjct  39   LDVIKTRFQVHGLPKYDVATSSIKGSLIVGSLEQIFRREGLRGMYRGLSPTVLALLPNWA  98

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  YE+ K +L + D +    LS     +A+S +    +  T P  VV++RLQ QG+ 
Sbjct  99   VYFTIYEQFKSFLCSNDES--HHLSIGANMIAASGAGAATTIFTNPLWVVKTRLQTQGMR  156

Query  411  SE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
            +    Y   +  +R++  +EG+ G Y G    L   +  A I F ++E I  +L +
Sbjct  157  AGIVPYRSTLSALRRIAHEEGMRGLYSGLIPALAGVSHVA-IQFPTYEKIKMYLAA  211



>gb|KHN43485.1| Mitochondrial substrate carrier family protein W [Glycine soja]
Length=240

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMR G VPYRGTLSALRRIA EEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  58   TNPLWVVKTRLQTQGMRPGVVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVAIQF  117

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            PTYE IK YLAN+D+T+M+KL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HSEK
Sbjct  118  PTYETIKFYLANQDDTAMEKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHSEK  177

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSGVIDC+RKVF QEG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FP DP+P
Sbjct  178  RYSGVIDCIRKVFHQEGVSGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPSDPRP  237

Query  222  QPL  214
              L
Sbjct  238  HIL  240



>gb|KDO87105.1| hypothetical protein CISIN_1g021150mg [Citrus sinensis]
Length=315

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFPTY  574
            LWVV TRLQTQGM+AG VPYR TLSAL RIA+EEGIRGLYSGLVPALAG+SHVAIQFPTY
Sbjct  136  LWVVKTRLQTQGMKAGVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVAIQFPTY  195

Query  573  EKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKRYS  394
            EKIK++LA++ NTSMDKLSA +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEKRYS
Sbjct  196  EKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYS  255

Query  393  GVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQPQPL  214
            GV+DC++KVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FPPDPQP  L
Sbjct  256  GVVDCIKKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPPDPQPHTL  315


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 89/174 (51%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+     G V     + +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPKLTNGTVKGSLIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K +L + D      LS     +A++V+    +  T P  VV++RLQ QG+ + 
Sbjct  94   FTMYEQLKSFLCSEDKN--HHLSVGANVIAAAVAGAATTIATNPLWVVKTRLQTQGMKAG  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  + ++ Q+EGI G Y G    L   +  A I F ++E I   L  
Sbjct  152  VVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKMHLAD  204



>ref|XP_006444424.1| hypothetical protein CICLE_v10024227mg [Citrus clementina]
 gb|ESR57664.1| hypothetical protein CICLE_v10024227mg [Citrus clementina]
Length=319

 Score =   310 bits (795),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFPTY  574
            LWVV TRLQTQGM+AG VPYR TLSAL RIA+EEGIRGLYSGLVPALAG+SHVAIQFPTY
Sbjct  140  LWVVKTRLQTQGMKAGVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVAIQFPTY  199

Query  573  EKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKRYS  394
            EKIK++LA++ NTSMDKLSA +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEKRYS
Sbjct  200  EKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYS  259

Query  393  GVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQPQPL  214
            GV+DC++KVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FPPDPQP  L
Sbjct  260  GVVDCIKKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPPDPQPHTL  319


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 86/176 (49%), Gaps = 12/176 (7%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+     G V     + +L +I ++EG+RG+Y GL P  LA + + AI 
Sbjct  34   LDVIKTRLQVHGLPKLTNGTVKGSLIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAIA  93

Query  585  ----FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
                     ++K +L + D      LS     +A++V+    +  T P  VV++RLQ QG
Sbjct  94   ELFILQCTSRLKSFLCSEDKN--HHLSVGANVIAAAVAGAATTIATNPLWVVKTRLQTQG  151

Query  417  LHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            + +    Y   +  + ++ Q+EGI G Y G    L   +  A I F ++E I   L
Sbjct  152  MKAGVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKMHL  206



>ref|XP_008451527.1| PREDICTED: LOW QUALITY PROTEIN: nicotinamide adenine dinucleotide 
transporter 1, chloroplastic-like [Cucumis melo]
Length=311

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGM++G +PYR T+SAL+RIA EEGIRGLYSGLVPALAGVSHVAI
Sbjct  127  IATNPLWVVKTRLQTQGMKSGVLPYRNTVSALKRIASEEGIRGLYSGLVPALAGVSHVAI  186

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK YLA+RDNT+ DKL+A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  187  QFPTYEXIKSYLASRDNTTTDKLTARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGFHS  246

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV DCV+KVFQQ+G+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLV++FPPDP
Sbjct  247  EKRYSGVADCVKKVFQQDGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVNLFPPDP  306

Query  228  QPQPL  214
             P  L
Sbjct  307  HPHTL  311


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 91/174 (52%), Gaps = 12/174 (7%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+   G    +G+L   +L++I  +EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLPNIG----KGSLIVGSLQQIFHKEGLRGMYRGLAPTVLALLPNWAVY  89

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y ++K +L + D     +LS     +A+S +    +  T P  VV++RLQ QG+ S 
Sbjct  90   FTIYGQLKTFLGSDDEHC--QLSIGANMMAASGAGAATTIATNPLWVVKTRLQTQGMKSG  147

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  ++++  +EGI G Y G    L   +  A I F ++E I  +L S
Sbjct  148  VLPYRNTVSALKRIASEEGIRGLYSGLVPALAGVSHVA-IQFPTYEXIKSYLAS  200



>ref|XP_002273574.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Vitis vinifera]
 emb|CBI36905.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY  TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRLQTQGMRAGVVPYSSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK+YLA+R+NT+MDKL A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  191  QFPTYEKIKMYLASRENTTMDKLGAPDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV+DC++KV QQEG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFLV++ PPDP
Sbjct  251  EKRYSGVVDCIKKVLQQEGLAGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVNLLPPDP  310

Query  228  QPQPL  214
             P  L
Sbjct  311  HPHTL  315


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 93/174 (53%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLPQLGNGNIKGSLIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K +L + D     +LS     +A+  +    +  T P  VV++RLQ QG+ + 
Sbjct  94   FTIYEQLKSFLCSNDEN--HQLSIGANMIAACGAGAATTIATNPLWVVKTRLQTQGMRAG  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               YS  +  +R++  +EGI G Y G    L   +  A I F ++E I  +L S
Sbjct  152  VVPYSSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKMYLAS  204



>ref|XP_008235160.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Prunus mume]
Length=313

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  132  IATNPLWVVKTRLQTQGMRPGVVPYRSTLSALRRIAHEEGIRGLYSGLVPALAGISHVAI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLAN+DNT++DKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  192  QFPTYEKIKFYLANQDNTTVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHS  251

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            EKRYSGV+DC+RKVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLV++FPP
Sbjct  252  EKRYSGVVDCIRKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPP  309


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 90/174 (52%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ R G    +G+L    L +I  +EG+RG+Y GL P  LA + + A+ 
Sbjct  35   LDVIKTRLQVHGLPRLGNGNVKGSLIVGYLEQIFHKEGLRGMYRGLSPTVLALLPNWAVY  94

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y+++K +L + D +    L      +A+S +    +  T P  VV++RLQ QG+   
Sbjct  95   FTIYDQLKNFLCSDDES--HHLPIGANMLAASGAGAATTIATNPLWVVKTRLQTQGMRPG  152

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  153  VVPYRSTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKFYLAN  205



>gb|KEH24418.1| substrate carrier family protein [Medicago truncatula]
Length=319

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            T+ TN LWVV TRLQTQGMR+G VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  134  TLFTNPLWVVKTRLQTQGMRSGVVPYRSTLSALRRIASEEGIRGLYSGLVPALAGISHVA  193

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YE IK YLAN+D+ ++DKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG H
Sbjct  194  IQFPMYETIKFYLANQDDAAVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHH  253

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            SEKRYSG+IDC+RKVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FP D
Sbjct  254  SEKRYSGMIDCIRKVFQQEGVPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSHFPSD  313

Query  231  PQPQPL  214
            PQP  L
Sbjct  314  PQPHIL  319


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 89/173 (51%), Gaps = 7/173 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQ--GMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQF  583
            L V+ TR Q     +  G V     +++L++I  +EG+RG+Y GL P  LA + + A+ F
Sbjct  39   LDVIKTRFQVGVPQLANGTVKGSVIVASLQQIFHKEGLRGMYRGLAPTVLALLPNWAVYF  98

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
              YE++K  L + D +    LS  +  VA++ +    +  T P  VV++RLQ QG+ S  
Sbjct  99   TMYEQLKSLLHSDDES--HHLSVGSNMVAAAGAGAATTLFTNPLWVVKTRLQTQGMRSGV  156

Query  402  R-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
              Y   +  +R++  +EGI G Y G    L   +  A I F  +E I  +L +
Sbjct  157  VPYRSTLSALRRIASEEGIRGLYSGLVPALAGISHVA-IQFPMYETIKFYLAN  208



>ref|XP_004136010.1| PREDICTED: mitochondrial substrate carrier family protein W-like 
[Cucumis sativus]
 ref|XP_004162441.1| PREDICTED: mitochondrial substrate carrier family protein W-like 
[Cucumis sativus]
 gb|KGN44980.1| hypothetical protein Csa_7G405860 [Cucumis sativus]
Length=311

 Score =   310 bits (793),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGM++G +PYR T+SAL+RIA EEGIRGLYSGLVPALAGVSHVAI
Sbjct  127  IATNPLWVVKTRLQTQGMKSGVLPYRNTVSALKRIASEEGIRGLYSGLVPALAGVSHVAI  186

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLA RDNT+ DKL+A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  187  QFPTYEKIKSYLARRDNTTTDKLTARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGFHS  246

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV DCV+KVFQQ+G+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFL ++FPPDP
Sbjct  247  EKRYSGVADCVKKVFQQDGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLANLFPPDP  306

Query  228  QPQPL  214
             P  L
Sbjct  307  HPHTL  311


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 91/172 (53%), Gaps = 12/172 (7%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G+   G    +G+L   +L++I  +EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLPNIG----KGSLIVGSLQQIFHKEGLRGMYRGLAPTVLALLPNWAVY  89

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y ++K +LA+  +    +LS     +A+S +    +  T P  VV++RLQ QG+ S 
Sbjct  90   FTIYGQLKTFLAS--DHEHCQLSIGANMMAASGAGAATTIATNPLWVVKTRLQTQGMKSG  147

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  ++++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  148  VLPYRNTVSALKRIASEEGIRGLYSGLVPALAGVSHVA-IQFPTYEKIKSYL  198



>ref|XP_004494928.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like, 
partial [Cicer arietinum]
Length=312

 Score =   309 bits (792),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMR G VPYR TL+ALRRIA EEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  130  TNPLWVVKTRLQTQGMRPGIVPYRSTLTALRRIAHEEGIRGLYSGLVPALAGISHVAIQF  189

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            P YEKIK YLAN+D+T++DKL A +VA+ASSVSKIFASTMTYPHEVVRSRLQEQG HSEK
Sbjct  190  PMYEKIKFYLANQDDTAVDKLGARDVAIASSVSKIFASTMTYPHEVVRSRLQEQGHHSEK  249

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSG+IDC+RKVFQQEG+ GFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS FP DPQP
Sbjct  250  RYSGMIDCIRKVFQQEGVAGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSHFPSDPQP  309

Query  222  QPL  214
              L
Sbjct  310  HIL  312


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 92/174 (53%), Gaps = 7/174 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G++  ++L++I  +EG+RG+Y GL P  LA + + A+ 
Sbjct  30   LDVIKTRFQVHGVPQFGNRSVKGSIIVASLKQIFHKEGLRGMYRGLAPTVLALLPNWAVY  89

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE++K  L + D+ S   LS     VA+S +    +  T P  VV++RLQ QG+   
Sbjct  90   FTMYEQLK-SLLHSDDESHHHLSVGANMVAASGAGAATTLFTNPLWVVKTRLQTQGMRPG  148

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  +R++  +EGI G Y G    L   +  A I F  +E I  +L +
Sbjct  149  IVPYRSTLTALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPMYEKIKFYLAN  201



>ref|XP_003521580.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Glycine max]
 gb|KHN20379.1| Mitochondrial nicotinamide adenine dinucleotide transporter 2 
[Glycine soja]
Length=317

 Score =   309 bits (791),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQG+R G VPYRGTLSALRRIA EEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  135  TNPLWVVKTRLQTQGIRPGVVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVAIQF  194

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            PTYE IK YLAN+D+ +MDKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HSEK
Sbjct  195  PTYETIKFYLANQDDAAMDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHSEK  254

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSGVIDC+RKVFQQEG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS+FP DP+P
Sbjct  255  RYSGVIDCIRKVFQQEGVQGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSLFPSDPRP  314

Query  222  QPL  214
              L
Sbjct  315  HIL  317


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 88/174 (51%), Gaps = 9/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G   +  G V     +++L +I  +EG+RG+Y GL P  LA + + A+ 
Sbjct  37   LDVIKTRFQVHGVPQLAHGSVKGSIIVASLEQIFHKEGLRGMYRGLAPTVLALLPNWAVY  96

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE++K  L + D+     L      +A+S +    +  T P  VV++RLQ QG+   
Sbjct  97   FSAYEQLKSLLHSDDS---HHLPIGANVIAASGAGAATTMFTNPLWVVKTRLQTQGIRPG  153

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  154  VVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYETIKFYLAN  206



>ref|XP_003554533.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Glycine max]
Length=317

 Score =   308 bits (790),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMR G VPYRGTLSALRRIA EEGIRGLYSGLVPALAG+SHVAIQF
Sbjct  135  TNPLWVVKTRLQTQGMRPGVVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVAIQF  194

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            PTYE IK YLAN+D+T+M+KL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HSEK
Sbjct  195  PTYETIKFYLANQDDTAMEKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHSEK  254

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQP  223
            RYSGVIDC+RKVF QEG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FP DP+P
Sbjct  255  RYSGVIDCIRKVFHQEGVSGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPSDPRP  314

Query  222  QPL  214
              L
Sbjct  315  HIL  317


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 91/174 (52%), Gaps = 9/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ +      +G++  ++L ++  +EG+RG+Y GL P  LA + + A+ 
Sbjct  37   LDVIKTRFQVHGVPQLAHRSAKGSIIVASLEQVFHKEGLRGMYRGLAPTVLALLPNWAVY  96

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE++K  L + D+     LS     +A+S +    +  T P  VV++RLQ QG+   
Sbjct  97   FSAYEQLKSLLQSDDS---HHLSIGANMIAASGAGAATTMFTNPLWVVKTRLQTQGMRPG  153

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  154  VVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYETIKFYLAN  206



>ref|XP_010259427.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=245

 Score =   305 bits (782),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TR QTQG R G VPYRGTLSALRRIA EEGIRGLYSGLVPALAG+SHVAIQFP
Sbjct  64   NPLWVVKTRFQTQGTRGGVVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVAIQFP  123

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKR  400
            TYEKIKIYLA RD T+ D LSA +VAVASSVSKI AST+TYPHEVVRSRLQEQG HSEKR
Sbjct  124  TYEKIKIYLAKRDKTTTDTLSARDVAVASSVSKIAASTLTYPHEVVRSRLQEQGHHSEKR  183

Query  399  YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQPQ  220
            YSGVIDC++KVFQ+EGIPGFYRGCATNL+RTTPAAVITFTSFEMIHRFLV++FPP+PQP 
Sbjct  184  YSGVIDCIKKVFQKEGIPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPPEPQPH  243

Query  219  PL  214
             L
Sbjct  244  TL  245



>ref|XP_006480018.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Citrus sinensis]
Length=315

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFPTY  574
            LWVV TRLQTQGM+A  VPYR TLSAL RIA+EEGIRGLYSGLVPALAG+SHVAIQFPTY
Sbjct  136  LWVVKTRLQTQGMKAVVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVAIQFPTY  195

Query  573  EKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKRYS  394
            EKIK++LA++ NTSMDKLSA +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEKRYS
Sbjct  196  EKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYS  255

Query  393  GVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQPQPL  214
            GV+DC++KVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FPPDPQP  L
Sbjct  256  GVVDCIKKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPPDPQPHTL  315


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 89/172 (52%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+     G V     + +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPKLTNGTVKGSLIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS-  409
            F  YE++K +L + D      LS     +A++V+    +  T P  VV++RLQ QG+ + 
Sbjct  94   FTMYEQLKSFLCSEDKN--HHLSVGANVIAAAVAGAATTIATNPLWVVKTRLQTQGMKAV  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  + ++ Q+EGI G Y G    L   +  A I F ++E I   L
Sbjct  152  VVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKMHL  202



>gb|KDO87104.1| hypothetical protein CISIN_1g021150mg [Citrus sinensis]
Length=316

 Score =   306 bits (783),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  753  LWVVXTRLQ-TQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFPT  577
            LWVV TRLQ TQGM+AG VPYR TLSAL RIA+EEGIRGLYSGLVPALAG+SHVAIQFPT
Sbjct  136  LWVVKTRLQQTQGMKAGVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVAIQFPT  195

Query  576  YEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKRY  397
            YEKIK++LA++ NTSMDKLSA +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HSEKRY
Sbjct  196  YEKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRY  255

Query  396  SGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQPQP  217
            SGV+DC++KVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FPPDPQP  
Sbjct  256  SGVVDCIKKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPPDPQPHT  315

Query  216  L  214
            L
Sbjct  316  L  316


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 90/175 (51%), Gaps = 9/175 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+     G V     + +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPKLTNGTVKGSLIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQE-QGLHS  409
            F  YE++K +L + D      LS     +A++V+    +  T P  VV++RLQ+ QG+ +
Sbjct  94   FTMYEQLKSFLCSEDKN--HHLSVGANVIAAAVAGAATTIATNPLWVVKTRLQQTQGMKA  151

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                Y   +  + ++ Q+EGI G Y G    L   +  A I F ++E I   L  
Sbjct  152  GVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKMHLAD  205



>ref|XP_007051022.1| NAD+ transporter 1 [Theobroma cacao]
 gb|EOX95179.1| NAD+ transporter 1 [Theobroma cacao]
Length=308

 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMR G VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IFTNPLWVVKTRLQTQGMRVGVVPYRSTLSALRRIAHEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK+YLA++DNT+MDKLSA +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  191  QFPTYEKIKLYLADKDNTTMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
            EKRYSGV+DC+RKVFQQEG+ GFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  FP
Sbjct  251  EKRYSGVVDCIRKVFQQEGVAGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVKYFP  307


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 90/174 (52%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I R+EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLPKLGNGAVKGSLIVGSLEQIFRKEGLRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE++K +L +  N     LS     +A+S +    +  T P  VV++RLQ QG+   
Sbjct  94   FTMYEQLKDFLCS--NNENHHLSIGANMLAASGAGAATTIFTNPLWVVKTRLQTQGMRVG  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  +R++  +EGI G Y G    L   +  A I F ++E I  +L  
Sbjct  152  VVPYRSTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKLYLAD  204



>gb|EYU46767.1| hypothetical protein MIMGU_mgv1a010350mg [Erythranthe guttata]
Length=315

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWVV TR QTQGMR G VPY GTLSALRRIA++EGIRGLYSGLVPALAG+SHVA
Sbjct  130  TILTNPLWVVKTRFQTQGMRIGTVPYTGTLSALRRIAQKEGIRGLYSGLVPALAGISHVA  189

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFPTYEKIK  LA+RDNT+ DKLSA +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG H
Sbjct  190  IQFPTYEKIKCTLADRDNTTTDKLSAGHVALASSVSKIFASTLTYPHEVVRSRLQEQGHH  249

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            SEKRYSGV+DCV+KVFQQEG+ GFYRGCATNL+RTTPAAVITFTSFEMIHR L  +FPPD
Sbjct  250  SEKRYSGVVDCVKKVFQQEGMTGFYRGCATNLLRTTPAAVITFTSFEMIHRSLTDLFPPD  309

Query  231  PQPQ  220
            P PQ
Sbjct  310  PHPQ  313


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 90/168 (54%), Gaps = 8/168 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+ +      +G++   +L +I  +EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPQIANANIKGSVIVGSLEQIFHKEGLRGMYRGLAPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y+++K  LA  D     +LS     +A+S +    + +T P  VV++R Q QG+   
Sbjct  94   FTIYDQLKSSLAADDVN--HQLSVGANMMAASGAGAVTTILTNPLWVVKTRFQTQGMRIG  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMI  265
               Y+G +  +R++ Q+EGI G Y G    L   +  A I F ++E I
Sbjct  152  TVPYTGTLSALRRIAQKEGIRGLYSGLVPALAGISHVA-IQFPTYEKI  198



>ref|XP_011079611.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Sesamum indicum]
Length=317

 Score =   305 bits (780),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFPTY  574
            LWV+ TRLQTQGMR G VPYR TLS L+RIA EEGIRGLYSGLVPALAG+SHV IQFPTY
Sbjct  136  LWVIKTRLQTQGMRKGVVPYRSTLSGLKRIAHEEGIRGLYSGLVPALAGISHVGIQFPTY  195

Query  573  EKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKRYS  394
            EKIK +LA+RDNT+ DKLSAS+VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HSEKRYS
Sbjct  196  EKIKSHLADRDNTTTDKLSASDVALASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYS  255

Query  393  GVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQPQPL  214
            GV+DC++KVFQQEGI GFYRGCATNL+RTTPAAVITFTSFEMIHRFLV++FPPDP PQ L
Sbjct  256  GVVDCIKKVFQQEGISGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPPDPHPQTL  315

Query  213  *G  208
             G
Sbjct  316  SG  317


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 85/174 (49%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ +      +G++   +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLPQLPNAKVKGSVIVGSLEQIFQKEGLRGMYRGLAPTVLAMLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y+++K  L   D     +L      +A++ +    +  T P  V+++RLQ QG+   
Sbjct  94   FTIYDQLKSSLGADDVN--HQLPLGANMMAAAGAGAATTIATNPLWVIKTRLQTQGMRKG  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  ++++  +EGI G Y G    L   +    I F ++E I   L  
Sbjct  152  VVPYRSTLSGLKRIAHEEGIRGLYSGLVPALAGISHVG-IQFPTYEKIKSHLAD  204



>ref|XP_010259426.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=315

 Score =   304 bits (779),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TR QTQG R G VPYRGTLSALRRIA EEGIRGLYSGLVPALAG+SHVAIQFP
Sbjct  134  NPLWVVKTRFQTQGTRGGVVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVAIQFP  193

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKR  400
            TYEKIKIYLA RD T+ D LSA +VAVASSVSKI AST+TYPHEVVRSRLQEQG HSEKR
Sbjct  194  TYEKIKIYLAKRDKTTTDTLSARDVAVASSVSKIAASTLTYPHEVVRSRLQEQGHHSEKR  253

Query  399  YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQPQ  220
            YSGVIDC++KVFQ+EGIPGFYRGCATNL+RTTPAAVITFTSFEMIHRFLV++FPP+PQP 
Sbjct  254  YSGVIDCIKKVFQKEGIPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTLFPPEPQPH  313

Query  219  PL  214
             L
Sbjct  314  TL  315


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 87/172 (51%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G+   G    +G+L   +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGIPNLGGGTTKGSLIVRSLEQIFQKEGVRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L   D     +LS     +A++ +    +  T P  VV++R Q QG    
Sbjct  94   FTMYEQLKGLLYTDDGN--HQLSVGANMIAAAGAGAATTIATNPLWVVKTRFQTQGTRGG  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  VVPYRGTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKIYL  202



>ref|XP_002523136.1| mitochondrial carrier protein, putative [Ricinus communis]
 gb|EEF39321.1| mitochondrial carrier protein, putative [Ricinus communis]
Length=314

 Score =   304 bits (778),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMR+G VPYRGTLSALRRIA  EGIRGLYSGL+PALAG+SHVAI
Sbjct  130  IFTNPLWVVKTRLQTQGMRSGVVPYRGTLSALRRIAHVEGIRGLYSGLLPALAGISHVAI  189

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLAN+DNT+MDKLSA +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  190  QFPTYEKIKFYLANQDNTTMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  249

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV+DC++KVFQQ+G+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFLV+ + PD 
Sbjct  250  EKRYSGVVDCIKKVFQQDGLQGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVTRYSPDS  309

Query  228  QPQPL  214
             P  L
Sbjct  310  HPHTL  314


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 88/174 (51%), Gaps = 9/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+     G +     + +L +I + EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLPKLDNGTIKGSLIVGSLEQIFQREGLRGMYRGLAPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE+ K +L++      + LS     +A+S +    +  T P  VV++RLQ QG+ S 
Sbjct  94   FTMYEQFKSFLSSNGE---NHLSVGANMIAASGAGAATTIFTNPLWVVKTRLQTQGMRSG  150

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y G +  +R++   EGI G Y G    L   +  A I F ++E I  +L +
Sbjct  151  VVPYRGTLSALRRIAHVEGIRGLYSGLLPALAGISHVA-IQFPTYEKIKFYLAN  203



>ref|XP_010905688.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=315

 Score =   301 bits (771),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TR QTQGMR G VPY+GTL+ALRRIA EEGIRGLYSG+VPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRFQTQGMRVGVVPYQGTLNALRRIAHEEGIRGLYSGIVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLA RDNT+++ L A +VAVASSVSKI AST+TYPHEVVRSRLQEQG HS
Sbjct  191  QFPTYEKIKTYLAKRDNTTINSLGAGDVAVASSVSKIAASTLTYPHEVVRSRLQEQGFHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            E RY+GVIDC++KVFQ+EGIPGFYRGCATNL+RTTPAAVITFTSFEMIHRFL+++FPP+ 
Sbjct  251  EMRYTGVIDCIKKVFQEEGIPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLITLFPPEQ  310

Query  228  QPQPL  214
             P  L
Sbjct  311  HPHTL  315


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 90/172 (52%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+   +   V     + +L +I R+EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLPSLKNSTVKGSLIIGSLEQIVRKEGVRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE++K  L + D +   +LS  +  +A+S +    +  T P  VV++R Q QG+   
Sbjct  94   FTVYEQLKSLLCSDDGSG--RLSVGDNMIAASGAGAATTIATNPLWVVKTRFQTQGMRVG  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G ++ +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  VVPYQGTLNALRRIAHEEGIRGLYSGIVPALAGISHVA-IQFPTYEKIKTYL  202



>ref|XP_008807764.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Phoenix dactylifera]
Length=315

 Score =   301 bits (770),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TR QTQGMR G VPY+GTL+ALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRFQTQGMRGGVVPYQGTLNALRRIAHEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLA RDNT+++ LSA +VAVASSVSKI AST+TYPHEVVRSRLQEQG HS
Sbjct  191  QFPTYEKIKTYLAKRDNTTINSLSAGDVAVASSVSKIAASTLTYPHEVVRSRLQEQGFHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            E RY GVIDC++KV Q+EGIPGFYRGCATNL+RTTPAAVITFTSFEMIHRFL+++FPP+ 
Sbjct  251  EMRYMGVIDCIKKVLQEEGIPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLITLFPPEQ  310

Query  228  QPQPL  214
             P  L
Sbjct  311  HPHTL  315


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 92/172 (53%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRA-GFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ +      +G+L   +L +I R+EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLASLKNSSVKGSLIIGSLEQIVRKEGVRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L + D +   +LS  +  +A+S +    +  T P  VV++R Q QG+   
Sbjct  94   FTVYEQLKSLLCSDDGS--HQLSVGHNMIAASGAGAATTIATNPLWVVKTRFQTQGMRGG  151

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G ++ +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  VVPYQGTLNALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKTYL  202



>ref|XP_010684596.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=312

 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TR QTQGMR G VPY+ TLSALRRIA+EEGIRGLYSGLVPALAG+SHVAI
Sbjct  128  IVTNPLWVVKTRFQTQGMRKGVVPYKSTLSALRRIAQEEGIRGLYSGLVPALAGISHVAI  187

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFP YE++K YLAN+D T++DK+ A +VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  188  QFPIYEQVKSYLANKDETAIDKIPARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  247

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRY GVIDCVRKVFQQEG+ GFYRGCATNL+RTTPAAVITFTSFEMIHR LV VF PD 
Sbjct  248  EKRYLGVIDCVRKVFQQEGMSGFYRGCATNLLRTTPAAVITFTSFEMIHRSLVDVFNPDT  307

Query  228  QPQPL  214
            QP  L
Sbjct  308  QPHAL  312


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 90/174 (52%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRA-GFVPYRG--TLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ + G    +G   +S+L +I  +EG+RG+Y GL P  LA + + A+ 
Sbjct  31   LDVIKTRLQVHGLSSLGNGAAKGGVIVSSLNQIFHKEGLRGMYRGLSPTVLALLPNWAVY  90

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L + D     +LS     +A+S +      +T P  VV++R Q QG+   
Sbjct  91   FTMYEQLKSLLGSDDGR--HQLSVGANVIAASGAGAATVIVTNPLWVVKTRFQTQGMRKG  148

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  +R++ Q+EGI G Y G    L   +  A I F  +E +  +L +
Sbjct  149  VVPYKSTLSALRRIAQEEGIRGLYSGLVPALAGISHVA-IQFPIYEQVKSYLAN  201



>gb|AES61717.2| substrate carrier family protein [Medicago truncatula]
Length=312

 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN  WVV TRLQTQGMR G VPYR TLSAL+RIA EEGIRG+YSGLVPALAG+SHVAI
Sbjct  132  MVTNPFWVVKTRLQTQGMRPGVVPYRSTLSALKRIAHEEGIRGMYSGLVPALAGISHVAI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK +LAN+DNT++DKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  192  QFPTYEKIKFHLANQDNTTVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHS  251

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSG+ DC+RKVFQQEG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS+ P DP
Sbjct  252  EKRYSGMTDCIRKVFQQEGLSGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSLSPSDP  311

Query  228  Q  226
            Q
Sbjct  312  Q  312


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 89/170 (52%), Gaps = 13/170 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVA  592
            L V+ TR Q  G   +  G V  RG+L   +L +I  +EG+RG+Y GL P  LA + + A
Sbjct  36   LDVIKTRFQVHGTPQLANGSV--RGSLIVGSLGQIYHKEGMRGMYRGLAPTVLALLPNWA  93

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            I F  YE++K  L+N ++     LS     VA+S +    + +T P  VV++RLQ QG+ 
Sbjct  94   IYFTMYEQLKRLLSNDES---HHLSVGANVVAASGAGAATTMVTNPFWVVKTRLQTQGMR  150

Query  411  -SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMI  265
                 Y   +  ++++  +EGI G Y G    L   +  A I F ++E I
Sbjct  151  PGVVPYRSTLSALKRIAHEEGIRGMYSGLVPALAGISHVA-IQFPTYEKI  199



>ref|XP_010559180.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010559181.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010559195.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010559196.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
Length=315

 Score =   297 bits (760),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAHEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIKIYLA + NT+ DKLSA +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  191  QFPTYEKIKIYLAKKGNTTTDKLSARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRY+GV DC++KVFQ++G+ GFYRGCATNL+RTTPAAVITFTSFEMI RFLVS  P DP
Sbjct  251  EKRYTGVRDCIKKVFQKDGLSGFYRGCATNLLRTTPAAVITFTSFEMIRRFLVSHLPSDP  310

Query  228  QPQPL  214
             P  L
Sbjct  311  HPHTL  315


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 92/172 (53%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L  I ++EG+RGLY GL P+ +A + + A+ 
Sbjct  34   LDVIKTRFQVHGLPKLGDGSVKGSLIVGSLEHIFKKEGMRGLYRGLSPSVMALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y+++K +L + D     KLS     +A+S +    +  T P  VV++RLQ QG+ + 
Sbjct  94   FTMYDQLKSFLCSNDED--HKLSVGANMIAASGAGAATTIATNPLWVVKTRLQTQGMRAG  151

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  VVPYKSTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKIYL  202



>gb|KEH24419.1| substrate carrier family protein [Medicago truncatula]
Length=312

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 163/186 (88%), Gaps = 7/186 (4%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            T+ TN LW       TQGMR+G VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  134  TLFTNPLW-------TQGMRSGVVPYRSTLSALRRIASEEGIRGLYSGLVPALAGISHVA  186

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YE IK YLAN+D+ ++DKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG H
Sbjct  187  IQFPMYETIKFYLANQDDAAVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHH  246

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            SEKRYSG+IDC+RKVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FP D
Sbjct  247  SEKRYSGMIDCIRKVFQQEGVPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSHFPSD  306

Query  231  PQPQPL  214
            PQP  L
Sbjct  307  PQPHIL  312



>ref|XP_006654293.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like, 
partial [Oryza brachyantha]
Length=324

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 166/188 (88%), Gaps = 2/188 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TIATN LWVV TR QTQG+RAG +PY+ TLSAL+RIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  135  TIATNPLWVVKTRFQTQGIRAGVIPYKSTLSALKRIAHEEGIRGLYSGLVPALAGISHVA  194

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQEQG H
Sbjct  195  IQFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQEQGAH  254

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP--  238
            SE RY GV+DC+RKV+ +EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+ VFP  
Sbjct  255  SEARYKGVMDCIRKVYHKEGVTGFYRGCATNLLRTTPAAVITFTSFEMIHRFLLDVFPPF  314

Query  237  PDPQPQPL  214
            PD +PQPL
Sbjct  315  PDQRPQPL  322


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 88/172 (51%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G   +  G       + +L++IA+ EG RG+Y GL P  LA + + A+ 
Sbjct  39   LDVIKTRFQVHGWPKITTGTFGGSVIIGSLQQIAQREGFRGMYRGLSPTILALLPNWAVY  98

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L++ D +   +LS     +A+S +    +  T P  VV++R Q QG+ + 
Sbjct  99   FTVYEQLKSLLSSDDGS--HQLSLGANVIAASCAGGATTIATNPLWVVKTRFQTQGIRAG  156

Query  405  K-RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  ++++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  157  VIPYKSTLSALKRIAHEEGIRGLYSGLVPALAGISHVA-IQFPAYEKIKAYL  207



>ref|XP_004495929.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Cicer arietinum]
Length=317

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN  WVV TRLQTQGMR G VPYR TLSAL+RIA EEGIRG+YSGLVPALAG+SHVAI
Sbjct  133  VVTNPFWVVKTRLQTQGMRPGVVPYRNTLSALKRIACEEGIRGMYSGLVPALAGISHVAI  192

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE+IK +LAN+DNT++DKL A +VA+ASSVSK FAST+TYPHEVVR+RLQEQG HS
Sbjct  193  QFPTYERIKFHLANKDNTTVDKLGARDVAIASSVSKFFASTLTYPHEVVRARLQEQGHHS  252

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            EKRYSGV DC+RKVFQQEG+ GFYRGCA NL+RTTPAAVITFTSFEMI RFLVS+ P D 
Sbjct  253  EKRYSGVSDCIRKVFQQEGLSGFYRGCAINLLRTTPAAVITFTSFEMIQRFLVSLSPSDQ  312

Query  228  QPQPL  214
            QP  L
Sbjct  313  QPHNL  317


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 84/168 (50%), Gaps = 8/168 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G   +  G V     + +L +I  +EG+RG+Y GL P  LA + + A+ 
Sbjct  36   LDVIKTRFQVHGSLQLANGTVKGSLIVGSLEQIYHKEGLRGMYRGLAPTVLALLPNWAVY  95

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE++K  L + D      LS     +A+S +    + +T P  VV++RLQ QG+   
Sbjct  96   FTVYEQLKSLLCSDDKN--HHLSVGANVIAASGAGAATTVVTNPFWVVKTRLQTQGMRPG  153

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMI  265
               Y   +  ++++  +EGI G Y G    L   +  A I F ++E I
Sbjct  154  VVPYRNTLSALKRIACEEGIRGMYSGLVPALAGISHVA-IQFPTYERI  200



>ref|XP_010518453.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X4 [Camelina sativa]
Length=253

 Score =   286 bits (731),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  70   IATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  129

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  130  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  189

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  190  EKRYSGVRDCIKKVFEKDGYPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  248


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 76/142 (54%), Gaps = 15/142 (11%)
 Frame = -2

Query  669  RIAREEGIRGLYSGLVP-ALAGVSHVAIQFPTYEKIKIYLANRDNTSMD-KLsasnvava  496
            +I ++EG+RGLY GL P  +A +S+ A        +K +L ++D   +D KLS     +A
Sbjct  12   KIFKKEGMRGLYRGLSPTVMALLSNWA--------LKSFLCSKD---VDRKLSVGANVLA  60

Query  495  ssvSKIFASTMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATN  319
            +S +    +  T P  VV++RLQ QG+ +    Y   +  +R++  +EGI G Y G    
Sbjct  61   ASGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPA  120

Query  318  LIRTTPAAVITFTSFEMIHRFL  253
            L   +  A I F ++EMI  +L
Sbjct  121  LAGISHVA-IQFPTYEMIKVYL  141



>gb|KFK37525.1| hypothetical protein AALP_AA4G268400 [Arabis alpina]
Length=314

 Score =   288 bits (737),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPY+GTLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRLQTQGMREGIVPYKGTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IKIYLA + N S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  191  QFPTYEMIKIYLAKKGNKSIDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF ++G+PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  251  EKRYSGVRDCIKKVFAKDGLPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  309


 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 92/172 (53%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I +EEG RGLY GL P  +A +S+ A+ 
Sbjct  34   LDVIKTRFQVHGLPKLGPANIKGSLIVGSLEKIFKEEGTRGLYRGLSPTVMALLSNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y++ K +L + D     KLS     +A+S +    +  T P  VV++RLQ QG+   
Sbjct  94   FTLYDQFKSFLISNDED--HKLSVGANVMAASGAGAATTIATNPLWVVKTRLQTQGMREG  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G +  +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  152  IVPYKGTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKIYL  202



>ref|XP_010518452.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=261

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  78   IATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  137

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  138  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  197

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  198  EKRYSGVRDCIKKVFEKDGYPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  256


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 79/141 (56%), Gaps = 5/141 (4%)
 Frame = -2

Query  669  RIAREEGIRGLYSGLVP-ALAGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavas  493
            +I ++EG+RGLY GL P  +A +S+ AI F  Y+++K +L ++D     KLS     +A+
Sbjct  12   KIFKKEGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSKDVDR--KLSVGANVLAA  69

Query  492  svSKIFASTMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNL  316
            S +    +  T P  VV++RLQ QG+ +    Y   +  +R++  +EGI G Y G    L
Sbjct  70   SGAGAATTIATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPAL  129

Query  315  IRTTPAAVITFTSFEMIHRFL  253
               +  A I F ++EMI  +L
Sbjct  130  AGISHVA-IQFPTYEMIKVYL  149



>ref|XP_009414905.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=315

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TR Q Q +R G VPY+GTL++LRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRFQAQELRVGTVPYQGTLNSLRRIAHEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLA +DNT++D L+A +VAVASS+SKI AST+TYPHEVVRS+LQEQG H+
Sbjct  191  QFPTYEKIKSYLAEQDNTTVDSLTARDVAVASSISKIVASTLTYPHEVVRSKLQEQGFHA  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            E RY GVIDC++KVF++EGIPGFY GCATNL+RTTPAAVITFTSFEMIHRFL+++FPP+ 
Sbjct  251  EMRYKGVIDCIKKVFRKEGIPGFYHGCATNLLRTTPAAVITFTSFEMIHRFLINLFPPES  310

Query  228  QPQPL  214
             P  L
Sbjct  311  HPHTL  315


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 88/172 (51%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+    +  V     + +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLPKICSNGVKGSVIIGSLEQILKKEGVRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE++K +L++ D     +LS      A+S +    +  T P  VV++R Q Q L   
Sbjct  94   FTVYEQLKSFLSSNDGN--HQLSIGANMFAASGAGAATTIATNPLWVVKTRFQAQELRVG  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G ++ +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  TVPYQGTLNSLRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKSYL  202



>ref|XP_009414904.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=316

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TR Q Q +R G VPY+GTL++LRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  132  IATNPLWVVKTRFQAQELRVGTVPYQGTLNSLRRIAHEEGIRGLYSGLVPALAGISHVAI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLA +DNT++D L+A +VAVASS+SKI AST+TYPHEVVRS+LQEQG H+
Sbjct  192  QFPTYEKIKSYLAEQDNTTVDSLTARDVAVASSISKIVASTLTYPHEVVRSKLQEQGFHA  251

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            E RY GVIDC++KVF++EGIPGFY GCATNL+RTTPAAVITFTSFEMIHRFL+++FPP+ 
Sbjct  252  EMRYKGVIDCIKKVFRKEGIPGFYHGCATNLLRTTPAAVITFTSFEMIHRFLINLFPPES  311

Query  228  QPQPL  214
             P  L
Sbjct  312  HPHTL  316


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 90/177 (51%), Gaps = 17/177 (10%)
 Frame = -2

Query  753  LWVVXTRLQTQGM--------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVS  601
            L V+ TR Q  G+        +AG V     + +L +I ++EG+RG+Y GL P  LA + 
Sbjct  34   LDVIKTRFQVHGLPKICSNGVKAGSV----IIGSLEQILKKEGVRGMYRGLSPTVLALLP  89

Query  600  HVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ  421
            + A+ F  YE++K +L++ D     +LS      A+S +    +  T P  VV++R Q Q
Sbjct  90   NWAVYFTVYEQLKSFLSSNDGN--HQLSIGANMFAASGAGAATTIATNPLWVVKTRFQAQ  147

Query  420  GLH-SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             L      Y G ++ +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  148  ELRVGTVPYQGTLNSLRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKSYL  203



>gb|EPS67920.1| hypothetical protein M569_06852 [Genlisea aurea]
Length=316

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN LWVV TRLQTQG+  G V YR TLSALRRI REEG RGLYSG++PALAG+SHVAI
Sbjct  132  LVTNPLWVVKTRLQTQGLIEGVVRYRSTLSALRRIVREEGFRGLYSGIIPALAGISHVAI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLA+RDNT+MDKLSA +VA+ASSVSKIFAST+TYPHEVVRSRLQ QG HS
Sbjct  192  QFPTYEKIKTYLAHRDNTTMDKLSAGDVALASSVSKIFASTLTYPHEVVRSRLQAQGQHS  251

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            E+ YSGV+DC+ K+F +EG+PGFYRGCATNL+RTTPAAVITFTSFEMIHR LV+VFPPD 
Sbjct  252  EELYSGVVDCIGKIFLKEGVPGFYRGCATNLLRTTPAAVITFTSFEMIHRALVAVFPPDS  311

Query  228  QPQPL  214
                L
Sbjct  312  HHHAL  316


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 90/172 (52%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+ +      +G+  L +L +I ++EG RG+Y GL P  +A + + A+ 
Sbjct  35   LDVIKTRLQVHGLPQLTNANIKGSIILGSLEQIVQKEGFRGMYRGLSPTIIALLPNWAVY  94

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-HS  409
            F  Y+++K YL   D     +L      +A+S +    + +T P  VV++RLQ QGL   
Sbjct  95   FTVYDQLKSYLGADDIN--HQLPVGANMIAASGAGAATTLVTNPLWVVKTRLQTQGLIEG  152

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              RY   +  +R++ ++EG  G Y G    L   +  A I F ++E I  +L
Sbjct  153  VVRYRSTLSALRRIVREEGFRGLYSGIIPALAGISHVA-IQFPTYEKIKTYL  203



>ref|XP_002439632.1| hypothetical protein SORBIDRAFT_09g017280 [Sorghum bicolor]
 gb|EES18062.1| hypothetical protein SORBIDRAFT_09g017280 [Sorghum bicolor]
Length=340

 Score =   287 bits (734),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWVV TR QTQG+RAG +PY+GTL+ALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  151  TIVTNPLWVVKTRFQTQGIRAGSIPYKGTLAALRRIAHEEGIRGLYSGLVPALAGISHVA  210

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQ+Q  H
Sbjct  211  IQFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQRAH  270

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            S+ RY GVIDC+RKV+ +EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+ +FP +
Sbjct  271  SDARYKGVIDCIRKVYHKEGVAGFYRGCATNLLRTTPAAVITFTSFEMIHRFLIDLFPAE  330

Query  231  PQPQ  220
            P+PQ
Sbjct  331  PEPQ  334


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 91/172 (53%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L++IA+ EG RG+Y GL P  LA + + A+ 
Sbjct  55   LDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQIAQREGFRGMYRGLSPTVLALLPNWAVY  114

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L++ D +   +LS     VA+S +    + +T P  VV++R Q QG+ + 
Sbjct  115  FTVYEQLKSLLSSNDGS--HQLSLGANVVAASCAGAATTIVTNPLWVVKTRFQTQGIRAG  172

Query  405  K-RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  173  SIPYKGTLAALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPAYEKIKAYL  223



>ref|XP_010518451.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=306

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  123  IATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  182

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  183  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  242

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  243  EKRYSGVRDCIKKVFEKDGYPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  301


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 92/173 (53%), Gaps = 18/173 (10%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I ++EG+RGLY GL P  +A +S+ A  
Sbjct  34   LDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKKEGMRGLYRGLSPTVMALLSNWA--  91

Query  585  FPTYEKIKIYLANRDNTSMD-KLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
                  +K +L ++D   +D KLS     +A+S +    +  T P  VV++RLQ QG+ +
Sbjct  92   ------LKSFLCSKD---VDRKLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQGMRA  142

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y   +  +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  143  GVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKVYL  194



>ref|XP_010507885.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
isoform X2 [Camelina sativa]
Length=314

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  191  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  251  EKRYSGVRDCIKKVFEKDGFPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  309


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 97/173 (56%), Gaps = 10/173 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I ++EG+RGLY GL P  +A +S+ AI 
Sbjct  34   LDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKKEGMRGLYRGLSPTVMALLSNWAIY  93

Query  585  FPTYEKIKIYLANRDNTSMD-KLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            F  Y+++K +L ++D   +D KLS     +A+S +    +  T P  VV++RLQ QG+ +
Sbjct  94   FTMYDQLKSFLCSKD---VDRKLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQGMRA  150

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y   +  +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  151  GVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKVYL  202



>ref|XP_010507884.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
isoform X1 [Camelina sativa]
Length=319

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  136  IATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  195

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  196  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  255

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  256  EKRYSGVRDCIKKVFEKDGFPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  314


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 97/178 (54%), Gaps = 15/178 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVA--  592
            L V+ TR Q  G+ + G    +G+L   +L +I ++EG+RGLY GL P  +A +S+ A  
Sbjct  34   LDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKKEGMRGLYRGLSPTVMALLSNWATY  93

Query  591  ---IQFPTYEKIKIYLANRDNTSMD-KLsasnvavassvSKIFASTMTYPHEVVRSRLQE  424
               I F  Y+++K +L ++D   +D KLS     +A+S +    +  T P  VV++RLQ 
Sbjct  94   FLQIYFTMYDQLKSFLCSKD---VDRKLSVGANVLAASGAGAATTIATNPLWVVKTRLQT  150

Query  423  QGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            QG+ +    Y   +  +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  151  QGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKVYL  207



>ref|XP_006397944.1| hypothetical protein EUTSA_v10001547mg [Eutrema salsugineum]
 gb|ESQ39397.1| hypothetical protein EUTSA_v10001547mg [Eutrema salsugineum]
Length=326

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  143  IATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  202

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IKIYLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  203  QFPTYEMIKIYLAKKGDKSIDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  262

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++K+F+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  263  EKRYSGVRDCIKKIFEKDGFPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHLPSE  321


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 95/172 (55%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I ++EG+RGLY GL P  +A +S+ A+ 
Sbjct  46   LDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKKEGVRGLYRGLSPTVMALLSNWAVY  105

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y+++K +L++ D     KLS     +A+S +    +  T P  VV++RLQ QG+ + 
Sbjct  106  FTMYDQLKSFLSSNDKD--HKLSVGANVMAASGAGAATTIATNPLWVVKTRLQTQGMRAG  163

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  164  VVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKIYL  214



>ref|XP_002880307.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH56566.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=312

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  129  IATNPLWVVKTRLQTQGMRVGIVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  188

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  189  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  248

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLVS  P +
Sbjct  249  EKRYSGVRDCIKKVFEKDGFPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVSHIPSE  307


 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 93/172 (54%), Gaps = 10/172 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I + EG+RGLY GL P  +A +S+ AI 
Sbjct  34   LDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPTVMALLSNWAIY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y+++K +L + D+    KLS     +A+S +    +  T P  VV++RLQ QG+   
Sbjct  94   FTMYDQLKSFLCSNDH----KLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQGMRVG  149

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  150  IVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKVYL  200



>ref|XP_010518450.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=314

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  191  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  251  EKRYSGVRDCIKKVFEKDGYPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  309


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 97/173 (56%), Gaps = 10/173 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I ++EG+RGLY GL P  +A +S+ AI 
Sbjct  34   LDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKKEGMRGLYRGLSPTVMALLSNWAIY  93

Query  585  FPTYEKIKIYLANRDNTSMD-KLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            F  Y+++K +L ++D   +D KLS     +A+S +    +  T P  VV++RLQ QG+ +
Sbjct  94   FTMYDQLKSFLCSKD---VDRKLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQGMRA  150

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y   +  +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  151  GVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKVYL  202



>ref|XP_004962357.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Setaria italica]
Length=340

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 165/188 (88%), Gaps = 2/188 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +I TN LWVV TR QTQG+RAG +PY+GTL+AL RIA EEGIRGLYSGLVPALAGVSHVA
Sbjct  151  SIVTNPLWVVKTRFQTQGIRAGPIPYKGTLAALSRIAHEEGIRGLYSGLVPALAGVSHVA  210

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ ASTMTYPHEVVRSRLQ+QG H
Sbjct  211  IQFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTMTYPHEVVRSRLQDQGAH  270

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            SE RY GVIDC++KV+ +EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+ + PP+
Sbjct  271  SETRYKGVIDCIKKVYYKEGVAGFYRGCATNLLRTTPAAVITFTSFEMIHRFLLDLIPPE  330

Query  231  PQP--QPL  214
            P+P  QPL
Sbjct  331  PEPHIQPL  338


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 90/172 (52%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L++IA+ EG RG+Y GL P  LA + + A+ 
Sbjct  55   LDVIKTRFQVHGWPKLGTGTIGGSVIIGSLQQIAQREGFRGMYRGLSPTVLALLPNWAVY  114

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L++ D +   +LS     VA+S +    S +T P  VV++R Q QG+ + 
Sbjct  115  FTVYEQLKSLLSSNDGS--HQLSLGANVVAASCAGAATSIVTNPLWVVKTRFQTQGIRAG  172

Query  405  K-RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G +  + ++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  173  PIPYKGTLAALSRIAHEEGIRGLYSGLVPALAGVSHVA-IQFPAYEKIKAYL  223



>ref|XP_006294636.1| hypothetical protein CARUB_v10023674mg [Capsella rubella]
 gb|EOA27534.1| hypothetical protein CARUB_v10023674mg [Capsella rubella]
Length=314

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPY+ TLSALRRI  EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRLQTQGMRVGVVPYKSTLSALRRIGYEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  191  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G+PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  251  EKRYSGVRDCIKKVFEKDGLPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  309


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 93/172 (54%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I ++EG+RGLY GL P  +A +S+ AI 
Sbjct  34   LDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKKEGMRGLYRGLSPTVMALLSNWAIY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y+++K +L + D     +LS     +A+S +    +  T P  VV++RLQ QG+   
Sbjct  94   FTMYDQLKSFLCSND--EHHRLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQGMRVG  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  152  VVPYKSTLSALRRIGYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKVYL  202



>ref|NP_566102.1| NAD+ transporter 1 [Arabidopsis thaliana]
 sp|O22261.2|NDT1_ARATH RecName: Full=Nicotinamide adenine dinucleotide transporter 1, 
chloroplastic; Short=AtNDT1; AltName: Full=NAD(+) transporter 
1 [Arabidopsis thaliana]
 gb|AAK50096.1|AF372957_1 At2g47490/T30B22.21 [Arabidopsis thaliana]
 gb|AAL69531.1| At2g47490/T30B22.21 [Arabidopsis thaliana]
 gb|AAC62861.2| putative mitochondrial carrier protein [Arabidopsis thaliana]
 gb|AAM61452.1| putative mitochondrial carrier protein [Arabidopsis thaliana]
 emb|CAI38582.1| mitochondrial carrier like protein [Arabidopsis thaliana]
 dbj|BAH19521.1| AT2G47490 [Arabidopsis thaliana]
 emb|CAR70090.1| chloroplastic nicotinamide adenine dinucleotide transporter 1 
[Arabidopsis thaliana]
 gb|AEC10850.1| NAD+ transporter 1 [Arabidopsis thaliana]
Length=312

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPY+ T SALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  129  IATNPLWVVKTRLQTQGMRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGISHVAI  188

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  189  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  248

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  249  EKRYSGVRDCIKKVFEKDGFPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  307


 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 92/172 (53%), Gaps = 10/172 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I + EG+RGLY GL P  +A +S+ AI 
Sbjct  34   LDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPTVMALLSNWAIY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y+++K +L + D+    KLS     +A+S +    +  T P  VV++RLQ QG+   
Sbjct  94   FTMYDQLKSFLCSNDH----KLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQGMRVG  149

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y      +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  150  IVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKVYL  200



>dbj|BAJ89038.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 167/190 (88%), Gaps = 4/190 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGF-VPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TIATN LWVV TR QTQG+RAG  +PY+GT++AL RIA EEGIRGLYSGLVPALAG++HV
Sbjct  152  TIATNPLWVVKTRFQTQGVRAGATIPYKGTVAALTRIAHEEGIRGLYSGLVPALAGITHV  211

Query  594  AIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            AIQFP YEKIK YLA RDNT+++ LS+ +VAVASS++K+ AST+TYPHEVVRSRLQ+QG 
Sbjct  212  AIQFPVYEKIKAYLAERDNTTVEALSSGDVAVASSLAKLAASTLTYPHEVVRSRLQDQGA  271

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            HSE RY GVIDCVRKV+  EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+++ PP
Sbjct  272  HSEARYRGVIDCVRKVYHAEGVAGFYRGCATNLLRTTPAAVITFTSFEMIHRFLLNLGPP  331

Query  234  DPQ---PQPL  214
            +P+   PQPL
Sbjct  332  EPEQHHPQPL  341


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 87/173 (50%), Gaps = 9/173 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L++IAR EG RGLY GL P  LA + + A+ 
Sbjct  56   LDVIKTRFQVHGWPKLAPGTIGGSVIVGSLQQIARREGFRGLYRGLSPTILALLPNWAVY  115

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  LA+  N    +LS     +A+S +    +  T P  VV++R Q QG+ + 
Sbjct  116  FTVYEQLKSMLAS--NEGSHQLSLGANVIAASCAGAATTIATNPLWVVKTRFQTQGVRAG  173

Query  405  KR--YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y G +  + ++  +EGI G Y G    L   T  A I F  +E I  +L
Sbjct  174  ATIPYKGTVAALTRIAHEEGIRGLYSGLVPALAGITHVA-IQFPVYEKIKAYL  225



>ref|XP_009142527.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Brassica rapa]
 emb|CDX80110.1| BnaA05g00460D [Brassica napus]
Length=306

 Score =   281 bits (719),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  129  IATNPLWVVKTRLQTQGMREGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  188

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE +K YLAN+ N S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  189  QFPTYELVKTYLANKGNKSIDDLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  248

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
            EKRYSGV DC++KVF+++G+ GFYRGCATNL+RTTPAA ITFTSFEM+HRFLV+  P
Sbjct  249  EKRYSGVRDCIKKVFEKDGVRGFYRGCATNLLRTTPAAAITFTSFEMVHRFLVTHLP  305


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 93/174 (53%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ +      +G++   +L++I ++EG+RGLY GL P  +A +S+ A+ 
Sbjct  32   LDVIKTRFQVHGLPKLAHPNIKGSIIVGSLKQIFKQEGMRGLYRGLSPTVMALLSNWAVY  91

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-HS  409
            F  Y+++K +L + D     K S     +A+S +    +  T P  VV++RLQ QG+   
Sbjct  92   FTMYDQLKSFLISNDKD--HKFSVGANVMAASGAGAATTIATNPLWVVKTRLQTQGMREG  149

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  +R++  +EGI G Y G    L   +  A I F ++E++  +L +
Sbjct  150  VVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYELVKTYLAN  202



>dbj|BAJ85199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 166/190 (87%), Gaps = 4/190 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGF-VPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TIATN LWVV TR QTQG+RAG  +PY+GT++AL RIA EEGIRGLYSGLVPALAG++HV
Sbjct  152  TIATNPLWVVKTRFQTQGVRAGATIPYKGTVAALTRIAHEEGIRGLYSGLVPALAGITHV  211

Query  594  AIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            AIQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQ+QG 
Sbjct  212  AIQFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKLAASTLTYPHEVVRSRLQDQGA  271

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            HSE RY GVIDCVRKV+  EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+++ PP
Sbjct  272  HSEARYRGVIDCVRKVYHAEGVAGFYRGCATNLLRTTPAAVITFTSFEMIHRFLLNLGPP  331

Query  234  DPQ---PQPL  214
            +P+   PQPL
Sbjct  332  EPEQHHPQPL  341


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 87/173 (50%), Gaps = 9/173 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L++IAR EG RGLY GL P  LA + + A+ 
Sbjct  56   LDVIKTRFQVHGWPKLAPGTIGGSVIVGSLQQIARREGFRGLYRGLSPTILALLPNWAVY  115

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  LA+  N    +LS     +A+S +    +  T P  VV++R Q QG+ + 
Sbjct  116  FTVYEQLKSMLAS--NEGSHQLSLGANVIAASCAGAATTIATNPLWVVKTRFQTQGVRAG  173

Query  405  KR--YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y G +  + ++  +EGI G Y G    L   T  A I F  +E I  +L
Sbjct  174  ATIPYKGTVAALTRIAHEEGIRGLYSGLVPALAGITHVA-IQFPVYEKIKAYL  225



>emb|CDY57720.1| BnaC04g51920D [Brassica napus]
Length=309

 Score =   280 bits (716),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  132  IATNPLWVVKTRLQTQGMREGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE +K YLAN+ + S+D L+A +VAVASS++KIFAST+TYPHEVVR+RLQEQG HS
Sbjct  192  QFPTYEMVKTYLANKGDKSIDDLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQGHHS  251

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
            EKRYSGV DC++KVF+++G+ GFYRGCATNL+RTTPAA ITFTSFEM+HRFLV+  P
Sbjct  252  EKRYSGVRDCIKKVFEKDGVRGFYRGCATNLLRTTPAAAITFTSFEMVHRFLVTHLP  308


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 91/174 (52%), Gaps = 8/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G+ +      +G++   +L++I ++EG RGLY GL P  +A +S+ A+ 
Sbjct  35   LDVIKTRFQVHGLPKLAHPNIKGSIIVGSLKQIFKQEGTRGLYRGLSPTVMALLSNWAVY  94

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y+++K +  + D     K S     +A+S +    +  T P  VV++RLQ QG+   
Sbjct  95   FTMYDQLKSFSISNDKD--HKFSVGANVMAASGAGAATTIATNPLWVVKTRLQTQGMREG  152

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               Y   +  +R++  +EGI G Y G    L   +  A I F ++EM+  +L +
Sbjct  153  VVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMVKTYLAN  205



>ref|XP_009383544.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=315

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWVV TR Q Q +R G VPY+GTL++LRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  130  TIVTNPLWVVKTRFQAQELRVGMVPYQGTLNSLRRIAHEEGIRGLYSGLVPALAGISHVA  189

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK  LA RDNT++D L+A +VAVASS+SKI AST+TYPHEVVRS+LQEQG H
Sbjct  190  IQFPAYEKIKCCLAERDNTTVDSLTARDVAVASSISKIVASTLTYPHEVVRSKLQEQGFH  249

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            +E +Y GVIDC++KVF+++GI GFY GCATNL+RTTPAAVITFTSFEMIHRFL ++FPP+
Sbjct  250  AEMQYKGVIDCIKKVFRKDGISGFYHGCATNLLRTTPAAVITFTSFEMIHRFLTNLFPPE  309

Query  231  PQPQPL  214
              P  L
Sbjct  310  SNPHVL  315


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 87/168 (52%), Gaps = 8/168 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ +      +G++   +L +I + EG+ G+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPKIDSNGAKGSIIIRSLEQIVKREGVLGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE+ K  L++ D     +LS      A+S + +  + +T P  VV++R Q Q L   
Sbjct  94   FTVYEQSKSLLSSNDGN--HQLSIGANMFAASGAGVATTIVTNPLWVVKTRFQAQELRVG  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMI  265
               Y G ++ +R++  +EGI G Y G    L   +  A I F ++E I
Sbjct  152  MVPYQGTLNSLRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPAYEKI  198



>ref|XP_006855345.1| hypothetical protein AMTR_s00057p00101290 [Amborella trichopoda]
 gb|ERN16812.1| hypothetical protein AMTR_s00057p00101290 [Amborella trichopoda]
Length=316

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 163/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWVV TR QTQGMRAG +PYR TLSALRRIA EEGIRGLYSGL+PALAG+SHVA
Sbjct  129  TIVTNPLWVVKTRFQTQGMRAGVMPYRSTLSALRRIAHEEGIRGLYSGLLPALAGISHVA  188

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG--  418
            IQFPTYEKIK YLA   NT+ D LSA++VA+ASSVSKI AST+TYPHEVVRSRLQEQG  
Sbjct  189  IQFPTYEKIKDYLAREGNTTPDALSAADVALASSVSKIAASTLTYPHEVVRSRLQEQGHA  248

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +SEKRY+GV+DCVRKVF ++GI GFYRGCATNL+RTTPAAVITFTSFEMIHRFL  +FP
Sbjct  249  CNSEKRYNGVVDCVRKVFMKDGISGFYRGCATNLLRTTPAAVITFTSFEMIHRFLNDLFP  308

Query  237  PDPQPQPL  214
            P  + Q L
Sbjct  309  PKRRHQTL  316


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 91/171 (53%), Gaps = 7/171 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQF  583
            L V+ TR Q  G+       +G+L   +L +IAR+EG+RG+Y GL P  LA + + A+ F
Sbjct  34   LDVIKTRFQVHGLPELNGRRKGSLILGSLEQIARKEGVRGMYRGLAPTVLALLPNWAVYF  93

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
              YE+ K  L + D+   ++LS     +A+S +    + +T P  VV++R Q QG+ +  
Sbjct  94   TMYEQFKSLLHSPDDN--NQLSIGANMIAASAAGAATTIVTNPLWVVKTRFQTQGMRAGV  151

Query  402  R-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y   +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  MPYRSTLSALRRIAHEEGIRGLYSGLLPALAGISHVA-IQFPTYEKIKDYL  201



>gb|EMS54256.1| hypothetical protein TRIUR3_07374 [Triticum urartu]
Length=357

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 4/190 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAG-FVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TIATN LWVV TR QTQG+RAG  +PY+GT++AL RIA EEGIRGLYSGLVPALAG++HV
Sbjct  166  TIATNPLWVVKTRFQTQGVRAGAMIPYKGTVAALTRIAHEEGIRGLYSGLVPALAGITHV  225

Query  594  AIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            AIQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQEQG 
Sbjct  226  AIQFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKLAASTLTYPHEVVRSRLQEQGA  285

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            HSE RY GVIDCVRKV+  EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+++  P
Sbjct  286  HSEARYRGVIDCVRKVYHAEGVAGFYRGCATNLLRTTPAAVITFTSFEMIHRFLLNLGSP  345

Query  234  DPQ---PQPL  214
            +P+   P PL
Sbjct  346  EPEQHHPHPL  355


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 72/147 (49%), Gaps = 14/147 (10%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            + +L +IAR EG RGLY GL P  LA + + A+ F  YE++K  LA+     M       
Sbjct  104  IGSLEQIARREGFRGLYRGLSPTILALLPNWAVYFTVYEQLKSMLASSGANVM-------  156

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKR--YSGVIDCVRKVFQQEGIPGFYR  334
               A+S +    +  T P  VV++R Q QG+ +     Y G +  + ++  +EGI G Y 
Sbjct  157  ---AASCAGAATTIATNPLWVVKTRFQTQGVRAGAMIPYKGTVAALTRIAHEEGIRGLYS  213

Query  333  GCATNLIRTTPAAVITFTSFEMIHRFL  253
            G    L   T  A I F  +E I  +L
Sbjct  214  GLVPALAGITHVA-IQFPVYEKIKAYL  239



>ref|NP_001131441.1| uncharacterized protein LOC100192773 [Zea mays]
 gb|ACF79846.1| unknown [Zea mays]
 gb|ACG42192.1| mitochondrial carrier YEL006W [Zea mays]
 gb|ACN33438.1| unknown [Zea mays]
 gb|AFW77704.1| carrier YEL006W [Zea mays]
Length=336

 Score =   279 bits (713),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWVV TR QTQG+RAG +PY+GTL+ALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  147  TIVTNPLWVVKTRFQTQGIRAGPIPYKGTLAALRRIAHEEGIRGLYSGLVPALAGISHVA  206

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQ+Q  +
Sbjct  207  IQFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQRAN  266

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            S+ RY GVIDCVRKV+ +EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHR L+ +FP +
Sbjct  267  SDARYKGVIDCVRKVYHKEGVAGFYRGCATNLLRTTPAAVITFTSFEMIHRSLLDLFPAE  326

Query  231  PQP--QPL  214
            P+P  QPL
Sbjct  327  PEPHIQPL  334


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 92/172 (53%), Gaps = 12/172 (7%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G   +  G V     + +L++IA++EG RG+Y GL P  LA + + A+ 
Sbjct  55   LDVIKTRFQVHGWPKLATGSV----IIGSLQQIAQQEGFRGMYRGLSPTILALLPNWAVY  110

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K +L++ D +   +LS     VA+S +    + +T P  VV++R Q QG+ + 
Sbjct  111  FTVYEQLKSFLSSNDGS--HQLSLGANVVAASCAGAATTIVTNPLWVVKTRFQTQGIRAG  168

Query  405  K-RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G +  +R++  +EGI G Y G    L   +  A I F  +E I  +L
Sbjct  169  PIPYKGTLAALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPVYEKIKAYL  219



>gb|EEE63395.1| hypothetical protein OsJ_18207 [Oryza sativa Japonica Group]
Length=336

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TIATN LWVV TR QTQG+RAG +PY+GTL+AL+RIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  147  TIATNPLWVVKTRFQTQGIRAGVIPYKGTLAALKRIAHEEGIRGLYSGLVPALAGISHVA  206

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQEQG H
Sbjct  207  IQFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQEQGAH  266

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVF  241
            S+ RY+GV+DC+RKV+  EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+ VF
Sbjct  267  SKARYTGVMDCIRKVYHIEGLTGFYRGCATNLLRTTPAAVITFTSFEMIHRFLLDVF  323


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 89/172 (52%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L++IA+ EG RG+Y GL P  LA + + A+ 
Sbjct  51   LDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQIAQREGFRGMYRGLSPTILALLPNWAVY  110

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L++ D +    L A+ +A + +      +  T P  VV++R Q QG+ + 
Sbjct  111  FTVYEQLKSLLSSNDRSHHLSLGANVIAASCAGGA--TTIATNPLWVVKTRFQTQGIRAG  168

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G +  ++++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  169  VIPYKGTLAALKRIAHEEGIRGLYSGLVPALAGISHVA-IQFPAYEKIKAYL  219



>ref|NP_001055296.1| Os05g0357200 [Oryza sativa Japonica Group]
 gb|AAV43843.1| putative mitochondrial carrier protein [Oryza sativa Japonica 
Group]
 gb|AAV43947.1| putative mitochondrial carrier protein [Oryza sativa Japonica 
Group]
 dbj|BAF17210.1| Os05g0357200 [Oryza sativa Japonica Group]
 dbj|BAG88995.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79050.1| hypothetical protein OsI_19613 [Oryza sativa Indica Group]
Length=336

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TIATN LWVV TR QTQG+RAG +PY+GTL+AL+RIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  147  TIATNPLWVVKTRFQTQGIRAGVIPYKGTLAALKRIAHEEGIRGLYSGLVPALAGISHVA  206

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQEQG H
Sbjct  207  IQFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQEQGAH  266

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVF  241
            S+ RY+GV+DC+RKV+  EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+ VF
Sbjct  267  SKARYTGVMDCIRKVYHIEGLTGFYRGCATNLLRTTPAAVITFTSFEMIHRFLLDVF  323


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 89/172 (52%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L++IA+ EG RG+Y GL P  LA + + A+ 
Sbjct  51   LDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQIAQREGFRGMYRGLSPTILALLPNWAVY  110

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L++ D +    L A+ +A + +      +  T P  VV++R Q QG+ + 
Sbjct  111  FTVYEQLKSLLSSNDRSHHLSLGANVIAASCAGGA--TTIATNPLWVVKTRFQTQGIRAG  168

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G +  ++++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  169  VIPYKGTLAALKRIAHEEGIRGLYSGLVPALAGISHVA-IQFPAYEKIKAYL  219



>ref|XP_008647348.1| PREDICTED: uncharacterized protein LOC100192773 isoform X1 [Zea 
mays]
Length=340

 Score =   279 bits (713),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWVV TR QTQG+RAG +PY+GTL+ALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  151  TIVTNPLWVVKTRFQTQGIRAGPIPYKGTLAALRRIAHEEGIRGLYSGLVPALAGISHVA  210

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQ+Q  +
Sbjct  211  IQFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQRAN  270

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            S+ RY GVIDCVRKV+ +EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHR L+ +FP +
Sbjct  271  SDARYKGVIDCVRKVYHKEGVAGFYRGCATNLLRTTPAAVITFTSFEMIHRSLLDLFPAE  330

Query  231  PQP--QPL  214
            P+P  QPL
Sbjct  331  PEPHIQPL  338


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 92/172 (53%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L++IA++EG RG+Y GL P  LA + + A+ 
Sbjct  55   LDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQIAQQEGFRGMYRGLSPTILALLPNWAVY  114

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K +L++ D +   +LS     VA+S +    + +T P  VV++R Q QG+ + 
Sbjct  115  FTVYEQLKSFLSSNDGS--HQLSLGANVVAASCAGAATTIVTNPLWVVKTRFQTQGIRAG  172

Query  405  K-RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G +  +R++  +EGI G Y G    L   +  A I F  +E I  +L
Sbjct  173  PIPYKGTLAALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPVYEKIKAYL  223



>gb|EMT02103.1| Mitochondrial substrate carrier family protein W [Aegilops tauschii]
Length=424

 Score =   281 bits (720),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 165/190 (87%), Gaps = 4/190 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGF-VPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TIATN LWVV TR QTQG+RAG  +PY+GT++AL RIA EEGIRGLYSGLVPALAG++HV
Sbjct  233  TIATNPLWVVKTRFQTQGVRAGATIPYKGTVAALTRIAHEEGIRGLYSGLVPALAGITHV  292

Query  594  AIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            AIQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQEQG 
Sbjct  293  AIQFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKLAASTLTYPHEVVRSRLQEQGA  352

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            HSE RY GVIDCVRKV+  EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+++ PP
Sbjct  353  HSEARYRGVIDCVRKVYHAEGVAGFYRGCATNLLRTTPAAVITFTSFEMIHRFLLNLGPP  412

Query  234  DPQ---PQPL  214
            +P+   P PL
Sbjct  413  EPEQHHPHPL  422


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 72/147 (49%), Gaps = 14/147 (10%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            + +L +IAR EG RGLY GL P  LA + + A+ F  YE++K  LA+     M       
Sbjct  171  IGSLEQIARREGFRGLYRGLSPTILALLPNWAVYFTVYEQLKSMLASSGANVM-------  223

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKR--YSGVIDCVRKVFQQEGIPGFYR  334
               A+S +    +  T P  VV++R Q QG+ +     Y G +  + ++  +EGI G Y 
Sbjct  224  ---AASCAGAATTIATNPLWVVKTRFQTQGVRAGATIPYKGTVAALTRIAHEEGIRGLYS  280

Query  333  GCATNLIRTTPAAVITFTSFEMIHRFL  253
            G    L   T  A I F  +E I  +L
Sbjct  281  GLVPALAGITHVA-IQFPVYEKIKAYL  306



>ref|XP_003568632.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Brachypodium distachyon]
Length=340

 Score =   279 bits (713),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAG-FVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TI TN LWVV TR QTQG+R+G  +PY+GT+ AL RIAREEGIRGLYSGLVPALAG++HV
Sbjct  150  TIVTNPLWVVKTRFQTQGIRSGVMIPYKGTVGALTRIAREEGIRGLYSGLVPALAGITHV  209

Query  594  AIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            AIQFP YEK+K YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQEQG 
Sbjct  210  AIQFPVYEKMKAYLAERDNTTVEALSFGDVAVASSLAKLAASTLTYPHEVVRSRLQEQGA  269

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            HSE RY GVIDCVRKV+  EGI GFYRGCATNL+RTTPAAVITFTSFEMIHRFL+ + PP
Sbjct  270  HSEARYRGVIDCVRKVYHGEGIAGFYRGCATNLLRTTPAAVITFTSFEMIHRFLLDLCPP  329

Query  234  DPQ--PQPL  214
            + +  PQPL
Sbjct  330  ESEQHPQPL  338


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 89/173 (51%), Gaps = 9/173 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L++I R EG RGLY GL P  LA + + A+ 
Sbjct  54   LDVIKTRFQVHGWPKLAPGTIGGSVIIGSLQQITRREGFRGLYRGLSPTVLALLPNWAVY  113

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L++ + +   +LS     +A+S +    + +T P  VV++R Q QG+ S 
Sbjct  114  FTVYEQLKSLLSSDEGS--HQLSVGANVIAASCAGAATTIVTNPLWVVKTRFQTQGIRSG  171

Query  405  KR--YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y G +  + ++ ++EGI G Y G    L   T  A I F  +E +  +L
Sbjct  172  VMIPYKGTVGALTRIAREEGIRGLYSGLVPALAGITHVA-IQFPVYEKMKAYL  223



>ref|XP_010506785.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Camelina sativa]
Length=314

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYE IK+YLA + + S+D L+A +VAVASS++KIFAST+TY  +VVR+RLQEQG HS
Sbjct  191  QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYXXQVVRARLQEQGHHS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV DC++KVF+++G PGFYRGCATNL+RTTPAAVITFTSFEM+HRFLV+  P +
Sbjct  251  EKRYSGVRDCIKKVFEKDGFPGFYRGCATNLLRTTPAAVITFTSFEMVHRFLVTHIPSE  309


 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 98/173 (57%), Gaps = 10/173 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I+++EG+RGLY GL P  +A +S+ AI 
Sbjct  34   LDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQISKKEGMRGLYRGLSPTVMALLSNWAIY  93

Query  585  FPTYEKIKIYLANRDNTSMD-KLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            F  Y+++K +L ++D   +D KLS     +A+S +    +  T P  VV++RLQ QG+ +
Sbjct  94   FTMYDQLKSFLCSKD---VDRKLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQGMRA  150

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y   +  +R++  +EGI G Y G    L   +  A I F ++EMI  +L
Sbjct  151  GVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA-IQFPTYEMIKVYL  202



>ref|XP_003591466.1| Mitochondrial folate transporter/carrier [Medicago truncatula]
Length=379

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  726  TQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFPTYEKIKIYLAN  547
            TQGMR G VPYR TLSAL+RIA EEGIRG+YSGLVPALAG+SHVAIQFPTYEKIK +LAN
Sbjct  213  TQGMRPGVVPYRSTLSALKRIAHEEGIRGMYSGLVPALAGISHVAIQFPTYEKIKFHLAN  272

Query  546  RDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKRYSGVIDCVRKV  367
            +DNT++DKL A +VA+ASSVSKIFAST+TYPHEVVRSRLQEQG HSEKRYSG+ DC+RKV
Sbjct  273  QDNTTVDKLGARDVAIASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYSGMTDCIRKV  332

Query  366  FQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQ  226
            FQQEG+ GFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS+ P DPQ
Sbjct  333  FQQEGLSGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSLSPSDPQ  379



>ref|XP_010905689.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=305

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 157/185 (85%), Gaps = 10/185 (5%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TR QTQGMR G VPY+GTL+ALRRIA EEGIRGLYS          HVAI
Sbjct  131  IATNPLWVVKTRFQTQGMRVGVVPYQGTLNALRRIAHEEGIRGLYS----------HVAI  180

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLA RDNT+++ L A +VAVASSVSKI AST+TYPHEVVRSRLQEQG HS
Sbjct  181  QFPTYEKIKTYLAKRDNTTINSLGAGDVAVASSVSKIAASTLTYPHEVVRSRLQEQGFHS  240

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            E RY+GVIDC++KVFQ+EGIPGFYRGCATNL+RTTPAAVITFTSFEMIHRFL+++FPP+ 
Sbjct  241  EMRYTGVIDCIKKVFQEEGIPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLITLFPPEQ  300

Query  228  QPQPL  214
             P  L
Sbjct  301  HPHTL  305


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 87/172 (51%), Gaps = 18/172 (10%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+   +   V     + +L +I R+EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRFQVHGLPSLKNSTVKGSLIIGSLEQIVRKEGVRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE++K  L + D +   +LS  +  +A+S +    +  T P  VV++R Q QG+   
Sbjct  94   FTVYEQLKSLLCSDDGSG--RLSVGDNMIAASGAGAATTIATNPLWVVKTRFQTQGMRVG  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G ++ +R++  +EGI G Y   A           I F ++E I  +L
Sbjct  152  VVPYQGTLNALRRIAHEEGIRGLYSHVA-----------IQFPTYEKIKTYL  192



>gb|ACN28655.1| unknown [Zea mays]
 gb|AFW77702.1| hypothetical protein ZEAMMB73_178914 [Zea mays]
Length=394

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWVV TR QTQG+RAG +PY+GTL+ALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  205  TIVTNPLWVVKTRFQTQGIRAGPIPYKGTLAALRRIAHEEGIRGLYSGLVPALAGISHVA  264

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQ+Q  +
Sbjct  265  IQFPVYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQRAN  324

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            S+ RY GVIDCVRKV+ +EG+ GFYRGCATNL+RTTPAAVITFTSFEMIHR L+ +FP +
Sbjct  325  SDARYKGVIDCVRKVYHKEGVAGFYRGCATNLLRTTPAAVITFTSFEMIHRSLLDLFPAE  384

Query  231  PQP--QPL  214
            P+P  QPL
Sbjct  385  PEPHIQPL  392


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 82/146 (56%), Gaps = 5/146 (3%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            + +L++IA++EG RG+Y GL P  LA + + A+ F  YE++K +L++ D +   +LS   
Sbjct  135  IGSLQQIAQQEGFRGMYRGLSPTILALLPNWAVYFTVYEQLKSFLSSNDGS--HQLSLGA  192

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK-RYSGVIDCVRKVFQQEGIPGFYRG  331
              VA+S +    + +T P  VV++R Q QG+ +    Y G +  +R++  +EGI G Y G
Sbjct  193  NVVAASCAGAATTIVTNPLWVVKTRFQTQGIRAGPIPYKGTLAALRRIAHEEGIRGLYSG  252

Query  330  CATNLIRTTPAAVITFTSFEMIHRFL  253
                L   +  A I F  +E I  +L
Sbjct  253  LVPALAGISHVA-IQFPVYEKIKAYL  277



>ref|NP_001146478.1| uncharacterized protein LOC100280066 [Zea mays]
 gb|ACL54103.1| unknown [Zea mays]
 gb|AFW81642.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_626020 [Zea 
mays]
Length=340

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 162/188 (86%), Gaps = 2/188 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            T  TN LWVV TR QTQG+RAG +PY+GTL+ALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  151  TTVTNPLWVVKTRFQTQGIRAGPMPYKGTLAALRRIAHEEGIRGLYSGLVPALAGISHVA  210

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQ+Q  H
Sbjct  211  IQFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQRAH  270

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            S+ RY GV+DC+RKV+ +EG+ GFY GCATNL+RTTPAAVITFTSFEMIHRFL+ +FP +
Sbjct  271  SDARYKGVVDCIRKVYHKEGVAGFYSGCATNLLRTTPAAVITFTSFEMIHRFLLDLFPAE  330

Query  231  PQP--QPL  214
             +P  QPL
Sbjct  331  SEPHIQPL  338


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 92/172 (53%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQG---MRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G   +  G +     + +L++IA+ EG RG+Y GL P  LA + + A+ 
Sbjct  55   LDVIKTRFQVHGWPKLTTGTIGGSVIIGSLQQIAQREGFRGMYRGLSPTVLALLPNWAVY  114

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L++ D +   +LS     VA+S +    +T+T P  VV++R Q QG+ + 
Sbjct  115  FTVYEQLKSLLSSNDGS--HQLSLGANVVAASCAGAATTTVTNPLWVVKTRFQTQGIRAG  172

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y G +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  173  PMPYKGTLAALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPAYEKIKAYL  223



>ref|XP_011082440.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Sesamum indicum]
 ref|XP_011082441.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Sesamum indicum]
Length=301

 Score =   273 bits (697),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 158/179 (88%), Gaps = 6/179 (3%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQG+R   VPYR TLSAL+RIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  129  IVTNPLWVVKTRLQTQGIRRDVVPYRSTLSALQRIAHEEGIRGLYSGLVPALAGISHVAI  188

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIK YLA++ NT++DKLSAS+VAVASSVSKIFAST+TYPHEVVRSRLQEQG HS
Sbjct  189  QFPTYEKIKCYLADQGNTTIDKLSASDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHS  248

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            EKRYSGV+DC++KVF         RGCATNL+RTTPAAVITFTSFEMIHRFLVS+F PD
Sbjct  249  EKRYSGVVDCIKKVFHPS------RGCATNLLRTTPAAVITFTSFEMIHRFLVSLFSPD  301


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 93/172 (54%), Gaps = 10/172 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ +      +G++   +L +I ++EG+RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPQLASANIKGSVIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K +L   D+    +LS     +A+S +    + +T P  VV++RLQ QG+  +
Sbjct  94   FTIYEQLKSFLGADDH----QLSVGANMMAASGAGAATTIVTNPLWVVKTRLQTQGIRRD  149

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  ++++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  150  VVPYRSTLSALQRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKCYL  200



>gb|KJB48101.1| hypothetical protein B456_008G053500 [Gossypium raimondii]
Length=281

 Score =   266 bits (681),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 157/181 (87%), Gaps = 2/181 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMR G VPY G LSALRRI  EEG+RGLYSG++P+LAG+SHVAI
Sbjct  61   IVTNPLWVVKTRLQTQGMRTGVVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVAI  120

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK Y+A + NT++D+LS S+VA+ASS+SK+ AS MTYPHEV+RSRLQEQG   
Sbjct  121  QFPAYEKIKSYMAKKGNTTVDRLSPSDVAIASSISKVLASIMTYPHEVIRSRLQEQGQAR  180

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            H+E +Y+GV+DC+RKVF++EG+ GFYRGCATNL+RTTP+AVITFTS+EMIHRFL  V PP
Sbjct  181  HTEVQYAGVVDCIRKVFRKEGVSGFYRGCATNLLRTTPSAVITFTSYEMIHRFLNQVLPP  240

Query  234  D  232
            +
Sbjct  241  E  241



>ref|XP_007153375.1| hypothetical protein PHAVU_003G029900g [Phaseolus vulgaris]
 gb|ESW25369.1| hypothetical protein PHAVU_003G029900g [Phaseolus vulgaris]
Length=272

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 153/181 (85%), Gaps = 2/181 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I+TN LWVV TRLQTQGMR   VPY+  LSAL RI REEGIRGLYSG++P+LAG+SHVAI
Sbjct  48   ISTNPLWVVKTRLQTQGMRTDVVPYKSVLSALTRITREEGIRGLYSGIIPSLAGISHVAI  107

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFP YEK+K Y+A +DNT++DKLS  +VA+ASS+SK+FAS MTYPHEV+RSRLQEQG   
Sbjct  108  QFPAYEKMKSYMAEKDNTTVDKLSPGSVAIASSISKVFASVMTYPHEVIRSRLQEQGQAK  167

Query  408  EK--RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
                RY+GVIDC RKVF++EGIPGFYRGCATNL+RTTP+AVITFTS+EMI RFL  V P 
Sbjct  168  NNVIRYAGVIDCTRKVFEKEGIPGFYRGCATNLLRTTPSAVITFTSYEMIRRFLEGVVPQ  227

Query  234  D  232
            D
Sbjct  228  D  228



>gb|KJB48098.1| hypothetical protein B456_008G053500 [Gossypium raimondii]
Length=327

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 157/181 (87%), Gaps = 2/181 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMR G VPY G LSALRRI  EEG+RGLYSG++P+LAG+SHVAI
Sbjct  107  IVTNPLWVVKTRLQTQGMRTGVVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVAI  166

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK Y+A + NT++D+LS S+VA+ASS+SK+ AS MTYPHEV+RSRLQEQG   
Sbjct  167  QFPAYEKIKSYMAKKGNTTVDRLSPSDVAIASSISKVLASIMTYPHEVIRSRLQEQGQAR  226

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            H+E +Y+GV+DC+RKVF++EG+ GFYRGCATNL+RTTP+AVITFTS+EMIHRFL  V PP
Sbjct  227  HTEVQYAGVVDCIRKVFRKEGVSGFYRGCATNLLRTTPSAVITFTSYEMIHRFLNQVLPP  286

Query  234  D  232
            +
Sbjct  287  E  287


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 86/146 (59%), Gaps = 4/146 (3%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            +++L+ I + EG++GLY GL P  +A + + A+ F  YE++K  LA+ DN S  +L+   
Sbjct  35   ITSLQHIIKTEGLKGLYRGLSPTIIALLPNWAVYFTVYEQLKGLLASHDNNSA-QLTIGE  93

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRG  331
              VA++ +    + +T P  VV++RLQ QG+ +    Y+GV+  +R++  +EG+ G Y G
Sbjct  94   NMVAAAGAGAATAIVTNPLWVVKTRLQTQGMRTGVVPYTGVLSALRRIVHEEGLRGLYSG  153

Query  330  CATNLIRTTPAAVITFTSFEMIHRFL  253
               +L   +  A I F ++E I  ++
Sbjct  154  VLPSLAGISHVA-IQFPAYEKIKSYM  178



>ref|XP_007044248.1| NAD+ transporter 2 isoform 1 [Theobroma cacao]
 gb|EOY00080.1| NAD+ transporter 2 isoform 1 [Theobroma cacao]
Length=365

 Score =   267 bits (683),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G VPY G LSALRRI  EEG+RGLYSG++P+LAG+SHVAIQFP
Sbjct  142  NPLWVVKTRLQTQGMRTGVVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVAIQFP  201

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK Y+A ++NT++D LS ++VA+ASS+SK+ AS MTYPHEV+RSRLQEQG   +SE
Sbjct  202  AYEKIKSYMAKKENTTVDHLSPADVAIASSISKVLASIMTYPHEVIRSRLQEQGQVRNSE  261

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
              Y+GV+DC+RKVFQ+EG+PGFYRGCATNL+RTTP+AVITFTS+EMIHRFL  V PPD
Sbjct  262  VHYAGVVDCIRKVFQKEGLPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLDQVLPPD  319


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 96/172 (56%), Gaps = 7/172 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG+  +++L+ I + +G++GLY GL P  LA + + A+ 
Sbjct  41   LDVIKTRLQVHGLPEASQSGARGSVIITSLQHIIKNDGLKGLYRGLSPTILALLPNWAVY  100

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L + ++    +L+     VA++ +    +  T P  VV++RLQ QG+ + 
Sbjct  101  FTLYEQLKGLLTSHEDNG-GQLTIGANMVAAAGAGAATAITTNPLWVVKTRLQTQGMRTG  159

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y+GV+  +R++  +EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  160  VVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVA-IQFPAYEKIKSYM  210



>ref|XP_010523970.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Tarenaya hassleriana]
Length=308

 Score =   265 bits (677),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TR Q+QGMR   VPYR TLSALRRIA EEGIRGLYSGLVPALAG+SHVAI
Sbjct  131  IATNPLWVVKTRFQSQGMRTAVVPYRSTLSALRRIAHEEGIRGLYSGLVPALAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFPTYEKIKIYLA + + + D LSA +VAVASS++KIFAST+TYPHEVVR+RLQEQG  S
Sbjct  191  QFPTYEKIKIYLAKKGDRTKDNLSAQDVAVASSIAKIFASTLTYPHEVVRARLQEQGHRS  250

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
            EKRY GV DC++KV ++EGI GFYRGCATNL+RTTPAAVITFTSFEMI  FL +  P
Sbjct  251  EKRYLGVRDCIKKVLEKEGIKGFYRGCATNLLRTTPAAVITFTSFEMIRHFLFTHLP  307


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 89/172 (52%), Gaps = 8/172 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TR Q  G+ + G    +G+L   +L +I + EG+RGLY GL P  +A + + AI 
Sbjct  34   LDVIKTRFQVHGLPKLGDGSTKGSLIVRSLEQIFKREGMRGLYRGLSPTVMALLPNWAIY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y ++K +L + D     KLS     +A+S +    +  T P  VV++R Q QG+ + 
Sbjct  94   FTMYGQLKSFLCSNDEDR--KLSVGANMIAASGAGAATTIATNPLWVVKTRFQSQGMRTA  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y   +  +R++  +EGI G Y G    L   +  A I F ++E I  +L
Sbjct  152  VVPYRSTLSALRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPTYEKIKIYL  202



>gb|KJB48097.1| hypothetical protein B456_008G053500 [Gossypium raimondii]
 gb|KJB48100.1| hypothetical protein B456_008G053500 [Gossypium raimondii]
Length=359

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 157/181 (87%), Gaps = 2/181 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMR G VPY G LSALRRI  EEG+RGLYSG++P+LAG+SHVAI
Sbjct  139  IVTNPLWVVKTRLQTQGMRTGVVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVAI  198

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK Y+A + NT++D+LS S+VA+ASS+SK+ AS MTYPHEV+RSRLQEQG   
Sbjct  199  QFPAYEKIKSYMAKKGNTTVDRLSPSDVAIASSISKVLASIMTYPHEVIRSRLQEQGQAR  258

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            H+E +Y+GV+DC+RKVF++EG+ GFYRGCATNL+RTTP+AVITFTS+EMIHRFL  V PP
Sbjct  259  HTEVQYAGVVDCIRKVFRKEGVSGFYRGCATNLLRTTPSAVITFTSYEMIHRFLNQVLPP  318

Query  234  D  232
            +
Sbjct  319  E  319


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 98/172 (57%), Gaps = 7/172 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     R +  +++L+ I + EG++GLY GL P  +A + + A+ 
Sbjct  41   LDVIKTRLQVHGLPTASKTGVRDSVIITSLQHIIKTEGLKGLYRGLSPTIIALLPNWAVY  100

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  LA+ DN S  +L+     VA++ +    + +T P  VV++RLQ QG+ + 
Sbjct  101  FTVYEQLKGLLASHDNNSA-QLTIGENMVAAAGAGAATAIVTNPLWVVKTRLQTQGMRTG  159

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y+GV+  +R++  +EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  160  VVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVA-IQFPAYEKIKSYM  210



>ref|XP_010906995.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=283

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G VPYR  LSA RRI  EEG+RGLYSGL+P+LAGVSHVAIQFP
Sbjct  107  NPLWVVKTRLQTQGMRPGVVPYRNMLSAFRRIVHEEGVRGLYSGLLPSLAGVSHVAIQFP  166

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK YLA RDNT++DKLS  +VA+ASS+SKI ASTMTYPHEVVRSRLQEQG    + 
Sbjct  167  AYEKIKYYLARRDNTTVDKLSPGSVAIASSLSKIIASTMTYPHEVVRSRLQEQGQARDTA  226

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +Y+GV+DC++KVFQ+EG+PGFYRGC TNL+RTTP AVITFTS+EMI RFL  VFP
Sbjct  227  NQYTGVVDCIKKVFQKEGLPGFYRGCGTNLLRTTPTAVITFTSYEMIQRFLHQVFP  282


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 81/146 (55%), Gaps = 4/146 (3%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            +S+L +I + EGI+GLY GL P + A + + A+ F  Y ++K  L + ++ + ++LS S 
Sbjct  32   ISSLEQIIKNEGIKGLYRGLSPTITALLPNWAVYFTVYNQLKGLLHSHEDGN-NQLSISA  90

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRG  331
              +A+S +    +  T P  VV++RLQ QG+      Y  ++   R++  +EG+ G Y G
Sbjct  91   NIIAASGAGAATAVATNPLWVVKTRLQTQGMRPGVVPYRNMLSAFRRIVHEEGVRGLYSG  150

Query  330  CATNLIRTTPAAVITFTSFEMIHRFL  253
               +L   +  A I F ++E I  +L
Sbjct  151  LLPSLAGVSHVA-IQFPAYEKIKYYL  175



>ref|XP_007153374.1| hypothetical protein PHAVU_003G029900g [Phaseolus vulgaris]
 gb|ESW25368.1| hypothetical protein PHAVU_003G029900g [Phaseolus vulgaris]
Length=355

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 153/181 (85%), Gaps = 2/181 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I+TN LWVV TRLQTQGMR   VPY+  LSAL RI REEGIRGLYSG++P+LAG+SHVAI
Sbjct  131  ISTNPLWVVKTRLQTQGMRTDVVPYKSVLSALTRITREEGIRGLYSGIIPSLAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFP YEK+K Y+A +DNT++DKLS  +VA+ASS+SK+FAS MTYPHEV+RSRLQEQG   
Sbjct  191  QFPAYEKMKSYMAEKDNTTVDKLSPGSVAIASSISKVFASVMTYPHEVIRSRLQEQGQAK  250

Query  408  EK--RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
                RY+GVIDC RKVF++EGIPGFYRGCATNL+RTTP+AVITFTS+EMI RFL  V P 
Sbjct  251  NNVIRYAGVIDCTRKVFEKEGIPGFYRGCATNLLRTTPSAVITFTSYEMIRRFLEGVVPQ  310

Query  234  D  232
            D
Sbjct  311  D  311


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 94/171 (55%), Gaps = 10/171 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  G+  G    +G +  ++L+ I ++EG RG+Y GL P  LA + + A+ F
Sbjct  38   LDVIKTRLQVHGLPHG---QKGNVIVTSLQNIVKKEGFRGMYRGLSPTILALLPNWAVYF  94

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
             +YE++K  L + D     +L+     +A++ +    +  T P  VV++RLQ QG+ ++ 
Sbjct  95   TSYEQVKGLLRSHD--GCQELTTIENMIAAASAGAATAISTNPLWVVKTRLQTQGMRTDV  152

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  V+  + ++ ++EGI G Y G   +L   +  A I F ++E +  ++
Sbjct  153  VPYKSVLSALTRITREEGIRGLYSGIIPSLAGISHVA-IQFPAYEKMKSYM  202



>ref|XP_010906993.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=311

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G VPYR  LSA RRI  EEG+RGLYSGL+P+LAGVSHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGMRPGVVPYRNMLSAFRRIVHEEGVRGLYSGLLPSLAGVSHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK YLA RDNT++DKLS  +VA+ASS+SKI ASTMTYPHEVVRSRLQEQG    + 
Sbjct  195  AYEKIKYYLARRDNTTVDKLSPGSVAIASSLSKIIASTMTYPHEVVRSRLQEQGQARDTA  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +Y+GV+DC++KVFQ+EG+PGFYRGC TNL+RTTP AVITFTS+EMI RFL  VFP
Sbjct  255  NQYTGVVDCIKKVFQKEGLPGFYRGCGTNLLRTTPTAVITFTSYEMIQRFLHQVFP  310


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 91/171 (53%), Gaps = 6/171 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQF  583
            L V+ TR Q  G+       R +  +S+L +I + EGI+GLY GL P + A + + A+ F
Sbjct  35   LDVIKTRFQVHGLPKMPPSARRSVIISSLEQIIKNEGIKGLYRGLSPTITALLPNWAVYF  94

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
              Y ++K  L + ++ + ++LS S   +A+S +    +  T P  VV++RLQ QG+    
Sbjct  95   TVYNQLKGLLHSHEDGN-NQLSISANIIAASGAGAATAVATNPLWVVKTRLQTQGMRPGV  153

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  ++   R++  +EG+ G Y G   +L   +  A I F ++E I  +L
Sbjct  154  VPYRNMLSAFRRIVHEEGVRGLYSGLLPSLAGVSHVA-IQFPAYEKIKYYL  203



>ref|XP_010264768.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Nelumbo nucifera]
Length=365

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 153/185 (83%), Gaps = 2/185 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I+TN LWVV TRLQTQGMR+G VPY+  LSALRRI+ EEGIRGLYSGL+PAL GVSHVAI
Sbjct  133  ISTNPLWVVKTRLQTQGMRSGVVPYKSILSALRRISHEEGIRGLYSGLLPALVGVSHVAI  192

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YE +K YLA R+NT++DKL+  + A+ASSVSKI ASTMTYPHEVVRSRLQEQG   
Sbjct  193  QFPAYENMKAYLARRENTTVDKLTPGHFAIASSVSKILASTMTYPHEVVRSRLQEQGQAR  252

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            + E  Y+GVIDC++KVF +EG+PGFYRGCATNL RTTPAA+ITFTSFEMI RFL  +   
Sbjct  253  NPEVHYAGVIDCIKKVFHKEGLPGFYRGCATNLFRTTPAAIITFTSFEMIQRFLHGILSH  312

Query  234  DPQPQ  220
            D   Q
Sbjct  313  DQHSQ  317


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 93/177 (53%), Gaps = 17/177 (10%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT-----LSALRRIAREEGIRGLYSGLVPA-LAGVSHVA  592
            L V+ TRLQ  G+    VP+ G      +S+L+ I + EG+RG+Y GL P  LA + + A
Sbjct  35   LDVIKTRLQVHGLPN--VPHSGNRGSLIVSSLQNIIKNEGVRGMYRGLSPTILALLPNWA  92

Query  591  IQFPTYEKIKIYL---ANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ  421
            + F  Y K+K  L    + DN    +L+     +A+S +    +  T P  VV++RLQ Q
Sbjct  93   VYFTVYGKLKALLHSYVDEDN----QLTIGANMIAASGAGTATAISTNPLWVVKTRLQTQ  148

Query  420  GLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            G+ S    Y  ++  +R++  +EGI G Y G    L+  +  A I F ++E +  +L
Sbjct  149  GMRSGVVPYKSILSALRRISHEEGIRGLYSGLLPALVGVSHVA-IQFPAYENMKAYL  204



>ref|XP_006604086.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Glycine max]
Length=289

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 2/179 (1%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMR   VPY+  LSAL RI  EEGIRGLYSG+VP+LAGVSHVAIQF
Sbjct  59   TNPLWVVKTRLQTQGMRPDVVPYKSVLSALTRITHEEGIRGLYSGIVPSLAGVSHVAIQF  118

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
            P YEKIK Y+A +DNT++DKL+  +VAVASS+SK+FAS MTYPHEV+RSRLQEQG     
Sbjct  119  PAYEKIKSYIAEKDNTTVDKLTPGSVAVASSISKVFASVMTYPHEVIRSRLQEQGQAKNI  178

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
              +Y+GVIDC +KVFQ+EGIPGFYRGCATNL RTTP+AVITFTS+EMIHRFL  V P D
Sbjct  179  GVQYAGVIDCTKKVFQKEGIPGFYRGCATNLFRTTPSAVITFTSYEMIHRFLERVVPQD  237


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 70/131 (53%), Gaps = 5/131 (4%)
 Frame = -2

Query  639  LYSGLVPAL-AGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTM  463
            +Y GL P + A + + A+ F +YE++K  L +RD    ++L+     +A++ +    +  
Sbjct  1    MYRGLSPTIVALLPNWAVYFTSYEQLKGLLRSRDG--CNELTTIGSIIAAAGAGAATAIS  58

Query  462  TYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVIT  286
            T P  VV++RLQ QG+  +   Y  V+  + ++  +EGI G Y G   +L   +  A I 
Sbjct  59   TNPLWVVKTRLQTQGMRPDVVPYKSVLSALTRITHEEGIRGLYSGIVPSLAGVSHVA-IQ  117

Query  285  FTSFEMIHRFL  253
            F ++E I  ++
Sbjct  118  FPAYEKIKSYI  128



>gb|KHN47916.1| Mitochondrial substrate carrier family protein W [Glycine soja]
Length=336

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = -2

Query  765  ATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQ  586
            +TN LWVV TRLQTQGMR   VPY+  LSAL RI  EEGIRGLYSG+VP+LAGVSHVAIQ
Sbjct  132  STNPLWVVKTRLQTQGMRPDVVPYKSVLSALTRITHEEGIRGLYSGIVPSLAGVSHVAIQ  191

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            FP YEKIK Y+A +DNT++DKL+  +VA+ASS+SK+FAS MTYPHEV+RSRLQEQG    
Sbjct  192  FPAYEKIKSYMAEKDNTTVDKLTPGSVAIASSISKVFASVMTYPHEVIRSRLQEQGQAKN  251

Query  405  --KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
               +Y+GVIDC +KVFQ+EGIPGFYRGCATNL+RTTP+AVITFTS+EMIHRFL  V P D
Sbjct  252  IGVQYTGVIDCTKKVFQKEGIPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLERVVPQD  311


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 94/171 (55%), Gaps = 10/171 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQF  583
            L V+ TRLQ  G+  G    +G+  +++L+ I R EG RG+Y GL P + A + + A+ F
Sbjct  38   LDVIKTRLQVHGLPHG---QKGSVIITSLQNIVRNEGFRGMYRGLSPTIVALLPNWAVYF  94

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
             +YE++K  L +RD    D+L+     +A++ +    +  T P  VV++RLQ QG+  + 
Sbjct  95   TSYEQLKGLLRSRDGC--DELTTIGNIIAAAGAGAATAISTNPLWVVKTRLQTQGMRPDV  152

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  V+  + ++  +EGI G Y G   +L   +  A I F ++E I  ++
Sbjct  153  VPYKSVLSALTRITHEEGIRGLYSGIVPSLAGVSHVA-IQFPAYEKIKSYM  202



>ref|XP_006587243.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Glycine max]
Length=365

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = -2

Query  765  ATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQ  586
            +TN LWVV TRLQTQGMR   VPY+  LSAL RI  EEGIRGLYSG+VP+LAGVSHVAIQ
Sbjct  132  STNPLWVVKTRLQTQGMRPDVVPYKSVLSALTRITHEEGIRGLYSGIVPSLAGVSHVAIQ  191

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            FP YEKIK Y+A +DNT++DKL+  +VA+ASS+SK+FAS MTYPHEV+RSRLQEQG    
Sbjct  192  FPAYEKIKSYMAEKDNTTVDKLTPGSVAIASSISKVFASVMTYPHEVIRSRLQEQGQAKN  251

Query  405  --KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
               +Y+GVIDC +KVFQ+EGIPGFYRGCATNL+RTTP+AVITFTS+EMIHRFL  V P D
Sbjct  252  IGVQYTGVIDCTKKVFQKEGIPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLERVVPQD  311


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 94/171 (55%), Gaps = 10/171 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQF  583
            L V+ TRLQ  G+  G    +G+  +++L+ I R EG RG+Y GL P + A + + A+ F
Sbjct  38   LDVIKTRLQVHGLPHG---QKGSVIITSLQNIVRNEGFRGMYRGLSPTIVALLPNWAVYF  94

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
             +YE++K  L +RD    D+L+     +A++ +    +  T P  VV++RLQ QG+  + 
Sbjct  95   TSYEQLKGLLRSRDG--CDELTTIGNIIAAAGAGAATAISTNPLWVVKTRLQTQGMRPDV  152

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  V+  + ++  +EGI G Y G   +L   +  A I F ++E I  ++
Sbjct  153  VPYKSVLSALTRITHEEGIRGLYSGIVPSLAGVSHVA-IQFPAYEKIKSYM  202



>gb|KCW86299.1| hypothetical protein EUGRSUZ_B02991, partial [Eucalyptus grandis]
Length=337

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +I TN LWVV TRLQTQGMR   VPY G  SAL RI REEG+RGLYSG++P+L GVSHVA
Sbjct  119  SITTNPLWVVKTRLQTQGMRPDVVPYAGVPSALCRIVREEGLRGLYSGILPSLVGVSHVA  178

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK Y+A +DNT++DKLSA +VA+ASS+SK+ AS +TYPHEVVRSRLQEQG  
Sbjct  179  IQFPAYEKIKCYIAKKDNTTVDKLSAGSVAIASSISKLTASVVTYPHEVVRSRLQEQGHG  238

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            ++ RY GV+DCVRKVF++EGIPGFYRGCATNLIRT P+AVITFTS+EMIHRFL  V  PD
Sbjct  239  AKVRYVGVVDCVRKVFRKEGIPGFYRGCATNLIRTIPSAVITFTSYEMIHRFLAQVLLPD  298


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 99/171 (58%), Gaps = 9/171 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  G+ +G   ++G++  ++LR I R+EG++GLY GL P  LA + + A+ F
Sbjct  26   LDVIKTRLQVHGVPSG---HKGSIIITSLRNIVRQEGVKGLYRGLSPTILALLPNWAVYF  82

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
              YE++K  + + D+   +++S     +A+  +    S  T P  VV++RLQ QG+  + 
Sbjct  83   TVYERLKGLVHSHDDNG-NQVSTGANMLAAVGAGAATSITTNPLWVVKTRLQTQGMRPDV  141

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y+GV   + ++ ++EG+ G Y G   +L+  +  A I F ++E I  ++
Sbjct  142  VPYAGVPSALCRIVREEGLRGLYSGILPSLVGVSHVA-IQFPAYEKIKCYI  191



>ref|XP_010279335.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Nelumbo nucifera]
Length=370

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQG+R+G VPY+  LSALRRI+ EEGIRGLYSGL+PALAGVSHVAIQFP
Sbjct  136  NPLWVVKTRLQTQGVRSGVVPYKSILSALRRISHEEGIRGLYSGLLPALAGVSHVAIQFP  195

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEK+K YLA R+NT++D LS  +VA+ASSVSKI ASTMTYPHEVVRSRLQEQG   + E
Sbjct  196  VYEKMKAYLARRENTTVDNLSPGHVAIASSVSKILASTMTYPHEVVRSRLQEQGQARNPE  255

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQ  226
              Y+GV DC++KVF ++G+PGFYRGCATNL+RTTPAA+ITFTSFEMI RFL  V PP+ Q
Sbjct  256  VHYAGVTDCIKKVFHKDGLPGFYRGCATNLLRTTPAAIITFTSFEMIQRFLHRVLPPEQQ  315


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 94/177 (53%), Gaps = 17/177 (10%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT-----LSALRRIAREEGIRGLYSGLVPA-LAGVSHVA  592
            L V+ TRLQ  G+    +P+ G+     +++L+ I + EG++G+Y GL P  LA + + A
Sbjct  35   LDVIKTRLQVHGLPN--LPHSGSRGSLIITSLQNIIKNEGMKGMYRGLSPTILALLPNWA  92

Query  591  IQFPTYEKIKIYL---ANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ  421
            + F  YEK+K  L    +RDN    +L+     VA++ +    +  T P  VV++RLQ Q
Sbjct  93   VYFTVYEKLKGLLHSHVDRDN----QLTVGANMVAATGAGAATAIATNPLWVVKTRLQTQ  148

Query  420  GLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            G+ S    Y  ++  +R++  +EGI G Y G    L   +  A I F  +E +  +L
Sbjct  149  GVRSGVVPYKSILSALRRISHEEGIRGLYSGLLPALAGVSHVA-IQFPVYEKMKAYL  204



>gb|KHG03180.1| Mitochondrial substrate carrier family protein W [Gossypium arboreum]
Length=359

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G VPY G LSALRRI  EEG+RGLYSG++P+LAG+SHVAIQFP
Sbjct  142  NPLWVVKTRLQTQGMRTGVVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVAIQFP  201

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK Y+A + NT++D+L+ S+VA+ASS+SK+ AS MTYPHEV+RSRLQEQG   H+E
Sbjct  202  AYEKIKSYMAKKGNTTVDRLTPSDVAIASSISKVLASIMTYPHEVIRSRLQEQGQARHTE  261

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
             +Y+GV+DC+RKVF++EG+ GFYRGCATNL+RTTP+AVITFTS+EMIHRFL  V PP+
Sbjct  262  VQYAGVVDCIRKVFRKEGVSGFYRGCATNLLRTTPSAVITFTSYEMIHRFLHQVLPPE  319


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 95/172 (55%), Gaps = 7/172 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     R +  +++L+ I + EG++GLY GL P  +A + + A+ 
Sbjct  41   LDVIKTRLQVHGLPTASKTGVRDSVIITSLQHIIKTEGLKGLYRGLSPTIIALLPNWAVY  100

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L   DN S  +L+     VA++ +    +  T P  VV++RLQ QG+ + 
Sbjct  101  FTVYEQLKGLLTPHDNNSA-QLTIGENMVAAAGAGAATAITTNPLWVVKTRLQTQGMRTG  159

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y+GV+  +R++  +EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  160  VVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVA-IQFPAYEKIKSYM  210



>ref|XP_009383545.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   259 bits (663),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 146/186 (78%), Gaps = 13/186 (7%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWVV TR Q Q +R G VPY+GTL++LRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  130  TIVTNPLWVVKTRFQAQELRVGMVPYQGTLNSLRRIAHEEGIRGLYSGLVPALAGISHVA  189

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK  LA R   S             S+SKI AST+TYPHEVVRS+LQEQG H
Sbjct  190  IQFPAYEKIKCCLAERAVAS-------------SISKIVASTLTYPHEVVRSKLQEQGFH  236

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            +E +Y GVIDC++KVF+++GI GFY GCATNL+RTTPAAVITFTSFEMIHRFL ++FPP+
Sbjct  237  AEMQYKGVIDCIKKVFRKDGISGFYHGCATNLLRTTPAAVITFTSFEMIHRFLTNLFPPE  296

Query  231  PQPQPL  214
              P  L
Sbjct  297  SNPHVL  302


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 87/168 (52%), Gaps = 8/168 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTL--SALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQ  586
            L V+ TRLQ  G+ +      +G++   +L +I + EG+ G+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPKIDSNGAKGSIIIRSLEQIVKREGVLGMYRGLSPTVLALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  YE+ K  L++ D     +LS      A+S + +  + +T P  VV++R Q Q L   
Sbjct  94   FTVYEQSKSLLSSNDGN--HQLSIGANMFAASGAGVATTIVTNPLWVVKTRFQAQELRVG  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMI  265
               Y G ++ +R++  +EGI G Y G    L   +  A I F ++E I
Sbjct  152  MVPYQGTLNSLRRIAHEEGIRGLYSGLVPALAGISHVA-IQFPAYEKI  198



>ref|XP_008782321.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Phoenix dactylifera]
Length=360

 Score =   261 bits (668),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 151/178 (85%), Gaps = 4/178 (2%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G VPYR  +SAL+RI+ EEGIRGLYSGL+PAL GVSHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGMRPGVVPYRSIMSALKRISHEEGIRGLYSGLLPALVGVSHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE--  406
             YEKIK YLA RDNT++DKLSA NVA+ASS+SKI ASTMTYPHEVVRSRLQEQG H+   
Sbjct  195  AYEKIKSYLARRDNTTVDKLSAGNVAIASSLSKILASTMTYPHEVVRSRLQEQG-HARSA  253

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
               Y+G +DC +KVFQ++GI GFYRGCATNL+RTTPAAVITFTS+EMI RFL   FPP
Sbjct  254  VNHYAGALDCTKKVFQKDGIRGFYRGCATNLLRTTPAAVITFTSYEMIQRFLRRAFPP  311


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPY---RGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVA  592
            L V+ TRLQ  G+ +  +P    RG+L  S+L +I + EG RG+Y GL P  LA + + A
Sbjct  34   LDVIKTRLQVHGLPS--LPSSARRGSLIVSSLEQIIKTEGFRGMYRGLSPTILALLPNWA  91

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  Y+K+K  L +  + + ++LS     +A+S +    +  T P  VV++RLQ QG+ 
Sbjct  92   VYFTVYDKLKGKLLSHADIN-NQLSIGANIIAASGAGAATAIATNPLWVVKTRLQTQGMR  150

Query  411  -SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                 Y  ++  ++++  +EGI G Y G    L+  +  A I F ++E I  +L 
Sbjct  151  PGVVPYRSIMSALKRISHEEGIRGLYSGLLPALVGVSHVA-IQFPAYEKIKSYLA  204



>ref|XP_006842368.1| hypothetical protein AMTR_s00079p00187170 [Amborella trichopoda]
 gb|ERN04043.1| hypothetical protein AMTR_s00079p00187170 [Amborella trichopoda]
Length=345

 Score =   261 bits (667),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 156/183 (85%), Gaps = 2/183 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN LWVV TRLQTQGMR+G VPY   LS+LRRIA EEGIRGLYSGL+PALAGVSHVAI
Sbjct  129  LTTNPLWVVKTRLQTQGMRSGVVPYGSILSSLRRIAHEEGIRGLYSGLLPALAGVSHVAI  188

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEK+K YLA R+NT+ DKLSA NVA+ASSVSK+ ASTMTYPHEVVRSRLQEQG   
Sbjct  189  QFPVYEKLKAYLAARENTTPDKLSAGNVAIASSVSKVLASTMTYPHEVVRSRLQEQGQAR  248

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            +SE  Y+GVIDC++KV+ +EG+ GFYRGCATNL+RTTPAAVITF S+EMI RFL  VFP 
Sbjct  249  NSETHYTGVIDCIKKVYHKEGMAGFYRGCATNLLRTTPAAVITFVSYEMIQRFLHRVFPL  308

Query  234  DPQ  226
            + Q
Sbjct  309  ERQ  311


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 91/171 (53%), Gaps = 4/171 (2%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVP-ALAGVSHVAIQFPT  577
            L V+ TRLQ  G+          +++L++I + EG+RGLY GL P  LA + + A+ F  
Sbjct  34   LDVIKTRLQVHGLPKHAQGGSLIVASLKQIVKTEGVRGLYRGLSPTVLALLPNWAVYFTI  93

Query  576  YEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KR  400
            YE++K  L + D  + ++LS     +A+S +    +  T P  VV++RLQ QG+ S    
Sbjct  94   YEQVKGLLQSHDRGN-NQLSIGKHMLAASCAGAATALTTNPLWVVKTRLQTQGMRSGVVP  152

Query  399  YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
            Y  ++  +R++  +EGI G Y G    L   +  A I F  +E +  +L +
Sbjct  153  YGSILSSLRRIAHEEGIRGLYSGLLPALAGVSHVA-IQFPVYEKLKAYLAA  202



>ref|XP_003553860.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X1 [Glycine max]
 gb|KHN07803.1| Mitochondrial substrate carrier family protein W [Glycine soja]
Length=363

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 2/179 (1%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMR   VPY+  LSAL RI  EEGIRGLYSG+VP+LAGVSHVAIQF
Sbjct  133  TNPLWVVKTRLQTQGMRPDVVPYKSVLSALTRITHEEGIRGLYSGIVPSLAGVSHVAIQF  192

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
            P YEKIK Y+A +DNT++DKL+  +VAVASS+SK+FAS MTYPHEV+RSRLQEQG     
Sbjct  193  PAYEKIKSYIAEKDNTTVDKLTPGSVAVASSISKVFASVMTYPHEVIRSRLQEQGQAKNI  252

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
              +Y+GVIDC +KVFQ+EGIPGFYRGCATNL RTTP+AVITFTS+EMIHRFL  V P D
Sbjct  253  GVQYAGVIDCTKKVFQKEGIPGFYRGCATNLFRTTPSAVITFTSYEMIHRFLERVVPQD  311


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 94/171 (55%), Gaps = 10/171 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQF  583
            L V+ TRLQ  G+  G    +G++  ++L+ I R EG RG+Y GL P + A + + A+ F
Sbjct  38   LDVIKTRLQVHGLPHG---QKGSIIITSLQNIVRNEGFRGMYRGLSPTIVALLPNWAVYF  94

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
             +YE++K  L +RD    ++L+     +A++ +    +  T P  VV++RLQ QG+  + 
Sbjct  95   TSYEQLKGLLRSRDG--CNELTTIGSIIAAAGAGAATAISTNPLWVVKTRLQTQGMRPDV  152

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  V+  + ++  +EGI G Y G   +L   +  A I F ++E I  ++
Sbjct  153  VPYKSVLSALTRITHEEGIRGLYSGIVPSLAGVSHVA-IQFPAYEKIKSYI  202



>ref|XP_004516758.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Cicer arietinum]
Length=363

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 155/180 (86%), Gaps = 2/180 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +I+TN LWVV TRLQTQGMR   VPY+  L+AL RI  EEG+RGLYSG+VP+LAGVSHVA
Sbjct  130  SISTNPLWVVKTRLQTQGMRPDVVPYKSVLAALTRITHEEGLRGLYSGIVPSLAGVSHVA  189

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK+Y+A +DNT++DKLS  NVA+ASS+SK+ AS MTYPHEV+RSRLQEQG  
Sbjct  190  IQFPAYEKIKLYMAKKDNTTVDKLSPGNVAIASSISKVTASVMTYPHEVIRSRLQEQGQA  249

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +S  +Y+GVIDC +KVFQ+EGIPGFYRGCATNL+RTTP+AVITFTS+EMIHRFL+   P
Sbjct  250  KNSGVQYAGVIDCTKKVFQKEGIPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLMRNIP  309


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 90/172 (52%), Gaps = 12/172 (7%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+   + G V     +++L+ I R EG RG+Y GL P  LA + + A+ 
Sbjct  38   LDVIKTRLQVHGLPPVQKGSV----IVTSLQNIVRTEGFRGMYRGLSPTILALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L + D     +L+     +A++ +    S  T P  VV++RLQ QG+  +
Sbjct  94   FTCYEQLKGLLRSHD--GCHELTTIGNIIAAAGAGAATSISTNPLWVVKTRLQTQGMRPD  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y  V+  + ++  +EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  152  VVPYKSVLAALTRITHEEGLRGLYSGIVPSLAGVSHVA-IQFPAYEKIKLYM  202



>ref|XP_008797621.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
Length=278

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 149/179 (83%), Gaps = 2/179 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQ MR G VPYR  LSA RRI  EEG +GLYSGL+P+LAGVSHV+I
Sbjct  99   IVTNPLWVVKTRLQTQAMRPGVVPYRSLLSAFRRIMHEEGFQGLYSGLLPSLAGVSHVSI  158

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK YLA RDNT++DKLS  +VA+ASS+SKI ASTMTYPHEVVRSRLQEQG   
Sbjct  159  QFPAYEKIKYYLARRDNTTVDKLSPGSVAIASSLSKIVASTMTYPHEVVRSRLQEQGQAR  218

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +  +Y+GV DC++KVFQ+EGIPGFYRGC TNL+RTTP AVITFTS+EMI RFL  VFP
Sbjct  219  DTANQYTGVADCIKKVFQKEGIPGFYRGCGTNLLRTTPTAVITFTSYEMIKRFLHQVFP  277


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%), Gaps = 4/146 (3%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            +S+L  + + EG++GLY GL P + A +   A+ F  Y+++K  L +  + + +  S   
Sbjct  27   ISSLEHVIKNEGVKGLYRGLSPTITALLPTWAVYFTVYDQLKGLLQSHVDGN-NHFSIGA  85

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRG  331
              +A+S +    S +T P  VV++RLQ Q +      Y  ++   R++  +EG  G Y G
Sbjct  86   NIIAASGAGAATSIVTNPLWVVKTRLQTQAMRPGVVPYRSLLSAFRRIMHEEGFQGLYSG  145

Query  330  CATNLIRTTPAAVITFTSFEMIHRFL  253
               +L   +  + I F ++E I  +L
Sbjct  146  LLPSLAGVSHVS-IQFPAYEKIKYYL  170



>gb|AFK34832.1| unknown [Lotus japonicus]
Length=277

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 152/180 (84%), Gaps = 2/180 (1%)
 Frame = -2

Query  765  ATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQ  586
            +TN LWVV TRLQTQGMR+  VPY+  LSAL RIA EEG+RGLYSG++P+LAGVSHVAIQ
Sbjct  58   STNPLWVVKTRLQTQGMRSDVVPYKSVLSALTRIAHEEGVRGLYSGILPSLAGVSHVAIQ  117

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            FP YEKIK+Y+A +DNT++DKLS  NVA+ASS+SKI AS +TYPHEV+RSRLQEQG+   
Sbjct  118  FPAYEKIKLYMAEKDNTTVDKLSPGNVAIASSISKITASLLTYPHEVIRSRLQEQGIAKN  177

Query  405  K--RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
                Y+GVIDC +KVFQ+EGI GFYRGCATNL+RTTP+AVITFTS+EMIHRFL    P D
Sbjct  178  NGVHYAGVIDCTKKVFQKEGIRGFYRGCATNLLRTTPSAVITFTSYEMIHRFLDRAIPKD  237



>ref|XP_008797620.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=311

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 149/179 (83%), Gaps = 2/179 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQ MR G VPYR  LSA RRI  EEG +GLYSGL+P+LAGVSHV+I
Sbjct  132  IVTNPLWVVKTRLQTQAMRPGVVPYRSLLSAFRRIMHEEGFQGLYSGLLPSLAGVSHVSI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK YLA RDNT++DKLS  +VA+ASS+SKI ASTMTYPHEVVRSRLQEQG   
Sbjct  192  QFPAYEKIKYYLARRDNTTVDKLSPGSVAIASSLSKIVASTMTYPHEVVRSRLQEQGQAR  251

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +  +Y+GV DC++KVFQ+EGIPGFYRGC TNL+RTTP AVITFTS+EMI RFL  VFP
Sbjct  252  DTANQYTGVADCIKKVFQKEGIPGFYRGCGTNLLRTTPTAVITFTSYEMIKRFLHQVFP  310


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 86/171 (50%), Gaps = 6/171 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQF  583
            L V+ TR Q  G+     P R +  +S+L  + + EG++GLY GL P + A +   A+ F
Sbjct  35   LDVIKTRFQVHGLPKMPPPARRSVIISSLEHVIKNEGVKGLYRGLSPTITALLPTWAVYF  94

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
              Y+++K  L +  + + +  S     +A+S +    S +T P  VV++RLQ Q +    
Sbjct  95   TVYDQLKGLLQSHVDGN-NHFSIGANIIAASGAGAATSIVTNPLWVVKTRLQTQAMRPGV  153

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  ++   R++  +EG  G Y G   +L   +  + I F ++E I  +L
Sbjct  154  VPYRSLLSAFRRIMHEEGFQGLYSGLLPSLAGVSHVS-IQFPAYEKIKYYL  203



>ref|XP_010099268.1| hypothetical protein L484_015458 [Morus notabilis]
 gb|EXB77532.1| hypothetical protein L484_015458 [Morus notabilis]
Length=318

 Score =   257 bits (657),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 151/178 (85%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR   +PY+  LSAL RIA EEGIRGLYSG+VP+L G+SHVAIQFP
Sbjct  83   NPLWVVKTRLQTQGMRQDVIPYKSILSALTRIAHEEGIRGLYSGVVPSLVGISHVAIQFP  142

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK-  403
             YEKIK Y+A R+NTS+DKL   +VA+ASS+SK+ AS  TYPHEVVRSRLQEQG    K 
Sbjct  143  AYEKIKSYMAKRENTSVDKLGPGSVAIASSISKVIASVATYPHEVVRSRLQEQGQARNKV  202

Query  402  -RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
             +Y+G++DCV+KVFQ+EG+PGFYRGCATNL+RTTP+A+ITFTS+EM+HRFL SV PP+
Sbjct  203  VQYAGLVDCVKKVFQREGLPGFYRGCATNLMRTTPSAIITFTSYEMMHRFLQSVIPPN  260



>ref|XP_010925998.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Elaeis guineensis]
Length=360

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 156/189 (83%), Gaps = 7/189 (4%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQG+R G VPYR  +SAL+RI+ EEGIRGLYSGL+PAL GVSHV IQFP
Sbjct  135  NPLWVVKTRLQTQGVRLGVVPYRSIMSALKRISHEEGIRGLYSGLLPALVGVSHVTIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG--LHSE  406
             YE IK YLA RDNT++DKLSA NVA+ASS+SKI ASTMTYPHEVVRSRLQEQG   +S 
Sbjct  195  AYEMIKSYLARRDNTTVDKLSAGNVAIASSLSKILASTMTYPHEVVRSRLQEQGHARNSV  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD--  232
              Y+G +DC +KVF+++GIPGFYRGCATNL+RTTPAAVITFTS+EMI RFL   FPP+  
Sbjct  255  NHYAGALDCTKKVFRKDGIPGFYRGCATNLLRTTPAAVITFTSYEMIQRFLRRAFPPEQS  314

Query  231  ---PQPQPL  214
                +P+P+
Sbjct  315  HLGARPEPV  323


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 92/173 (53%), Gaps = 7/173 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRG---TLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+       RG    +S+L++I + EG RG+Y GL P  LA + + A+ 
Sbjct  34   LDVIKTRLQVHGLPNLPPSARGGSLIVSSLKQIIKTEGFRGMYRGLSPTILALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y+K+K  L +  + + ++LS     +A+S +    +  T P  VV++RLQ QG+   
Sbjct  94   FTVYDKLKGQLLSHADIN-NQLSIGANVIAASGAGAATAIATNPLWVVKTRLQTQGVRLG  152

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
               Y  ++  ++++  +EGI G Y G    L+  +    I F ++EMI  +L 
Sbjct  153  VVPYRSIMSALKRISHEEGIRGLYSGLLPALVGVS-HVTIQFPAYEMIKSYLA  204



>ref|XP_006448416.1| hypothetical protein CICLE_v10015617mg [Citrus clementina]
 ref|XP_006468740.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Citrus sinensis]
 gb|ESR61656.1| hypothetical protein CICLE_v10015617mg [Citrus clementina]
Length=379

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 153/178 (86%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR+  VPY+  LSALRRI+ EEG+RGLYSG++P+LAGVSHVAIQFP
Sbjct  145  NPLWVVKTRLQTQGMRSNVVPYKSILSALRRISHEEGMRGLYSGILPSLAGVSHVAIQFP  204

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS--E  406
             YE+IK Y+A +D+T +DKL+  +V +ASS++K+ AS MTYPHEVVRSRLQEQG +   +
Sbjct  205  AYERIKHYMAKKDDTDVDKLNPGSVMIASSIAKVLASVMTYPHEVVRSRLQEQGQNRKVD  264

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
             +Y+GV+DCV+KVFQ+EG PGFYRGCATNL+RTTP+AVITFTS+E+I RFL+ V PPD
Sbjct  265  VQYAGVVDCVKKVFQKEGFPGFYRGCATNLLRTTPSAVITFTSYEIIQRFLLRVLPPD  322


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 92/172 (53%), Gaps = 7/172 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAG-FVPYRGTLS--ALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  G     RG++   +L+ I + EG++GLY GL P  LA + + A+ 
Sbjct  44   LDVIKTRLQVHGLPEGTHSGRRGSIIIISLQNILKNEGLKGLYRGLSPTLLALLPNWAVY  103

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L    + +  +LS     +A++ +    +  T P  VV++RLQ QG+ S 
Sbjct  104  FAVYERLKGLLRTHGDGN-SQLSVGKNMIAAAGAGAATAITTNPLWVVKTRLQTQGMRSN  162

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y  ++  +R++  +EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  163  VVPYKSILSALRRISHEEGMRGLYSGILPSLAGVSHVA-IQFPAYERIKHYM  213



>ref|XP_008792834.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Phoenix dactylifera]
 ref|XP_008778231.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Phoenix dactylifera]
Length=311

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G VPYR  LSA RRI  EEG++G YSGL+P+LAGVSHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGMRPGVVPYRNMLSAFRRIVHEEGVQGFYSGLLPSLAGVSHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK YLA RDNT++DKLS  +VA+ASS+SKI ASTMTYPHEVVRSRLQEQG    + 
Sbjct  195  AYEKIKYYLARRDNTTVDKLSPGSVAIASSLSKIIASTMTYPHEVVRSRLQEQGQARDTA  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +Y+GV+DC +KVFQ+EGI GFYRGC TNL+RTTP AVITFTS+EMI RFL  VFP
Sbjct  255  NQYTGVVDCTKKVFQKEGISGFYRGCGTNLLRTTPTAVITFTSYEMIQRFLHRVFP  310


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 91/173 (53%), Gaps = 10/173 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT----LSALRRIAREEGIRGLYSGLVPAL-AGVSHVAI  589
            L V+ TR Q  G+    +P        +S+L +I + EGI+GLY GL P + A + + A+
Sbjct  35   LDVIKTRFQVHGLPK--MPPSAQRSVIISSLEQIIKNEGIKGLYRGLSPTITALLPNWAV  92

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
             F  Y ++K  L + ++ + ++LS     +A+S +    +  T P  VV++RLQ QG+  
Sbjct  93   YFTVYNQLKGLLHSHEDGN-NQLSIRANIIAASGAGAATAVATNPLWVVKTRLQTQGMRP  151

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y  ++   R++  +EG+ GFY G   +L   +  A I F ++E I  +L
Sbjct  152  GVVPYRNMLSAFRRIVHEEGVQGFYSGLLPSLAGVSHVA-IQFPAYEKIKYYL  203



>ref|XP_002315927.2| hypothetical protein POPTR_0010s13120g [Populus trichocarpa]
 gb|EEF02098.2| hypothetical protein POPTR_0010s13120g [Populus trichocarpa]
Length=289

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 153/182 (84%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRLQTQGMR G VPY+  LSALRRI +EEG+ GLYSG++P+LAG+SHVA
Sbjct  52   SIATNPLWVVKTRLQTQGMRPGVVPYKSVLSALRRIKQEEGMLGLYSGILPSLAGISHVA  111

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A + NT+++ LS  +VA+ASSVSK+ AS +TYPHEVVRSRLQEQG  
Sbjct  112  IQFPAYEKIKCYMAKKGNTTVNNLSPGDVAIASSVSKVLASVLTYPHEVVRSRLQEQGQL  171

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +SE  Y+GV+DC++KVFQ+EG  GFYRGCATNL+RTTP+AVITFTS+EMIH+F   +  
Sbjct  172  RNSEAHYAGVVDCIKKVFQKEGFRGFYRGCATNLMRTTPSAVITFTSYEMIHKFFEGILL  231

Query  237  PD  232
            PD
Sbjct  232  PD  233



>ref|XP_009407378.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=309

 Score =   254 bits (650),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMR   VPY+  LSALRRIA EEG RGLYSGL+P+LAGVSHVAI
Sbjct  130  ITTNPLWVVKTRLQTQGMRPEVVPYKSMLSALRRIALEEGRRGLYSGLLPSLAGVSHVAI  189

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG--L  415
            QFP YE+IK YLA RDNT++DKL+  NVA ASS+SKI AST+TYPHEV+R+RLQEQG   
Sbjct  190  QFPAYEQIKSYLARRDNTTVDKLNPGNVATASSLSKIIASTLTYPHEVIRARLQEQGHAH  249

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
            ++  +Y GV+DC+RKV+Q+EGIPGFYRG ATNL+RTTPAAVITFTS+EMIHR L+ + P
Sbjct  250  NNTNKYVGVMDCIRKVYQREGIPGFYRGYATNLLRTTPAAVITFTSYEMIHRRLLQIIP  308


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 89/173 (51%), Gaps = 11/173 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRG----TLSALRRIAREEGIRGLYSGLVPAL-AGVSHVAI  589
            L V+ TRLQ  G+     P        +S+L++I R EGI GLY GL P + A + + A+
Sbjct  34   LDVIKTRLQVHGL-PEMSPSSSRRCIIVSSLKQILRNEGISGLYRGLTPTVTALLPNWAV  92

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
             F  Y ++K  L + D +  ++L      +A+S +    +  T P  VV++RLQ QG+  
Sbjct  93   YFTVYNQLK-SLLHVDKS--NELPFGANMLAASGAGAATAITTNPLWVVKTRLQTQGMRP  149

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            E   Y  ++  +R++  +EG  G Y G   +L   +  A I F ++E I  +L
Sbjct  150  EVVPYKSMLSALRRIALEEGRRGLYSGLLPSLAGVSHVA-IQFPAYEQIKSYL  201



>ref|XP_011076390.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Sesamum indicum]
Length=367

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 151/186 (81%), Gaps = 5/186 (3%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR   VPY+   SALRRIA EEG RG YSGL+P+LAG+SHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGMRQDVVPYKNIFSALRRIAHEEGFRGWYSGLLPSLAGISHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YE+IK YLA RDN S ++LS   VAVASS SK+ AS +TYPHEVVRSRLQEQG   +SE
Sbjct  195  AYERIKFYLAKRDNKSSNELSPWEVAVASSFSKVVASVLTYPHEVVRSRLQEQGQVRNSE  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD--  232
             +Y+GVIDC++KVFQ+EGIPGFYRGCATNL RTTP+AVITFTS+EMIHR L  V PP+  
Sbjct  255  LQYTGVIDCIKKVFQKEGIPGFYRGCATNLFRTTPSAVITFTSYEMIHRILRHVSPPEEK  314

Query  231  -PQPQP  217
             P+P P
Sbjct  315  HPEPHP  320


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 88/172 (51%), Gaps = 7/172 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRG---TLSALRRIAREEGIRGLYSGLVPALAG-VSHVAIQ  586
            L V+ TR Q  G+       RG    L +L+ I R EG++GLY GL P LA  + + A+ 
Sbjct  34   LDVIKTRFQVHGLPEMHPSGRGGSVILVSLQNIVRNEGLKGLYRGLTPTLAALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y  +K  L + +     +L+ ++  +A++ +    +  T P  VV++RLQ QG+  +
Sbjct  94   FTVYGHLKEILHSYEG-GKGQLTIASNMIAAAGAGAATAVATNPLWVVKTRLQTQGMRQD  152

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y  +   +R++  +EG  G+Y G   +L   +  A I F ++E I  +L
Sbjct  153  VVPYKNIFSALRRIAHEEGFRGWYSGLLPSLAGISHVA-IQFPAYERIKFYL  203



>ref|XP_010922196.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X4 [Elaeis guineensis]
Length=310

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQ +R G VPYR  LSALRRI  EEG +GLYSGL+P+LAGVSHVAIQFP
Sbjct  134  NPLWVVKTRLQTQALRPGVVPYRSMLSALRRIVHEEGFQGLYSGLLPSLAGVSHVAIQFP  193

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
            +YEKIK YLA +DNT++D+L   +V +AS++SK+ ASTMTYPHEV+RSRLQEQG    + 
Sbjct  194  SYEKIKYYLARKDNTTVDELGPGSVVIASALSKVVASTMTYPHEVIRSRLQEQGQARDAA  253

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             RY+GV+DC++KVFQ+EGIPGFY GC TNL+RTTP AVITFTS+EMI RFL  +FP
Sbjct  254  NRYTGVVDCIKKVFQKEGIPGFYHGCGTNLLRTTPTAVITFTSYEMIKRFLHQMFP  309


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 86/173 (50%), Gaps = 11/173 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT----LSALRRIAREEGIRGLYSGLVPALAGVSHV-AI  589
            L V+ TR Q  G+    +P        +S+L +I + EGI+GLY GL P +A +    A+
Sbjct  35   LDVIKTRFQVHGLPE--MPPSAQRSVIISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAV  92

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
             F  Y ++K  L + D    ++LS     +A+S +    +  T P  VV++RLQ Q L  
Sbjct  93   YFTVYNQLKYLLQSHDGN--NQLSIGANILAASGAGAATAIGTNPLWVVKTRLQTQALRP  150

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y  ++  +R++  +EG  G Y G   +L   +  A I F S+E I  +L
Sbjct  151  GVVPYRSMLSALRRIVHEEGFQGLYSGLLPSLAGVSHVA-IQFPSYEKIKYYL  202



>ref|XP_010922189.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=311

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQ +R G VPYR  LSALRRI  EEG +GLYSGL+P+LAGVSHVAIQFP
Sbjct  135  NPLWVVKTRLQTQALRPGVVPYRSMLSALRRIVHEEGFQGLYSGLLPSLAGVSHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
            +YEKIK YLA +DNT++D+L   +V +AS++SK+ ASTMTYPHEV+RSRLQEQG    + 
Sbjct  195  SYEKIKYYLARKDNTTVDELGPGSVVIASALSKVVASTMTYPHEVIRSRLQEQGQARDAA  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             RY+GV+DC++KVFQ+EGIPGFY GC TNL+RTTP AVITFTS+EMI RFL  +FP
Sbjct  255  NRYTGVVDCIKKVFQKEGIPGFYHGCGTNLLRTTPTAVITFTSYEMIKRFLHQMFP  310


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 85/173 (49%), Gaps = 10/173 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT----LSALRRIAREEGIRGLYSGLVPALAGVSHV-AI  589
            L V+ TR Q  G+    +P        +S+L +I + EGI+GLY GL P +A +    A+
Sbjct  35   LDVIKTRFQVHGLPE--MPPSAQRSVIISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAV  92

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
             F  Y ++K YL        ++LS     +A+S +    +  T P  VV++RLQ Q L  
Sbjct  93   YFTVYNQLK-YLLQSHVDGNNQLSIGANILAASGAGAATAIGTNPLWVVKTRLQTQALRP  151

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                Y  ++  +R++  +EG  G Y G   +L   +  A I F S+E I  +L
Sbjct  152  GVVPYRSMLSALRRIVHEEGFQGLYSGLLPSLAGVSHVA-IQFPSYEKIKYYL  203



>ref|XP_010644204.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Vitis vinifera]
 emb|CBI26982.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 151/181 (83%), Gaps = 2/181 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQ MR   VPY+G  SAL+RIA+EEGIRGLYSGL+P+LAG++HVAI
Sbjct  135  ITTNPLWVVKTRLQTQTMRPNVVPYKGIFSALKRIAQEEGIRGLYSGLLPSLAGITHVAI  194

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YE++K YLA   +T++D+L   N A+ASS SK+ AS MTYPHEV+RSRLQEQG   
Sbjct  195  QFPAYEQMKSYLAKMGDTTVDELGPGNFAIASSFSKVLASVMTYPHEVIRSRLQEQGQVR  254

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            +SEK YSGVIDC+ KV+++EG+PGFYRGCATNL+RTTP+AVITFTSFEMIHRFL  +  P
Sbjct  255  NSEKHYSGVIDCIEKVYRKEGLPGFYRGCATNLLRTTPSAVITFTSFEMIHRFLQRLLHP  314

Query  234  D  232
            D
Sbjct  315  D  315


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 92/175 (53%), Gaps = 7/175 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+   R   V     +++L  I R EG++G+Y GL P  LA + + A+ 
Sbjct  37   LDVIKTRLQVHGLPEVRHSGVRGSVIITSLENIIRTEGLKGMYRGLSPTILALLPNWAVY  96

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y+K+K  L +  ++S  +L+     +A+S +    +  T P  VV++RLQ Q +   
Sbjct  97   FTVYQKLKDVLHSHVDSS-SQLTIGANVIAASGAGAATAITTNPLWVVKTRLQTQTMRPN  155

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y G+   ++++ Q+EGI G Y G   +L   T  A I F ++E +  +L  +
Sbjct  156  VVPYKGIFSALKRIAQEEGIRGLYSGLLPSLAGITHVA-IQFPAYEQMKSYLAKM  209



>ref|XP_010922203.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X5 [Elaeis guineensis]
Length=301

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQ +R G VPYR  LSALRRI  EEG +GLYSGL+P+LAGVSHVAIQFP
Sbjct  125  NPLWVVKTRLQTQALRPGVVPYRSMLSALRRIVHEEGFQGLYSGLLPSLAGVSHVAIQFP  184

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
            +YEKIK YLA +DNT++D+L   +V +AS++SK+ ASTMTYPHEV+RSRLQEQG    + 
Sbjct  185  SYEKIKYYLARKDNTTVDELGPGSVVIASALSKVVASTMTYPHEVIRSRLQEQGQARDAA  244

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             RY+GV+DC++KVFQ+EGIPGFY GC TNL+RTTP AVITFTS+EMI RFL  +FP
Sbjct  245  NRYTGVVDCIKKVFQKEGIPGFYHGCGTNLLRTTPTAVITFTSYEMIKRFLHQMFP  300


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 75/146 (51%), Gaps = 4/146 (3%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPALAG-VSHVAIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            +S+L +I + EGI+GLY GL P +A  +   A+ F  Y ++K YL        ++LS   
Sbjct  50   ISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAVYFTVYNQLK-YLLQSHVDGNNQLSIGA  108

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRG  331
              +A+S +    +  T P  VV++RLQ Q L      Y  ++  +R++  +EG  G Y G
Sbjct  109  NILAASGAGAATAIGTNPLWVVKTRLQTQALRPGVVPYRSMLSALRRIVHEEGFQGLYSG  168

Query  330  CATNLIRTTPAAVITFTSFEMIHRFL  253
               +L   +  A I F S+E I  +L
Sbjct  169  LLPSLAGVSHVA-IQFPSYEKIKYYL  193



>ref|XP_003614555.1| Mitochondrial substrate carrier family protein W [Medicago truncatula]
 gb|AES97513.1| substrate carrier family protein [Medicago truncatula]
Length=354

 Score =   254 bits (648),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 153/186 (82%), Gaps = 3/186 (2%)
 Frame = -2

Query  765  ATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQ  586
            +TN LWVV TRLQTQGMR   VPY+  LSAL RI  EEG+RGLYSG++P+LAGVSHVAIQ
Sbjct  132  STNPLWVVKTRLQTQGMRPNVVPYKSVLSALTRITHEEGLRGLYSGILPSLAGVSHVAIQ  191

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL---  415
            FP YEKIK+Y+A +DNT++DKL+  +VA+ASS+SK+ AS MTYPHEV+RSRLQEQG    
Sbjct  192  FPAYEKIKLYMAKKDNTTVDKLNPGSVAIASSISKVTASVMTYPHEVIRSRLQEQGQAKN  251

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
             S  +Y+GVIDC +KVFQ+EGI GFYRGCATNL+RTTP+AVITFTS+EMIHRFL    P 
Sbjct  252  SSGVQYAGVIDCTKKVFQKEGIRGFYRGCATNLLRTTPSAVITFTSYEMIHRFLTRTIPQ  311

Query  234  DPQPQP  217
            +   +P
Sbjct  312  NEPNKP  317


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 90/172 (52%), Gaps = 12/172 (7%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+   + G V     +++L+ I R EG RGLY GL P  LA + + A+ 
Sbjct  38   LDVIKTRLQVHGLPPVQKGSV----IVTSLQNIVRTEGFRGLYRGLSPTILALLPNWAVY  93

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE+IK  L  R +   ++L+     +A++ +    +  T P  VV++RLQ QG+   
Sbjct  94   FTCYEQIKGLL--RTHEGCNELTTIGNIIAAAGAGAATAISTNPLWVVKTRLQTQGMRPN  151

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y  V+  + ++  +EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  152  VVPYKSVLSALTRITHEEGLRGLYSGILPSLAGVSHVA-IQFPAYEKIKLYM  202



>ref|XP_010922181.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=319

 Score =   252 bits (644),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQ +R G VPYR  LSALRRI  EEG +GLYSGL+P+LAGVSHVAIQFP
Sbjct  143  NPLWVVKTRLQTQALRPGVVPYRSMLSALRRIVHEEGFQGLYSGLLPSLAGVSHVAIQFP  202

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
            +YEKIK YLA +DNT++D+L   +V +AS++SK+ ASTMTYPHEV+RSRLQEQG    + 
Sbjct  203  SYEKIKYYLARKDNTTVDELGPGSVVIASALSKVVASTMTYPHEVIRSRLQEQGQARDAA  262

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             RY+GV+DC++KVFQ+EGIPGFY GC TNL+RTTP AVITFTS+EMI RFL  +FP
Sbjct  263  NRYTGVVDCIKKVFQKEGIPGFYHGCGTNLLRTTPTAVITFTSYEMIKRFLHQMFP  318


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 76/146 (52%), Gaps = 5/146 (3%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPALAGVSHV-AIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            +S+L +I + EGI+GLY GL P +A +    A+ F  Y ++K  L + D    ++LS   
Sbjct  69   ISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAVYFTVYNQLKYLLQSHDGN--NQLSIGA  126

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRG  331
              +A+S +    +  T P  VV++RLQ Q L      Y  ++  +R++  +EG  G Y G
Sbjct  127  NILAASGAGAATAIGTNPLWVVKTRLQTQALRPGVVPYRSMLSALRRIVHEEGFQGLYSG  186

Query  330  CATNLIRTTPAAVITFTSFEMIHRFL  253
               +L   +  A I F S+E I  +L
Sbjct  187  LLPSLAGVSHVA-IQFPSYEKIKYYL  211



>ref|XP_010922172.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=320

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQ +R G VPYR  LSALRRI  EEG +GLYSGL+P+LAGVSHVAIQFP
Sbjct  144  NPLWVVKTRLQTQALRPGVVPYRSMLSALRRIVHEEGFQGLYSGLLPSLAGVSHVAIQFP  203

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
            +YEKIK YLA +DNT++D+L   +V +AS++SK+ ASTMTYPHEV+RSRLQEQG    + 
Sbjct  204  SYEKIKYYLARKDNTTVDELGPGSVVIASALSKVVASTMTYPHEVIRSRLQEQGQARDAA  263

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             RY+GV+DC++KVFQ+EGIPGFY GC TNL+RTTP AVITFTS+EMI RFL  +FP
Sbjct  264  NRYTGVVDCIKKVFQKEGIPGFYHGCGTNLLRTTPTAVITFTSYEMIKRFLHQMFP  319


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 75/146 (51%), Gaps = 4/146 (3%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPALAGVSHV-AIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            +S+L +I + EGI+GLY GL P +A +    A+ F  Y ++K YL        ++LS   
Sbjct  69   ISSLEQIIKNEGIKGLYRGLSPTIAALLPTWAVYFTVYNQLK-YLLQSHVDGNNQLSIGA  127

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRG  331
              +A+S +    +  T P  VV++RLQ Q L      Y  ++  +R++  +EG  G Y G
Sbjct  128  NILAASGAGAATAIGTNPLWVVKTRLQTQALRPGVVPYRSMLSALRRIVHEEGFQGLYSG  187

Query  330  CATNLIRTTPAAVITFTSFEMIHRFL  253
               +L   +  A I F S+E I  +L
Sbjct  188  LLPSLAGVSHVA-IQFPSYEKIKYYL  212



>gb|KDO76915.1| hypothetical protein CISIN_1g016968mg [Citrus sinensis]
Length=379

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 152/178 (85%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR+  VPY+  LSALRRI+ EEG+RGLYSG++P+LAGVSHVAIQFP
Sbjct  145  NPLWVVKTRLQTQGMRSNVVPYKSILSALRRISHEEGMRGLYSGILPSLAGVSHVAIQFP  204

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS--E  406
             YE+IK Y+A +D+T +DKL+  ++ +ASS++K+ AS +TYPHEVVRSRLQEQG +   +
Sbjct  205  AYERIKHYMAKKDDTDVDKLNPGSIMIASSIAKVLASVITYPHEVVRSRLQEQGQNRKVD  264

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
             +Y+GV+DCV+KVFQ+EG PGFYRGCATNL+RTTP+AVITFTS+E+I  FL+ V PPD
Sbjct  265  VQYAGVVDCVKKVFQKEGFPGFYRGCATNLLRTTPSAVITFTSYEIIQSFLLRVLPPD  322


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 92/172 (53%), Gaps = 7/172 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAG-FVPYRGTLS--ALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  G     RG++   +L+ I + EG++GLY GL P  LA + + A+ 
Sbjct  44   LDVIKTRLQVHGLPEGTHSGRRGSIIIISLQNILKNEGLKGLYRGLSPTLLALLPNWAVY  103

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L    + +  +LS     +A++ +    +  T P  VV++RLQ QG+ S 
Sbjct  104  FAVYERLKGLLRTHGDGN-SQLSVGKNMIAAAGAGAATAITTNPLWVVKTRLQTQGMRSN  162

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y  ++  +R++  +EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  163  VVPYKSILSALRRISHEEGMRGLYSGILPSLAGVSHVA-IQFPAYERIKHYM  213



>ref|XP_004147114.1| PREDICTED: mitochondrial substrate carrier family protein W-like 
[Cucumis sativus]
 ref|XP_004167306.1| PREDICTED: mitochondrial substrate carrier family protein W-like 
[Cucumis sativus]
 gb|KGN51541.1| hypothetical protein Csa_5G576830 [Cucumis sativus]
Length=371

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMR G VPY G +SA  RI REEGIRGLYSG++P+L G+SHVAIQF
Sbjct  133  TNPLWVVKTRLQTQGMRPGVVPYTGMVSAFTRIVREEGIRGLYSGIIPSLVGISHVAIQF  192

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HS  409
            P YE++K Y+A R+NT++DKLS  ++A+ASS+SK+ AS MTYPHEVVRSRLQEQG   + 
Sbjct  193  PAYERLKSYIAKRENTTVDKLSPGHLAIASSLSKVTASVMTYPHEVVRSRLQEQGQARNI  252

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
              +YSGV+DC++KVF++EG+PGFYRGCATNL+RTTP+AVITFTS+EMIHRFL+ V P
Sbjct  253  APQYSGVMDCIKKVFRKEGVPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLLRVIP  309


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 90/169 (53%), Gaps = 4/169 (2%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQFPT  577
            L V+ TRLQ  G+ +G       +++L+ I R EG RG+Y GL P + A + + A+ F  
Sbjct  36   LDVIKTRLQVHGLPSGQSGGSIIITSLQSIMRSEGFRGMYRGLSPTIVALLPNWAVYFTV  95

Query  576  YEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KR  400
            YE +K  L + D     +LS     +A++ +    +  T P  VV++RLQ QG+      
Sbjct  96   YEHLK-GLLHSDGDDGHQLSFGANMLAAAGAGASTAIATNPLWVVKTRLQTQGMRPGVVP  154

Query  399  YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            Y+G++    ++ ++EGI G Y G   +L+  +  A I F ++E +  ++
Sbjct  155  YTGMVSAFTRIVREEGIRGLYSGIIPSLVGISHVA-IQFPAYERLKSYI  202



>ref|XP_006645938.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Oryza brachyantha]
Length=316

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRLQTQGMR G VPY    SALRRI  EEGIRGLYSGL+P+LAGV+HVAI
Sbjct  137  IATNPLWVVKTRLQTQGMRPGVVPYASIWSALRRITAEEGIRGLYSGLLPSLAGVTHVAI  196

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ--GL  415
            Q P YEK+K+Y A RDNT++DKLS   +A+ SS SK+ AS +TYPHEVVRS+LQEQ  G 
Sbjct  197  QLPVYEKVKLYFAKRDNTTVDKLSPGKLAICSSGSKVTASIITYPHEVVRSKLQEQGRGR  256

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
            H    Y+GV+DC+++V+Q+EGIPGFYRGCATNL+RTTP AVITFTS+EMI+RF+  + P
Sbjct  257  HGAVHYTGVLDCIKQVYQKEGIPGFYRGCATNLLRTTPNAVITFTSYEMINRFMHQLLP  315


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFV----PYRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAI  589
            L V+ TRLQ  G+ +       P R  +S  + I + EG+ GLY GL P +  +    A+
Sbjct  38   LDVIKTRLQVYGLPSNLSSTAPPGRVIISGFQHIFKNEGLPGLYRGLSPTIVALFPTWAV  97

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
             F  Y  +K  L ++D+ +  +LS  +  +A+S + I  +  T P  VV++RLQ QG+  
Sbjct  98   TFSVYNHLKGLLHSQDDNA-GELSVQSNILAASCAGIATAIATNPLWVVKTRLQTQGMRP  156

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAV  292
                Y+ +   +R++  +EGI G Y G   +L   T  A+
Sbjct  157  GVVPYASIWSALRRITAEEGIRGLYSGLLPSLAGVTHVAI  196



>gb|KFK41256.1| hypothetical protein AALP_AA2G105900 [Arabis alpina]
Length=306

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 2/180 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            IATN LWVV TRL  QGMR   VPY+  LSA  RI REEG RGLYSG++P+LAGVSHV I
Sbjct  127  IATNPLWVVKTRLIMQGMRPDVVPYKSLLSAFSRICREEGFRGLYSGILPSLAGVSHVVI  186

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK Y+AN  NTS+DKLS  NVAVASS+SK+ AS MTYPHEVVRS+LQ+QG   
Sbjct  187  QFPVYEKIKQYMANVGNTSVDKLSPGNVAVASSISKVIASVMTYPHEVVRSKLQDQGQVR  246

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            + E ++SGVIDC +KVF++EGIPGFYRGCATNL+RTTPAAVITFTS+EM+HRFL+ V  P
Sbjct  247  NKEAQFSGVIDCTKKVFRKEGIPGFYRGCATNLLRTTPAAVITFTSYEMMHRFLLKVVSP  306


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 89/175 (51%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+ +     ++G+  +++L  I + EG RG+Y GL P  +A + + A+ 
Sbjct  32   LDVIKTRLQVLGLPQTPTSGHKGSVIITSLGNIVKNEGFRGMYRGLSPTIIALLPNWAVY  91

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D      LS     VA++ +    +  T P  VV++RL  QG+  +
Sbjct  92   FSVYGKLKDLLQSNDG----NLSIGANMVAAAGAGTSTAIATNPLWVVKTRLIMQGMRPD  147

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  ++    ++ ++EG  G Y G   +L   +   VI F  +E I +++ +V
Sbjct  148  VVPYKSLLSAFSRICREEGFRGLYSGILPSLAGVS-HVVIQFPVYEKIKQYMANV  201



>gb|KDP29452.1| hypothetical protein JCGZ_18373 [Jatropha curcas]
Length=370

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 149/177 (84%), Gaps = 2/177 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G VPY+  +S LRRI  EEGIRGLYSG++P+LAG+SHVAIQFP
Sbjct  138  NPLWVVKTRLQTQGMRPGVVPYKSIISGLRRIVHEEGIRGLYSGILPSLAGISHVAIQFP  197

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK Y+A ++NT++D LS  +VA+ASS +K+ AS +TYPHEVVRSRLQEQG   +SE
Sbjct  198  VYEKIKSYVAEKNNTTVDNLSPGDVAIASSTAKVVASVLTYPHEVVRSRLQEQGQAGNSE  257

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
             RYSG++DCV+KVFQ+EG PGFYRGCATNL+RTTP+A+ITFTS+E + RFL  V PP
Sbjct  258  VRYSGLVDCVKKVFQKEGFPGFYRGCATNLLRTTPSAIITFTSYETMRRFLDRVLPP  314


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 92/176 (52%), Gaps = 15/176 (9%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSH  598
            L V+ TRLQ  G+       RAG V     +++L+ I R EG +GLY GL P  +A + +
Sbjct  37   LDVIKTRLQVHGLPVTPNSGRAGSV----IITSLQNIIRTEGFKGLYRGLSPTIIALLPN  92

Query  597  VAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
             A+ F TYE +K  L +  + + ++L+     VA++ +    +  T P  VV++RLQ QG
Sbjct  93   WAVYFTTYELLKGLLLSHGDAN-NELTIGTNMVAAAGAGAATAITTNPLWVVKTRLQTQG  151

Query  417  LHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            +      Y  +I  +R++  +EGI G Y G   +L   +  A I F  +E I  ++
Sbjct  152  MRPGVVPYKSIISGLRRIVHEEGIRGLYSGILPSLAGISHVA-IQFPVYEKIKSYV  206



>ref|XP_009409783.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=333

 Score =   251 bits (640),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 156/186 (84%), Gaps = 3/186 (2%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN LWVV TRLQTQ +R G VPY+  +SALRRI+ EEGIRG YSGL+PALAG+SHVAI
Sbjct  134  VVTNPLWVVKTRLQTQRIRPGVVPYKSVMSALRRISYEEGIRGFYSGLLPALAGISHVAI  193

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG--L  415
            QFP YE IK++LAN+DNT++DKLSA +VA+ASS+SK+ ASTMTYPHEVVRS+LQEQG   
Sbjct  194  QFPVYENIKLHLANKDNTTVDKLSAGSVAIASSLSKVLASTMTYPHEVVRSKLQEQGHAR  253

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            +S  +Y+GV+DCV+KVF+++GI GFYRGC TNL+RTTPAAVITFTS+EMI RFL   F P
Sbjct  254  NSLTQYAGVVDCVKKVFRKDGISGFYRGCGTNLLRTTPAAVITFTSYEMIQRFL-HQFVP  312

Query  234  DPQPQP  217
              +  P
Sbjct  313  SEESHP  318


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 95/177 (54%), Gaps = 11/177 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPY---RGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVA  592
            L VV TRLQ  G+    +P    RG+L  S+L +I R+EG +G+Y GL P  LA + + A
Sbjct  34   LDVVKTRLQVHGLPN--LPQSSRRGSLIISSLEQIIRKEGFKGMYHGLSPTILALLPNWA  91

Query  591  IQFPTYEKIKIYLANRDNTSMD-KLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            + F  Y+K+K  L + D T +D +LS     +A+S +    + +T P  VV++RLQ Q +
Sbjct  92   VYFTVYDKLKGLLHSHDATKVDNQLSVGANVLAASGAGAATAVVTNPLWVVKTRLQTQRI  151

Query  414  H-SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                  Y  V+  +R++  +EGI GFY G    L   +  A I F  +E I   L +
Sbjct  152  RPGVVPYKSVMSALRRISYEEGIRGFYSGLLPALAGISHVA-IQFPVYENIKLHLAN  207



>ref|XP_009105387.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Brassica rapa]
Length=288

 Score =   249 bits (635),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 149/184 (81%), Gaps = 2/184 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQGMR   +PY+  LSA  RI REEG RGLYSG++P+L GVSHVA
Sbjct  104  SIATNPLWVVKTRLMTQGMRPDVIPYKSMLSAFSRIFREEGFRGLYSGVIPSLVGVSHVA  163

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A   + S+D+LS   VAVASS+SK+ AS  TYPHEVVRS+LQEQG  
Sbjct  164  IQFPVYEKIKQYMAKVGDKSVDQLSPGEVAVASSISKVIASVSTYPHEVVRSKLQEQGQV  223

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +++ +YSGVIDC +KVF+ EG+PGFYRGCATNL+RTTP+AVITFTS+EMIHRFLV V  
Sbjct  224  RNAKAKYSGVIDCAKKVFRNEGVPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLVQVLS  283

Query  237  PDPQ  226
            PD +
Sbjct  284  PDKE  287



>ref|XP_002527012.1| mitochondrial carrier protein, putative [Ricinus communis]
 gb|EEF35384.1| mitochondrial carrier protein, putative [Ricinus communis]
Length=372

 Score =   251 bits (642),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR   VPY+  LSAL RI REEGIRGLYSG++P+LAG+SHVAIQFP
Sbjct  137  NPLWVVKTRLQTQGMRPDVVPYKSILSALGRIIREEGIRGLYSGVLPSLAGISHVAIQFP  196

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK Y+A + + ++D LS  +VA+ASSV+K+ AS +TYPHEVVRSRLQEQG   +S 
Sbjct  197  AYEKIKSYMAKKSSRTVDNLSTGDVAIASSVAKVLASVLTYPHEVVRSRLQEQGQVRNSG  256

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
              Y+GV+DCV+KVFQ+EG PGFYRGCATNL+RTTP+AVITFTS+EMIHRFL  V PPD
Sbjct  257  VHYAGVVDCVKKVFQKEGFPGFYRGCATNLMRTTPSAVITFTSYEMIHRFLDRVLPPD  314


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 93/176 (53%), Gaps = 16/176 (9%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSH  598
            L V+ TRLQ  G+       R G +     +++ + I + EG++GLY GL P  +A + +
Sbjct  37   LDVIKTRLQVHGLPTTSNSGRPGSI----IVTSFQNIIKTEGLKGLYRGLSPTIIALLPN  92

Query  597  VAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
             A+ F  YE++K  L++ D  S  +L+     VA++ +    +  T P  VV++RLQ QG
Sbjct  93   WAVYFTVYEQLKGLLSHGDEHS--ELAVGANMVAAAGAGAATAIATNPLWVVKTRLQTQG  150

Query  417  LHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            +  +   Y  ++  + ++ ++EGI G Y G   +L   +  A I F ++E I  ++
Sbjct  151  MRPDVVPYKSILSALGRIIREEGIRGLYSGVLPSLAGISHVA-IQFPAYEKIKSYM  205



>gb|EEC70751.1| hypothetical protein OsI_02162 [Oryza sativa Indica Group]
 gb|EEE54681.1| hypothetical protein OsJ_01987 [Oryza sativa Japonica Group]
Length=327

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            +ATN LWVV TRLQTQGMR G VPY    SALRRIA EEGIRGLYSGL+P+LAGV+HVAI
Sbjct  148  VATNPLWVVKTRLQTQGMRTGVVPYTSIWSALRRIAEEEGIRGLYSGLLPSLAGVTHVAI  207

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG--L  415
            Q P YE +K+Y A RDNT++DKLS   +A+ SS SK+ AS +TYPHEVVRS+LQEQG   
Sbjct  208  QLPVYENVKLYFAKRDNTTVDKLSPGKLAICSSGSKVAASIITYPHEVVRSKLQEQGRAR  267

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
            H    Y+GVIDC+++V+Q+EGIPGFYRGCATNL+RTTP AVITFTS+EMI+R +  + P
Sbjct  268  HGAVHYTGVIDCIKQVYQKEGIPGFYRGCATNLLRTTPNAVITFTSYEMINRLMHQLLP  326


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 82/172 (48%), Gaps = 20/172 (12%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFV----PYRGTLSALRRIAREEGIRGLYSGLVPALAG-------  607
            L V+ TRLQ  G+ +       P R  +S  + I + EG+ GLY GL P +         
Sbjct  38   LDVIKTRLQVYGLPSNLSSTAPPGRVIISGFQHILKNEGLPGLYRGLSPTIVALFPTWAA  97

Query  606  -----VSHVAIQFPTYEKIKIYLANR-DNTSMDKLsasnvavassvSKIFASTMTYPHEV  445
                 +    + F  Y  +K  L ++ DNT   +LS     +A+S + I  +  T P  V
Sbjct  98   KYCFMIDACLVTFSVYNHLKGLLHSQGDNTG--ELSVQANILAASCAGIATAVATNPLWV  155

Query  444  VRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAV  292
            V++RLQ QG+ +    Y+ +   +R++ ++EGI G Y G   +L   T  A+
Sbjct  156  VKTRLQTQGMRTGVVPYTSIWSALRRIAEEEGIRGLYSGLLPSLAGVTHVAI  207



>ref|XP_009105386.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X1 [Brassica rapa]
Length=313

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 149/184 (81%), Gaps = 2/184 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQGMR   +PY+  LSA  RI REEG RGLYSG++P+L GVSHVA
Sbjct  129  SIATNPLWVVKTRLMTQGMRPDVIPYKSMLSAFSRIFREEGFRGLYSGVIPSLVGVSHVA  188

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A   + S+D+LS   VAVASS+SK+ AS  TYPHEVVRS+LQEQG  
Sbjct  189  IQFPVYEKIKQYMAKVGDKSVDQLSPGEVAVASSISKVIASVSTYPHEVVRSKLQEQGQV  248

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +++ +YSGVIDC +KVF+ EG+PGFYRGCATNL+RTTP+AVITFTS+EMIHRFLV V  
Sbjct  249  RNAKAKYSGVIDCAKKVFRNEGVPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLVQVLS  308

Query  237  PDPQ  226
            PD +
Sbjct  309  PDKE  312


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 89/175 (51%), Gaps = 14/175 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+   R G V     +++L  I ++EG+RG+Y GL P  +  + + A+ 
Sbjct  39   LDVIKTRLQVHGLPETRRGSV----IITSLGNILKKEGVRGMYRGLSPTIIVLLPNWAVY  94

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS     VA+  +    S  T P  VV++RL  QG+  +
Sbjct  95   FSVYGKLKDLLQSSDG----KLSIGANMVAAGGAGASTSIATNPLWVVKTRLMTQGMRPD  150

Query  405  K-RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  ++    ++F++EG  G Y G   +L+  +  A I F  +E I +++  V
Sbjct  151  VIPYKSMLSAFSRIFREEGFRGLYSGVIPSLVGVSHVA-IQFPVYEKIKQYMAKV  204



>ref|XP_004968826.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Setaria italica]
Length=316

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -2

Query  765  ATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQ  586
            ATN LWVV TRLQTQGMR G VPY+  LSAL+RIA+EEGIRGLYSGL+P+L GV+HVAIQ
Sbjct  138  ATNPLWVVKTRLQTQGMRPGVVPYQSILSALQRIAKEEGIRGLYSGLLPSLVGVAHVAIQ  197

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--H  412
             P YEK+K+Y A RDNT++DKLS + VA+ SS SK+ AS +TYPHEVVRS+LQEQG   H
Sbjct  198  LPVYEKVKLYFAKRDNTTVDKLSPTQVAMCSSGSKVAASIITYPHEVVRSKLQEQGRNDH  257

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
               RYSGV DC+++V+++EG PGFYRGCATNL+RTTP AVITFTS+EMI+R +  +  P
Sbjct  258  GAMRYSGVTDCIKQVYKKEGFPGFYRGCATNLLRTTPNAVITFTSYEMINRLMHQLLVP  316


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 83/161 (52%), Gaps = 8/161 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFV-----PYRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVA  592
            L V+ TRLQ  G+ + F      P R  +S  ++I + EG+ GLY GL P +  +    A
Sbjct  37   LDVIKTRLQVYGLPSNFSSGAAPPGRVIISGFQQILKNEGLPGLYRGLSPTIVALFPTWA  96

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  Y  +K  L + D  +  +LS     +A+S + I  +T T P  VV++RLQ QG+ 
Sbjct  97   VTFSVYNHVKGLLHSEDGNN-SELSVQANVLAASCAGIATATATNPLWVVKTRLQTQGMR  155

Query  411  -SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAV  292
                 Y  ++  ++++ ++EGI G Y G   +L+     A+
Sbjct  156  PGVVPYQSILSALQRIAKEEGIRGLYSGLLPSLVGVAHVAI  196



>ref|XP_011007410.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Populus euphratica]
Length=368

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 150/181 (83%), Gaps = 2/181 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMR G VPY+  LSALRRI +EEG+ GLYSG++P+LAG+SHVAI
Sbjct  132  IVTNPLWVVKTRLQTQGMRPGVVPYKSVLSALRRIKQEEGMLGLYSGILPSLAGISHVAI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK Y+A + NT+++ LS  +VA+ASSVSK+ AS +TYPHEVVRSRLQEQG   
Sbjct  192  QFPAYEKIKCYMAKKGNTTVNNLSPGDVAIASSVSKVLASVLTYPHEVVRSRLQEQGQLR  251

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            +SE  Y+GV+DC++KVFQ+EG  GFYRGCATNL+RTTP+AVITFTS+EMIH+F      P
Sbjct  252  NSEAHYAGVVDCIKKVFQKEGFRGFYRGCATNLMRTTPSAVITFTSYEMIHKFFERFLLP  311

Query  234  D  232
            D
Sbjct  312  D  312


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 92/174 (53%), Gaps = 14/174 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT-----LSALRRIAREEGIRGLYSGLVPA-LAGVSHVA  592
            L V+ TRLQ   +     P  G      +S+L+ I + EG +GLY GL P  +A + + A
Sbjct  37   LDVIKTRLQVHALP----PNSGQGGSIIISSLQHIVKTEGFKGLYRGLSPTIMALLPNWA  92

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  YE++K  L+N D  S  +LS     VA++ S    S +T P  VV++RLQ QG+ 
Sbjct  93   VCFTVYEQLKGILSNGDGDS--QLSVGANMVAAAGSGAATSIVTNPLWVVKTRLQTQGMR  150

Query  411  SE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                 Y  V+  +R++ Q+EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  151  PGVVPYKSVLSALRRIKQEEGMLGLYSGILPSLAGISHVA-IQFPAYEKIKCYM  203



>emb|CDY38578.1| BnaC06g30010D [Brassica napus]
Length=334

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 147/184 (80%), Gaps = 2/184 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQGMR   VPY+  LSA  RI +EEG RGLYSG++P+L GVSHVA
Sbjct  150  SIATNPLWVVKTRLMTQGMRPDVVPYKSMLSAFSRICKEEGFRGLYSGVIPSLVGVSHVA  209

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A   +TS+DKLS   VAVASS+SK+ AS  TYPHEVVRS+LQEQG  
Sbjct  210  IQFPVYEKIKQYMAKVGDTSVDKLSPGEVAVASSISKVIASVSTYPHEVVRSKLQEQGQV  269

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
               + +YSGVIDC +KVF  EG+PGFYRGCATNL+RTTP+AVITFTS+EMIHRFLV V  
Sbjct  270  RKVKAKYSGVIDCAKKVFINEGVPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLVQVVS  329

Query  237  PDPQ  226
            P+ +
Sbjct  330  PEKE  333


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 90/175 (51%), Gaps = 14/175 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+   R G V     +++L  I ++EGIRG+Y GL P  +A + + A+ 
Sbjct  60   LDVIKTRLQVHGLPETRRGSV----IITSLGNILKKEGIRGMYRGLSPTIIALLPNWAVY  115

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS     VA++ +    S  T P  VV++RL  QG+  +
Sbjct  116  FSVYGKLKDLLQSSDG----KLSIGANMVAAAGAGASTSIATNPLWVVKTRLMTQGMRPD  171

Query  405  KR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  ++    ++ ++EG  G Y G   +L+  +  A I F  +E I +++  V
Sbjct  172  VVPYKSMLSAFSRICKEEGFRGLYSGVIPSLVGVSHVA-IQFPVYEKIKQYMAKV  225



>emb|CDP00658.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   249 bits (636),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 154/201 (77%), Gaps = 9/201 (4%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQ MR G VPY G LSALRRIA EEGIRG YSGL+P+LAG+SHVAIQFP
Sbjct  138  NPLWVVKTRLQTQRMRQGVVPYHGILSALRRIAHEEGIRGWYSGLLPSLAGISHVAIQFP  197

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG--LHSE  406
             YE +K YLA R++  +++L    VA+ASS+SK+ AS MTYPHEVVRSRLQEQG   + E
Sbjct  198  AYEHLKAYLAKRNSKKINELRPGEVAIASSMSKVVASLMTYPHEVVRSRLQEQGRLRNPE  257

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP---  235
              Y+GVIDC++K+F +EG+PGFYRGCATNL+RTTP+AVITFTS+EMIHRFL S  PP   
Sbjct  258  IHYAGVIDCIKKIFLREGLPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLQSAIPPAER  317

Query  234  ----DPQPQPL*GSISSCIGN  184
                 P+P     S +S  GN
Sbjct  318  RSKAQPKPDSNIDSQNSTAGN  338


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 95/175 (54%), Gaps = 13/175 (7%)
 Frame = -2

Query  753  LWVVXTRLQTQGM----RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPALAG-VSHV  595
            L V+ TRLQ  G+    R+G   +RG+  +++L+ I R EG RGLY GL P LA  + + 
Sbjct  37   LDVIKTRLQVYGLPEMARSG---HRGSVIITSLQNIVRNEGFRGLYRGLSPTLAALLPNW  93

Query  594  AIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            A+ F  Y  +K  L +  ++S  +L+ +   +A+S +    +    P  VV++RLQ Q +
Sbjct  94   AVYFSVYGHLKSLLHSHVDSS-GQLTIAANVIAASGAGAATAVAANPLWVVKTRLQTQRM  152

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                  Y G++  +R++  +EGI G+Y G   +L   +  A I F ++E +  +L
Sbjct  153  RQGVVPYHGILSALRRIAHEEGIRGWYSGLLPSLAGISHVA-IQFPAYEHLKAYL  206



>emb|CDM83064.1| unnamed protein product [Triticum aestivum]
Length=319

 Score =   247 bits (630),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            +ATN LWVV TRLQTQGMR G VPY   LSALRRIA EEG+RGLYSGL+P+LAGV+HVAI
Sbjct  140  VATNPLWVVKTRLQTQGMRPGVVPYTSILSALRRIAAEEGLRGLYSGLLPSLAGVTHVAI  199

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG--L  415
            QFP YEK K+Y+A RDNT++DKL    VA+ SS SKI AS +TYPHEVVRS+LQEQG   
Sbjct  200  QFPVYEKAKLYIAKRDNTTVDKLGPGQVAICSSGSKIAASLITYPHEVVRSKLQEQGRVP  259

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            H   RY GV DC+++V Q+EGI GFYRGCATNL+RTTP AVITFTS+EMI+R +
Sbjct  260  HGAIRYIGVTDCIKQVLQKEGIAGFYRGCATNLLRTTPNAVITFTSYEMINRLM  313


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 88/174 (51%), Gaps = 9/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPY-----RGTLSALRRIAREEGIRGLYSGLVPALAGVSHV-A  592
            L V+ TRLQ  G+ +   P      R  LS L+ I + EG+ GLY GL P +  +    A
Sbjct  40   LDVLKTRLQVYGLPSNLSPGTAPPGRIILSGLQHILKTEGLPGLYRGLSPTIVALYPTWA  99

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  Y  ++  L ++D+ +  +LS     +A+S + I  +  T P  VV++RLQ QG+ 
Sbjct  100  VTFSVYNYVRGLLRSQDDKN-GELSIQENILAASSAGIATAVATNPLWVVKTRLQTQGMR  158

Query  411  SE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                 Y+ ++  +R++  +EG+ G Y G   +L   T  A I F  +E    ++
Sbjct  159  PGVVPYTSILSALRRIAAEEGLRGLYSGLLPSLAGVTHVA-IQFPVYEKAKLYI  211



>ref|XP_009109874.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Brassica rapa]
 emb|CDY36114.1| BnaA08g19340D [Brassica napus]
Length=360

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 151/182 (83%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R G VPY+  +SA  RI +EEG RGLYSGL+P+LAG+SHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICQEEGFRGLYSGLLPSLAGISHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A  DNTS++ LS  +VA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMAKIDNTSVENLSPGSVAIASSIAKVVASVLTYPHEVIRAKLQEQGQM  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +SE +YSGVIDCV+KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  252  RNSENKYSGVIDCVKKVFRSEGIPGMYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 89/175 (51%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG+  +++L+ I + EG RG+Y GL P  +A + + A+ 
Sbjct  38   LDVIKTRLQVLGLPEAPASGKRGSVIITSLQNIVKNEGFRGMYRGLSPTIIALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y K+K  L + D T    LS     VA++ +    S  T P  VV++RL  QG+   
Sbjct  98   FSVYGKLKEVLQSSDGT----LSVGANMVAAAGAGASTSIATNPLWVVKTRLMTQGIRPG  153

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  V+    ++ Q+EG  G Y G   +L   +  A I F ++E I +++  +
Sbjct  154  VVPYKSVMSAFSRICQEEGFRGLYSGLLPSLAGISHVA-IQFPAYEKIKQYMAKI  207



>ref|XP_008467192.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Cucumis melo]
Length=371

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRLQTQGMR G VPY G +SA  RI  EEG RGLYSG++P+L G+SHVAIQF
Sbjct  133  TNPLWVVKTRLQTQGMRPGVVPYTGMVSAFTRIVHEEGFRGLYSGIIPSLVGISHVAIQF  192

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HS  409
            P YE++K Y+A RDNT++DKLS  ++A+ASS+SK+ AS MTYPHEVVRSRLQEQG   + 
Sbjct  193  PAYERLKSYIAKRDNTTVDKLSPGHLAIASSLSKVTASVMTYPHEVVRSRLQEQGQARNI  252

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVF  241
              +YSGV+DC++KVF++EG+PGFYRGCATNL+RTTP+AVITFTS+EMIHRFL+ V 
Sbjct  253  APQYSGVMDCIKKVFRKEGVPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLLRVI  308


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 88/169 (52%), Gaps = 4/169 (2%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQFPT  577
            L V+ TRLQ  G+ +G       +++L+ I R EG RGLY GL P + A + + A+ F  
Sbjct  36   LDVIKTRLQVHGLPSGQRGGSIIVTSLQGIMRSEGFRGLYRGLSPTIVALLPNWAVYFTV  95

Query  576  YEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KR  400
            YE +K  L + D     +LS     VA++ +    +  T P  VV++RLQ QG+      
Sbjct  96   YEHLK-GLLHSDGDVGHQLSFGANMVAAAGAGASTAIATNPLWVVKTRLQTQGMRPGVVP  154

Query  399  YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            Y+G++    ++  +EG  G Y G   +L+  +  A I F ++E +  ++
Sbjct  155  YTGMVSAFTRIVHEEGFRGLYSGIIPSLVGISHVA-IQFPAYERLKSYI  202



>ref|XP_011022458.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Populus euphratica]
Length=369

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 151/181 (83%), Gaps = 2/181 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR   VPY+  LSALRRI +EEG+RGLYSG++P+LAG+SHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGMRPDLVPYKNVLSALRRITQEEGMRGLYSGVLPSLAGISHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK Y+A R NT++D LS ++VA+ASSV+KI AS +TYPHEVVRSRLQEQG   +SE
Sbjct  195  AYEKIKFYMAKRGNTTVDNLSHADVAIASSVAKILASVLTYPHEVVRSRLQEQGCLRNSE  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQ  226
             RY+GV+DC++KV ++EG  GFYRGCATNL+RTTP+AVITFTS+EMI +F   V P D +
Sbjct  255  VRYAGVVDCIKKVSRKEGFRGFYRGCATNLMRTTPSAVITFTSYEMIFKFFERVLPSDKK  314

Query  225  P  223
            P
Sbjct  315  P  315


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 95/170 (56%), Gaps = 6/170 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL-SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQFP  580
            L V+ TRLQ  G+    V   G + S+L+ I + EG RGLY GL P  +A + + A+ F 
Sbjct  37   LDVIKTRLQVHGLPPNSVQGGGVIISSLQHIVKTEGFRGLYRGLSPTIMALLPNWAVYFT  96

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-K  403
             YE++K  L++ D     +LS S   VA++ +    +T+T P  VV++RLQ QG+  +  
Sbjct  97   VYEQLKGILSDVDGDR--QLSISANMVAAAGAGAATATVTNPLWVVKTRLQTQGMRPDLV  154

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             Y  V+  +R++ Q+EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  155  PYKNVLSALRRITQEEGMRGLYSGVLPSLAGISHVA-IQFPAYEKIKFYM  203



>emb|CDX84985.1| BnaC05g20700D [Brassica napus]
Length=376

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 151/182 (83%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R   VPY+  +SA  RI  EEG+RGLYSG++P+LAG+SHVA
Sbjct  147  SIATNPLWVVKTRLMTQGIRTDVVPYKSIMSAFSRICHEEGLRGLYSGILPSLAGISHVA  206

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+AN DNTS+D LS  +VA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  207  IQFPAYEKIKQYMANIDNTSVDNLSPGSVAIASSIAKVLASVLTYPHEVIRAKLQEQGQM  266

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGV+DCV+KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  267  RNAETKYSGVVDCVKKVFRSEGIPGMYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  326

Query  237  PD  232
            P+
Sbjct  327  PE  328


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 94/175 (54%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG+  +++L+ I +++G+RG+Y GL P  +A + + A+ 
Sbjct  53   LDVIKTRLQVVGLPEAPVSGKRGSVIITSLQDIVKKDGLRGMYRGLSPTIIALLPNWAVY  112

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS     VA++ +    S  T P  VV++RL  QG+ ++
Sbjct  113  FSVYGKLKDVLQSSDG----KLSVGANMVAAAGAGAATSIATNPLWVVKTRLMTQGIRTD  168

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  ++    ++  +EG+ G Y G   +L   +  A I F ++E I +++ ++
Sbjct  169  VVPYKSIMSAFSRICHEEGLRGLYSGILPSLAGISHVA-IQFPAYEKIKQYMANI  222



>ref|XP_009115307.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
[Brassica rapa]
 emb|CDY42111.1| BnaA09g28490D [Brassica napus]
Length=361

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 151/182 (83%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R   VPY+  +SA  RI  EEG+RGLYSG++P+LAG+SHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRTDVVPYKSIISAFSRICHEEGLRGLYSGILPSLAGISHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+AN DNTS+D LS  +VA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMANIDNTSVDNLSPGSVAIASSIAKVLASVLTYPHEVIRAKLQEQGQM  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGV+DCV+KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  252  RNAETKYSGVVDCVKKVFRSEGIPGMYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 93/175 (53%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG+  +++L+ I +++G RG+Y GL P  +A + + A+ 
Sbjct  38   LDVIKTRLQVVGLPEAPASGKRGSVIITSLQGIVKKDGFRGMYRGLSPTIIALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS     VA++ +    S  T P  VV++RL  QG+ ++
Sbjct  98   FSVYGKLKDVLQSSDG----KLSVGANMVAAAGAGAATSIATNPLWVVKTRLMTQGIRTD  153

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  +I    ++  +EG+ G Y G   +L   +  A I F ++E I +++ ++
Sbjct  154  VVPYKSIISAFSRICHEEGLRGLYSGILPSLAGISHVA-IQFPAYEKIKQYMANI  207



>emb|CDY24409.1| BnaCnng04760D [Brassica napus]
Length=360

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R G VPY+  +SA  RI +EEG RGLYSGL+P+LAG+SHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICQEEGFRGLYSGLLPSLAGISHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A  DNTS++ LS   VA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMAKIDNTSVENLSPGRVAIASSIAKVVASVLTYPHEVIRAKLQEQGQI  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +SE +YSGVIDCV+KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  252  RNSENKYSGVIDCVKKVFRSEGIPGMYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 89/175 (51%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG+  +++L+ I + EG RG+Y GL P  +A + + A+ 
Sbjct  38   LDVIKTRLQVLGLPEAPASGKRGSVIITSLQNIVKNEGFRGMYRGLSPTIIALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y K+K  L + D T    LS     VA++ +    S  T P  VV++RL  QG+   
Sbjct  98   FSVYGKLKDVLQSSDGT----LSVGANMVAAAGAGASTSIATNPLWVVKTRLMTQGIRPG  153

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  V+    ++ Q+EG  G Y G   +L   +  A I F ++E I +++  +
Sbjct  154  VVPYKSVMSAFSRICQEEGFRGLYSGLLPSLAGISHVA-IQFPAYEKIKQYMAKI  207



>gb|EPS70095.1| hypothetical protein M569_04665, partial [Genlisea aurea]
Length=326

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 146/177 (82%), Gaps = 2/177 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR   VPY    SALRRIA EEGIRG YSGL+P+L G+SHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGMRQDVVPYSSICSALRRIAHEEGIRGWYSGLLPSLVGISHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
            TYE+IK YLA R + S +KLS + +AVASS+SKI AS MTYPHEV+RSRLQEQG   +S+
Sbjct  195  TYERIKYYLATRKDNSSNKLSPAEIAVASSLSKIVASVMTYPHEVIRSRLQEQGQVRNSD  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
             +Y GV+DC++KVF++EGIPGFYRGCATNL+RTTP+A ITFTS+EMIHRF + V  P
Sbjct  255  VKYQGVVDCMKKVFKKEGIPGFYRGCATNLLRTTPSAAITFTSYEMIHRFFLHVSSP  311


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 92/176 (52%), Gaps = 11/176 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLS-----ALRRIAREEGIRGLYSGLVPALAG-VSHVA  592
            L V+ TRLQ  G+  G  P  G +      +++ I + EG +GLY GL P LA  + + A
Sbjct  34   LDVIKTRLQVHGLPEGRNP-SGRIGGVIVVSMKNIIQNEGFKGLYRGLTPTLAALLPNWA  92

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  Y  +K  L +    S ++LS     +A++ +    +  T P  VV++RLQ QG+ 
Sbjct  93   VYFAVYGHLKEILHSYG--SANQLSIGLNMIAAAGAGAATAVATNPLWVVKTRLQTQGMR  150

Query  411  SE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
             +   YS +   +R++  +EGI G+Y G   +L+  +  A I F ++E I  +L +
Sbjct  151  QDVVPYSSICSALRRIAHEEGIRGWYSGLLPSLVGISHVA-IQFPTYERIKYYLAT  205



>gb|KFK41414.1| hypothetical protein AALP_AA2G127900 [Arabis alpina]
Length=209

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN LWVV TRL  QGMR   VPY+  LSA  RI REEG RGLYSG++P+LAGVSHV IQF
Sbjct  32   TNPLWVVKTRLIMQGMRPDVVPYKSLLSAFSRICREEGFRGLYSGILPSLAGVSHVVIQF  91

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HS  409
            P YEKIK Y+AN  NTS+DKLS  NVAVASS+SK+ AS MTYPHEVVRS+LQ+QG   + 
Sbjct  92   PVYEKIKQYMANVGNTSVDKLSPGNVAVASSISKVIASVMTYPHEVVRSKLQDQGQVRNV  151

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            E RY+GV+DC +KVF++EGI GFYRGCATNL+RTTPAAVITFT++EM+HRFL+ V  P
Sbjct  152  EARYTGVMDCTKKVFRKEGILGFYRGCATNLLRTTPAAVITFTTYEMMHRFLLKVVYP  209



>ref|XP_006344160.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Solanum tuberosum]
Length=363

 Score =   246 bits (629),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 150/189 (79%), Gaps = 4/189 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +I TN LWVV TRLQTQGMR G VPY+G +SAL RI  EEGIRGLYSGL+P+LAG+SHVA
Sbjct  131  SITTNPLWVVKTRLQTQGMREGVVPYKGIMSALIRITHEEGIRGLYSGLLPSLAGISHVA  190

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEK+K YLA R N   ++L+   VA+ASS++K+ AS MTYPHEVVRS+LQEQG  
Sbjct  191  IQFPAYEKLKSYLAKRANKHTNELNPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQV  250

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +SEK Y+GV+DCV+K+F+QE +  FYRGC TNL+RTTP+AVITFTS+EMIHR L     
Sbjct  251  RNSEKAYNGVVDCVKKMFKQERLTAFYRGCGTNLLRTTPSAVITFTSYEMIHRILQRAIL  310

Query  237  P--DPQPQP  217
            P  D +P P
Sbjct  311  PEEDSEPHP  319


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 90/176 (51%), Gaps = 15/176 (9%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPAL-AGVSH  598
            L V+ TRLQ  G+       R G V     +++L+ I R EG RGLY GL P L A + +
Sbjct  34   LDVIKTRLQVHGLPQVSQSGRQGSV----IVTSLQNILRTEGFRGLYRGLSPTLTALLPN  89

Query  597  VAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
             A+ F  Y  +K  L +  ++S  +L+     +A++ +    S  T P  VV++RLQ QG
Sbjct  90   WAVYFTVYRHLKDSLHSHVDSS-GELTIGANMLAAAGAGAATSITTNPLWVVKTRLQTQG  148

Query  417  LHSEKR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            +      Y G++  + ++  +EGI G Y G   +L   +  A I F ++E +  +L
Sbjct  149  MREGVVPYKGIMSALIRITHEEGIRGLYSGLLPSLAGISHVA-IQFPAYEKLKSYL  203



>ref|XP_008339642.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Malus domestica]
Length=368

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 147/174 (84%), Gaps = 2/174 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I+TN LWVV TRLQTQGMR G +PY+   SA  RIA EEG+RGLYSG++P+LAG+SHVAI
Sbjct  131  ISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAFSRIATEEGLRGLYSGILPSLAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK ++A RDNT++DKL  S VA ASSVSK+ AS +TYPHEVVRSRLQEQG   
Sbjct  191  QFPAYEKIKSFMAKRDNTTVDKLHPSRVAFASSVSKVIASVITYPHEVVRSRLQEQGQAR  250

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            H E +Y+GVIDC++KVFQ+EG+ GFY GCATNL+RTTP+AVITFTS+EMI RFL
Sbjct  251  HIEPQYAGVIDCMKKVFQKEGLRGFYNGCATNLLRTTPSAVITFTSYEMIDRFL  304


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 91/171 (53%), Gaps = 9/171 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  GM +G    RG++  ++L++I + EG++G+Y GL P  LA + + A+ F
Sbjct  37   LDVIKTRLQVHGMPSG---QRGSIIVTSLQKILKTEGVKGMYRGLSPTILALLPNWAVYF  93

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
              YE++K  L    +  + +L+     +A++ +    +  T P  VV++RLQ QG+    
Sbjct  94   TVYEQLKGLLHTHVH-GIGELTIGENMIAAAGAGAATAISTNPLWVVKTRLQTQGMRPGV  152

Query  402  -RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  +     ++  +EG+ G Y G   +L   +  A I F ++E I  F+
Sbjct  153  IPYKSMRSAFSRIATEEGLRGLYSGILPSLAGISHVA-IQFPAYEKIKSFM  202



>ref|XP_004238908.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic 
[Solanum lycopersicum]
Length=365

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 150/189 (79%), Gaps = 4/189 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +I TN LWVV TRL TQGMR G VPY+G LSAL RI  EEGIRGLYSGL+P+LAG+SHVA
Sbjct  133  SITTNPLWVVKTRLMTQGMREGVVPYKGILSALIRITHEEGIRGLYSGLLPSLAGISHVA  192

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEK+K YLA R N   ++L++  VA+ASS++KI AS MTYPHEVVRS+LQEQG  
Sbjct  193  IQFPAYEKLKSYLAKRANKHTNELNSGEVAIASSMAKILASVMTYPHEVVRSKLQEQGQV  252

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +SEK Y+GV+DCV+K+F+QE +  FYRGC TNL+RTTP+AVITFTS+EMIH+ L     
Sbjct  253  RNSEKAYNGVVDCVKKMFKQERLTAFYRGCGTNLLRTTPSAVITFTSYEMIHKILQRAIL  312

Query  237  P--DPQPQP  217
            P  D +P P
Sbjct  313  PEKDSEPNP  321


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 90/176 (51%), Gaps = 15/176 (9%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPAL-AGVSH  598
            L V+ TRLQ  G+       R G V     +++L+ I R EG RGLY GL P L A + +
Sbjct  36   LDVIKTRLQVHGLPQVSQSARQGSV----IVTSLQNILRTEGFRGLYRGLSPTLTALLPN  91

Query  597  VAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
             A+ F  YE +K  L +  ++S  +L+     +A++ +    S  T P  VV++RL  QG
Sbjct  92   WAVYFTVYEHLKDSLHSHVDSS-GQLTIGANMLAAAGAGAATSITTNPLWVVKTRLMTQG  150

Query  417  LHSEKR-YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            +      Y G++  + ++  +EGI G Y G   +L   +  A I F ++E +  +L
Sbjct  151  MREGVVPYKGILSALIRITHEEGIRGLYSGLLPSLAGISHVA-IQFPAYEKLKSYL  205



>gb|AAG50815.1|AC079281_17 mitochondrial carrier protein, putative [Arabidopsis thaliana]
Length=311

 Score =   244 bits (623),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R G VPY+  +SA  RI  EEG+RGLYSG++P+LAGVSHVA
Sbjct  80   SIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHVA  139

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A  DNTS++ LS  NVA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  140  IQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIASILTYPHEVIRAKLQEQGQI  199

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGVIDC+ KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  200  RNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  259

Query  237  PD  232
            P+
Sbjct  260  PE  261



>gb|EYU40785.1| hypothetical protein MIMGU_mgv1a008842mg [Erythranthe guttata]
Length=360

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 147/174 (84%), Gaps = 2/174 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR   VPY+   SAL RIAREEG RG YSGL+P+LAG++HVAIQFP
Sbjct  138  NPLWVVKTRLQTQGMRQDVVPYKNIFSALTRIAREEGFRGWYSGLLPSLAGITHVAIQFP  197

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
            TYE++K YLA R+N S+D+L+   VA+ASS SK+ AS +TYPHEV+RSRLQEQG   + E
Sbjct  198  TYERMKFYLAKRENKSIDELNPWEVAIASSFSKVVASILTYPHEVIRSRLQEQGQVRNCE  257

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
             +Y+GV+DCV+KVF++EGIPGFYRGCATNL+RTTP+AVITFTS+EMI RFL+ V
Sbjct  258  LQYAGVVDCVKKVFRKEGIPGFYRGCATNLLRTTPSAVITFTSYEMIRRFLLRV  311


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 93/176 (53%), Gaps = 15/176 (9%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPAL-AGVSH  598
            L V+ TRLQ +G+       R G V     L +L+ I R EG++GLY GL P L A + +
Sbjct  37   LDVIKTRLQVRGLPEMQPSGRRGSV----ILVSLQSIVRNEGVKGLYRGLTPTLTALLPN  92

Query  597  VAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
             A+ F  Y  +K  L + +  S D+LS S+  +A++ +    +  T P  VV++RLQ QG
Sbjct  93   WAVYFTVYGHLKEVLHSYEG-SKDQLSISSNMIAAAGAGAATAIATNPLWVVKTRLQTQG  151

Query  417  LHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            +  +   Y  +   + ++ ++EG  G+Y G   +L   T  A I F ++E +  +L
Sbjct  152  MRQDVVPYKNIFSALTRIAREEGFRGWYSGLLPSLAGITHVA-IQFPTYERMKFYL  206



>gb|KFK44519.1| hypothetical protein AALP_AA1G267200 [Arabis alpina]
Length=366

 Score =   246 bits (628),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R   VPY+  +SA  RI +EEG RGLYSG++P+LAGVSHVA
Sbjct  134  SIATNPLWVVKTRLMTQGIRPDVVPYKSVMSAFSRICQEEGFRGLYSGILPSLAGVSHVA  193

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+AN DNTS++ LS  N A+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  194  IQFPAYEKIKQYMANMDNTSVENLSTGNFAIASSIAKVIASVLTYPHEVIRAKLQEQGQM  253

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +Y+GVIDCV+KVF+ EG PGFYRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  254  RNAETKYAGVIDCVKKVFKSEGAPGFYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  313

Query  237  PD  232
            P+
Sbjct  314  PE  315


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 91/175 (52%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG+  +++L+ I + EG RG+Y GL P  +A + + A+ 
Sbjct  40   LDVIKTRLQVLGLPEAPASGQRGSVIITSLQNIVKNEGFRGMYRGLSPTIIALLPNWAVY  99

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS     VA++ +    S  T P  VV++RL  QG+  +
Sbjct  100  FSVYGKLKEVLQSSDG----KLSIGANMVAAAGAGAATSIATNPLWVVKTRLMTQGIRPD  155

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  V+    ++ Q+EG  G Y G   +L   +  A I F ++E I +++ ++
Sbjct  156  VVPYKSVMSAFSRICQEEGFRGLYSGILPSLAGVSHVA-IQFPAYEKIKQYMANM  209



>ref|XP_010046584.1| PREDICTED: uncharacterized protein LOC104435557 [Eucalyptus grandis]
Length=1027

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +I TN LWVV TRLQTQGMR   VPY G  SAL RI REEG+RGLYSG++P+L GVSHVA
Sbjct  809  SITTNPLWVVKTRLQTQGMRPDVVPYAGVPSALCRIVREEGLRGLYSGILPSLVGVSHVA  868

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            IQFP YEKIK Y+A +DNT++DKLSA +VA+ASS+SK+ AS +TYPHEVVRSRLQEQG  
Sbjct  869  IQFPAYEKIKCYIAKKDNTTVDKLSAGSVAIASSISKLTASVVTYPHEVVRSRLQEQGHG  928

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            ++ RY GV+DCVRKVF++EGIPGFYRGCATNLIRT P+AVITFTS+EMIHRFL  V  PD
Sbjct  929  AKVRYVGVVDCVRKVFRKEGIPGFYRGCATNLIRTIPSAVITFTSYEMIHRFLAQVLLPD  988


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 98/169 (58%), Gaps = 9/169 (5%)
 Frame = -2

Query  747  VVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQFPT  577
            V+ TRLQ  G+ +G   ++G++  ++LR I R+EG++GLY GL P  LA + + A+ F  
Sbjct  718  VIKTRLQVHGVPSG---HKGSIIITSLRNIVRQEGVKGLYRGLSPTILALLPNWAVYFTV  774

Query  576  YEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KR  400
            YE++K  + + D+   +++S     +A+  +    S  T P  VV++RLQ QG+  +   
Sbjct  775  YERLKGLVHSHDDNG-NQVSTGANMLAAVGAGAATSITTNPLWVVKTRLQTQGMRPDVVP  833

Query  399  YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            Y+GV   + ++ ++EG+ G Y G   +L+  +  A I F ++E I  ++
Sbjct  834  YAGVPSALCRIVREEGLRGLYSGILPSLVGVSHVA-IQFPAYEKIKCYI  881



>ref|XP_010559229.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Tarenaya hassleriana]
Length=356

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN  WVV TRL TQGMR   VPY+  LSA  RI  EEG+RG YSG++P+LAGVSHVAIQF
Sbjct  134  TNPFWVVKTRLMTQGMRPDVVPYKSVLSAFSRICHEEGLRGFYSGILPSLAGVSHVAIQF  193

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HS  409
            P YE IK Y+A   NT++DKLS S+VA++SS+SK+ AS MTYPHEVVRS+LQEQG   + 
Sbjct  194  PAYEMIKQYMATIGNTTVDKLSPSDVAISSSISKVIASVMTYPHEVVRSKLQEQGQVRNV  253

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
              +YSG++DC++KVF++EGIPGFYRGCATNL+RTTP+AVITFTS+EMIHRFL+ V PPD
Sbjct  254  TVQYSGLVDCIKKVFRKEGIPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLLQVVPPD  312


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 90/174 (52%), Gaps = 9/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  G+       RG   +++L+ I R EG RGLY GL P  +A + + A+ F
Sbjct  38   LDVIKTRLQVLGLPETPTGQRGGVIITSLQNIIRNEGFRGLYRGLSPTIIALLPNWAVYF  97

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
              Y K+K  L + D     KL      +A++ +    +  T P  VV++RL  QG+  + 
Sbjct  98   TVYGKLKDLLQSSDG----KLGVGANMIAAAGAGASTAIATNPFWVVKTRLMTQGMRPDV  153

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
              Y  V+    ++  +EG+ GFY G   +L   +  A I F ++EMI +++ ++
Sbjct  154  VPYKSVLSAFSRICHEEGLRGFYSGILPSLAGVSHVA-IQFPAYEMIKQYMATI  206



>ref|XP_002457880.1| hypothetical protein SORBIDRAFT_03g017840 [Sorghum bicolor]
 gb|EES03000.1| hypothetical protein SORBIDRAFT_03g017840 [Sorghum bicolor]
Length=312

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -2

Query  765  ATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQ  586
            ATN LWVV TRLQTQGMR G VPY+  LSAL+RIA+EEGIRGLYSGL+P+L GV+HVAIQ
Sbjct  134  ATNPLWVVKTRLQTQGMRPGVVPYQSILSALQRIAKEEGIRGLYSGLLPSLVGVAHVAIQ  193

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--H  412
             P YEK+K+Y A RDNT++  LS ++VA+ SS SK+ AS +TYPHEVVRS+LQEQG   H
Sbjct  194  LPVYEKVKLYFARRDNTTVYNLSPTHVAICSSGSKVAASIITYPHEVVRSKLQEQGRDHH  253

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
               RYSGV DC+++V+Q+EG PGFYRGCATNL+RTTP AVITFTS+EMI+R +  +  P
Sbjct  254  GATRYSGVADCIKQVYQKEGFPGFYRGCATNLLRTTPNAVITFTSYEMINRLMHQLLAP  312


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 83/160 (52%), Gaps = 10/160 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFV----PYRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAI  589
            L V+ TRLQ  G+ + F     P R  +S  ++I + EG+ GLY GL P +  +    A+
Sbjct  37   LDVIKTRLQVYGLPSNFSGAPPPGRVLISGFQQILKNEGLPGLYRGLSPTIVALFPTWAV  96

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-  412
             F  Y  +K  L ++D     +LS     +A+S + I  +T T P  VV++RLQ QG+  
Sbjct  97   TFSVYNHVKGVLHSKDG----ELSVQANVLAASCAGIATATATNPLWVVKTRLQTQGMRP  152

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAV  292
                Y  ++  ++++ ++EGI G Y G   +L+     A+
Sbjct  153  GVVPYQSILSALQRIAKEEGIRGLYSGLLPSLVGVAHVAI  192



>ref|XP_009356235.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Pyrus x bretschneideri]
Length=374

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I+TN LWVV TRLQTQGMR G +PY+   SA  RI  EEG+RGLYSG++P+LAGVSHVAI
Sbjct  131  ISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAFSRITTEEGLRGLYSGILPSLAGVSHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK ++A RDNT++DKL  S VA ASSVSK+ AS +TYPHEVVRSRLQEQG   
Sbjct  191  QFPAYEKIKSFMAKRDNTTVDKLHPSRVAFASSVSKVIASVITYPHEVVRSRLQEQGQAR  250

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
            H   +Y+GVIDC++KVFQ+EG+ GFY GCATNLIRTTP+AVITFTS+EMI RFL  V  P
Sbjct  251  HIGTQYAGVIDCIKKVFQKEGLRGFYNGCATNLIRTTPSAVITFTSYEMIDRFLRRVVLP  310

Query  234  D  232
            +
Sbjct  311  E  311


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 92/171 (54%), Gaps = 9/171 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  GM +G    RG++  ++L++I + EG++G+Y GL P  LA + + A+ F
Sbjct  37   LDVIKTRLQVHGMPSG---QRGSIIVTSLQKILKTEGVKGMYRGLSPTILALLPNWAVYF  93

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
              YE++K  L +  + S  +L+     +A++ +    +  T P  VV++RLQ QG+    
Sbjct  94   TVYEQLKGRLHSHVHGS-GELTIGENMIAAAGAGAATAISTNPLWVVKTRLQTQGMRPGV  152

Query  402  -RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  +     ++  +EG+ G Y G   +L   +  A I F ++E I  F+
Sbjct  153  IPYKSMRSAFSRITTEEGLRGLYSGILPSLAGVSHVA-IQFPAYEKIKSFM  202



>ref|XP_009357098.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Pyrus x bretschneideri]
Length=368

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 147/174 (84%), Gaps = 2/174 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I+TN LWVV TRLQTQGMR G +PY+   SA  RIA EEG+RGLYSG++P+LAG+SHVAI
Sbjct  131  ISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAFSRIATEEGLRGLYSGILPSLAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK ++A RD+T++DKL  S VA ASSVSK+ AS +TYPHEVVRSRLQEQG   
Sbjct  191  QFPAYEKIKSFMAKRDDTTVDKLHPSRVAFASSVSKVIASVITYPHEVVRSRLQEQGQAR  250

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            H E +Y+GVIDC++KVFQ+EG+ GFY GCATNL+RTTP+AVITFTS+EMI RFL
Sbjct  251  HIEPQYAGVIDCMKKVFQKEGLRGFYNGCATNLLRTTPSAVITFTSYEMIDRFL  304


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 91/171 (53%), Gaps = 9/171 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  GM +G    RG++  ++L++I + EG++G+Y GL P  LA + + A+ F
Sbjct  37   LDVIKTRLQVHGMPSG---QRGSIIVTSLQKIVKTEGVKGMYRGLSPTILALLPNWAVYF  93

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
              YE++K  L    + S  +L+     +A++ +    +  T P  VV++RLQ QG+    
Sbjct  94   TVYEQLKGLLHTHVHGS-GELTIGENMIAAAGAGAATAISTNPLWVVKTRLQTQGMRPGV  152

Query  402  -RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  +     ++  +EG+ G Y G   +L   +  A I F ++E I  F+
Sbjct  153  IPYKSMRSAFSRIATEEGLRGLYSGILPSLAGISHVA-IQFPAYEKIKSFM  202



>emb|CAN76447.1| hypothetical protein VITISV_010118 [Vitis vinifera]
Length=410

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 152/196 (78%), Gaps = 12/196 (6%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYS----------GLVP  619
            I TN LWVV TRLQTQ MR   VPY+G  SAL+RIA+EEGIRGLY           GL+P
Sbjct  162  ITTNPLWVVKTRLQTQTMRPNVVPYKGIFSALKRIAQEEGIRGLYRSVSLXLMFKIGLLP  221

Query  618  ALAGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVR  439
            +LAG++HVAIQFP YE++K YLA   +T++D+L   N A+ASS SK+ AS MTYPHEV+R
Sbjct  222  SLAGITHVAIQFPAYEQMKSYLAKMGDTTVDELGPGNFAIASSFSKVLASVMTYPHEVIR  281

Query  438  SRLQEQGL--HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMI  265
            SRLQEQG   +SEK YSGVIDC+ KV+++EG+PGFYRGCATNL+RTTP+AVITFTSFEMI
Sbjct  282  SRLQEQGQVRNSEKHYSGVIDCIEKVYRKEGLPGFYRGCATNLLRTTPSAVITFTSFEMI  341

Query  264  HRFLVSVFPPDPQPQP  217
            HRFL  V  PD +  P
Sbjct  342  HRFLQRVLHPDAKHSP  357


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 71/126 (56%), Gaps = 3/126 (2%)
 Frame = -2

Query  684  LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasn  508
            +++L  I R EG++G+Y GL P  LA + + A+ F  Y+K+K  L +  ++S  +L+   
Sbjct  90   ITSLENIIRTEGLKGMYRGLSPTILALLPNWAVYFTVYQKLKDVLHSHVDSS-SQLTIGA  148

Query  507  vavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKR-YSGVIDCVRKVFQQEGIPGFYRG  331
              +A+S +    +  T P  VV++RLQ Q +      Y G+   ++++ Q+EGI G YR 
Sbjct  149  NVIAASGAGAATAITTNPLWVVKTRLQTQTMRPNVVPYKGIFSALKRIAQEEGIRGLYRS  208

Query  330  CATNLI  313
             +  L+
Sbjct  209  VSLXLM  214



>ref|XP_006304969.1| hypothetical protein CARUB_v10012042mg [Capsella rubella]
 gb|EOA37867.1| hypothetical protein CARUB_v10012042mg [Capsella rubella]
Length=363

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R   VPY+  +SA  RI  EEG+RGLYSG++P+LAGVSHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRPDVVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+AN DNTS++ LS  NVA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMANMDNTSVENLSPGNVAIASSIAKVIASVLTYPHEVIRAKLQEQGQM  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGVIDC+ KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  252  RNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 92/175 (53%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG   +++L+ I + EGIRG+Y GL P  +A + + A+ 
Sbjct  38   LDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIVKNEGIRGMYRGLSPTIIALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS  +  VA++ +    S  T P  VV++RL  QG+  +
Sbjct  98   FSVYGKLKDVLQSSDG----KLSIGSNMVAAAGAGAATSIATNPLWVVKTRLMTQGIRPD  153

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  V+    ++  +EG+ G Y G   +L   +  A I F ++E I +++ ++
Sbjct  154  VVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHVA-IQFPAYEKIKQYMANM  207



>emb|CAI38581.1| mitochondrial carrier like protein [Arabidopsis thaliana]
Length=363

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R G VPY+  +SA  RI  EEG+RGLYSG++P+LAGVSHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A  DNTS++ LS  NVA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIASILTYPHEVIRAKLQEQGQI  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGVIDC+ KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  252  RNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 91/175 (52%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG   +++L+ I +EEG RG+Y GL+P  +A + + A+ 
Sbjct  38   LDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLLPTIIALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y K+K  L + D     KLS  +  +A++ +    S  T P  VV++RL  QG+   
Sbjct  98   FSVYGKLKDVLQSSDG----KLSIGSNMIAAAGAGAATSIATNPLWVVKTRLMTQGIRPG  153

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  V+    ++  +EG+ G Y G   +L   +  A I F ++E I +++  +
Sbjct  154  VVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHVA-IQFPAYEKIKQYMAKM  207



>ref|NP_564233.1| NAD+ transporter 2 [Arabidopsis thaliana]
 sp|Q8RWA5.1|NDT2_ARATH RecName: Full=Nicotinamide adenine dinucleotide transporter 2, 
mitochondrial; Short=AtNDT2; AltName: Full=NAD(+) transporter 
2 [Arabidopsis thaliana]
 gb|AAM13231.1| unknown protein [Arabidopsis thaliana]
 gb|AAP42759.1| At1g25380 [Arabidopsis thaliana]
 emb|CAR70089.1| mitochondrial nicotinamide adenine dinucleotide transporter 2 
[Arabidopsis thaliana]
 gb|AEE30615.1| NAD+ transporter 2 [Arabidopsis thaliana]
Length=363

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R G VPY+  +SA  RI  EEG+RGLYSG++P+LAGVSHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A  DNTS++ LS  NVA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIASILTYPHEVIRAKLQEQGQI  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGVIDC+ KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  252  RNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 90/175 (51%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG   +++L+ I +EEG RG+Y GL P  +A + + A+ 
Sbjct  38   LDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-S  409
            F  Y K+K  L + D     KLS  +  +A++ +    S  T P  VV++RL  QG+   
Sbjct  98   FSVYGKLKDVLQSSDG----KLSIGSNMIAAAGAGAATSIATNPLWVVKTRLMTQGIRPG  153

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  V+    ++  +EG+ G Y G   +L   +  A I F ++E I +++  +
Sbjct  154  VVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHVA-IQFPAYEKIKQYMAKM  207



>ref|XP_004299043.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=368

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I+TN LWVV TRLQTQGMR G +PY+   SA  RIA EEG+RGLYSG++P+LAG+SHVAI
Sbjct  131  ISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAFTRIATEEGLRGLYSGIIPSLAGISHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK  +A  D+T++DKL    VAVASS+SKI AS +TYPHEV+RSRLQEQG   
Sbjct  191  QFPAYEKIKSIMAKEDSTTVDKLKPGRVAVASSISKILASVITYPHEVIRSRLQEQGQAR  250

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            H + +Y+GVIDC++KVF +EG+PGFY GCATNLIRTTP+AVITFTS+EMI RFL
Sbjct  251  HIQPKYAGVIDCIKKVFLKEGLPGFYNGCATNLIRTTPSAVITFTSYEMIDRFL  304


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 89/171 (52%), Gaps = 10/171 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  GM  G    RG++  ++L+ I + EGIRG+Y GL P  LA + + A+ F
Sbjct  38   LDVIKTRLQVHGMPTG---QRGSIIVTSLQNILKTEGIRGMYRGLSPTILALLPNWAVYF  94

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
              YE++K  L + ++ S   +  + +A A + +    S  T P  VV++RLQ QG+    
Sbjct  95   TVYEQLKGLLQSHEDGSERSIGENMIAAAGAGAATAIS--TNPLWVVKTRLQTQGMRPGV  152

Query  402  -RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  +     ++  +EG+ G Y G   +L   +  A I F ++E I   +
Sbjct  153  IPYKSMRSAFTRIATEEGLRGLYSGIIPSLAGISHVA-IQFPAYEKIKSIM  202



>ref|XP_010681639.1| PREDICTED: nicotinamide adenine dinucleotide transporter 1, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=354

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 146/176 (83%), Gaps = 2/176 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR   +PY+  LSALRRI REEGI GLYSGL+P+LAG+SHVAIQFP
Sbjct  139  NPLWVVKTRLQTQGMRTDVIPYKSILSALRRITREEGIPGLYSGLLPSLAGISHVAIQFP  198

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YE+IK+YLA  +NT++D+LSA +VA+ASS+SKI AS MTYPHEV+RSRLQEQG   + E
Sbjct  199  AYERIKLYLAKTENTTVDELSAGSVAIASSLSKIVASIMTYPHEVIRSRLQEQGQVRNRE  258

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
              YSGV+DCVRKVFQ EG+ GFYRGCATNL+RT P +VITFTS+EMI R L  V P
Sbjct  259  VHYSGVVDCVRKVFQAEGLAGFYRGCATNLMRTVPNSVITFTSYEMILRLLTRVVP  314


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 95/171 (56%), Gaps = 6/171 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  G+       +G++  ++L+ I ++EG RGLY GL P  LA +   A+ F
Sbjct  39   LDVIKTRLQVHGLPVTSTSTKGSIIITSLQDIVKKEGFRGLYRGLSPTILALLPTWAVYF  98

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            P YE +K  L  +D+   ++L+     +A+  +    +  T P  VV++RLQ QG+ ++ 
Sbjct  99   PVYEHLK-GLLQKDDHGTEQLTIVKNMIAAGGAGAATAVATNPLWVVKTRLQTQGMRTDV  157

Query  402  -RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  ++  +R++ ++EGIPG Y G   +L   +  A I F ++E I  +L
Sbjct  158  IPYKSILSALRRITREEGIPGLYSGLLPSLAGISHVA-IQFPAYERIKLYL  207



>gb|AAG28807.1|AC079374_10 unknown protein [Arabidopsis thaliana]
Length=376

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R G VPY+  +SA  RI  EEG+RGLYSG++P+LAGVSHVA
Sbjct  145  SIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHVA  204

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A  DNTS++ LS  NVA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  205  IQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIASILTYPHEVIRAKLQEQGQI  264

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGVIDC+ KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  265  RNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  324

Query  237  PD  232
            P+
Sbjct  325  PE  326


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 88/188 (47%), Gaps = 23/188 (12%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPALAGV-------  604
            L V+ TRLQ  G+  A     RG   +++L+ I +EEG RG+Y GL P +  +       
Sbjct  38   LDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLPNWAVS  97

Query  603  -------SHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEV  445
                     + + F  Y K+K  L + D     KLS  +  +A++ +    S  T P  V
Sbjct  98   TTVLYRALFLQVYFSVYGKLKDVLQSSDG----KLSIGSNMIAAAGAGAATSIATNPLWV  153

Query  444  VRSRLQEQGLH-SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEM  268
            V++RL  QG+      Y  V+    ++  +EG+ G Y G   +L   +  A I F ++E 
Sbjct  154  VKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHVA-IQFPAYEK  212

Query  267  IHRFLVSV  244
            I +++  +
Sbjct  213  IKQYMAKM  220



>ref|XP_006415866.1| hypothetical protein EUTSA_v10007992mg [Eutrema salsugineum]
 gb|ESQ34219.1| hypothetical protein EUTSA_v10007992mg [Eutrema salsugineum]
Length=365

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R   +PY+  +SA  RI  EEG+RGLYSG++P+LAG+SHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRPDVIPYKSVMSAFSRICHEEGLRGLYSGILPSLAGISHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+AN DNTS++ LS  NVA+ASSV+K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMANMDNTSVENLSPGNVAIASSVAKVLASVLTYPHEVIRAKLQEQGQM  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +Y GVIDCV+KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  252  RNAETKYLGVIDCVKKVFRSEGIPGMYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 89/177 (50%), Gaps = 14/177 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT-----LSALRRIAREEGIRGLYSGLVPA-LAGVSHVA  592
            L V+ TRLQ  G+     P  G      +++L+ I + EG RG+Y GL P  +A + + A
Sbjct  38   LDVIKTRLQVLGLPE--TPTSGKRGSVIITSLQNIVKNEGFRGMYRGLSPTIIALLPNWA  95

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            + F  Y K+K  L + D     KLS     VA++ +    S  T P  VV++RL  QG+ 
Sbjct  96   VYFSVYGKLKDVLQSSDG----KLSIGANMVAAAGAGAATSIATNPLWVVKTRLMTQGIR  151

Query  411  SEK-RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
             +   Y  V+    ++  +EG+ G Y G   +L   +  A I F ++E I +++ ++
Sbjct  152  PDVIPYKSVMSAFSRICHEEGLRGLYSGILPSLAGISHVA-IQFPAYEKIKQYMANM  207



>ref|XP_008367006.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Malus domestica]
Length=374

 Score =   244 bits (622),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I+TN LWVV TRLQTQGMR G +PY+   SA  RI  EEG+RGLYSG++P+LAGVSHVAI
Sbjct  131  ISTNPLWVVKTRLQTQGMRPGVIPYKSMRSAFSRITTEEGLRGLYSGILPSLAGVSHVAI  190

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            QFP YEKIK ++A RDNT++DKL  S VA ASSVSK+ AS +TYPHEVVRSRLQEQG   
Sbjct  191  QFPXYEKIKSFMAKRDNTTVDKLHPSRVAFASSVSKVIASVITYPHEVVRSRLQEQGQAR  250

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            H   +Y+GVIDC++KVFQ+EG+ GFY GCATNLIRTTP+AVITFTS+EMI RFL
Sbjct  251  HIGTQYAGVIDCIKKVFQKEGLRGFYNGCATNLIRTTPSAVITFTSYEMIDRFL  304


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 91/171 (53%), Gaps = 9/171 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  GM +G    RG++  ++L++I + EG++G+Y GL P  LA + + A+ F
Sbjct  37   LDVIKTRLQVHGMPSG---QRGSIIVTSLQKILKTEGVKGMYRGLSPTILALLPNWAVYF  93

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
              YE++K  L +  + S  +L+     +A++ +    +  T P  VV++RLQ QG+    
Sbjct  94   TVYEQLKGLLHSHVHGS-GELTIGENMIAAAGAGAATAISTNPLWVVKTRLQTQGMRPGV  152

Query  402  -RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  +     ++  +EG+ G Y G   +L   +  A I F  +E I  F+
Sbjct  153  IPYKSMRSAFSRITTEEGLRGLYSGILPSLAGVSHVA-IQFPXYEKIKSFM  202



>emb|CDX96021.1| BnaA07g27100D [Brassica napus]
Length=312

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL  + MR   VPY+  LSA  RI REEG RGLYSG++P+L GVSHVA
Sbjct  129  SIATNPLWVVKTRLMAR-MRPDVVPYKSMLSAFSRIFREEGFRGLYSGVIPSLVGVSHVA  187

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+AN  + S+D+LS   VAVASS+SK+ AS  TYPHEVVRS+LQEQG  
Sbjct  188  IQFPVYEKIKQYMANVGDKSVDQLSPGEVAVASSISKVIASVSTYPHEVVRSKLQEQGQV  247

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +++ +YSGVIDC +KVF+ EG+PGFYRGCATNL+RTTP+AVITFTS+EMIHRFLV V  
Sbjct  248  RNAKAKYSGVIDCAKKVFRNEGVPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLVQVLS  307

Query  237  PDPQ  226
            PD +
Sbjct  308  PDKE  311


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 13/174 (7%)
 Frame = -2

Query  753  LWVVXTRLQTQGM---RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+   R G V     +++L  I ++EG+RG+Y GL P  +A + + A+ 
Sbjct  39   LDVIKTRLQVHGLPETRRGSV----IITSLGNILKKEGVRGMYRGLSPTIIALLPNWAVY  94

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS     VA++ +    S  T P  VV++RL  +     
Sbjct  95   FSVYGKLKDLLQSSDG----KLSIGANMVAAAGAGASTSIATNPLWVVKTRLMARMRPDV  150

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
              Y  ++    ++F++EG  G Y G   +L+  +  A I F  +E I +++ +V
Sbjct  151  VPYKSMLSAFSRIFREEGFRGLYSGVIPSLVGVSHVA-IQFPVYEKIKQYMANV  203



>ref|XP_007223316.1| hypothetical protein PRUPE_ppa007312mg [Prunus persica]
 gb|EMJ24515.1| hypothetical protein PRUPE_ppa007312mg [Prunus persica]
Length=373

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G +PY+   SA  RIA EEG+RGLYSG++P+LAG+SHVAIQFP
Sbjct  139  NPLWVVKTRLQTQGMRPGVIPYKSMRSAFTRIATEEGMRGLYSGILPSLAGISHVAIQFP  198

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK ++A RDNT++DKL+  NVA+ASS+SK+ AS +TYPHEVVRSRLQEQG   H E
Sbjct  199  AYEKIKSFMAKRDNTTVDKLNPGNVAIASSISKVIASVITYPHEVVRSRLQEQGQARHIE  258

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             +Y+GVIDC +KVFQ+EG+ GFY GCATNL+RTTP+AVITFTS+EMI RFL
Sbjct  259  PQYAGVIDCTKKVFQKEGLRGFYNGCATNLLRTTPSAVITFTSYEMIDRFL  309


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 89/172 (52%), Gaps = 7/172 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT---LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  GM  G    RG    +++L+ I + EG++G+Y GL P  LA + + A+ 
Sbjct  38   LDVIKTRLQVHGMPPGQRVVRGNGIIITSLQNILKTEGLKGMYRGLSPTILALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  L +  + S  +L+     +A++ +    +  T P  VV++RLQ QG+   
Sbjct  98   FTVYEQLKGLLQSHVDGS-SELTIGANMIAAAGAGAATAITTNPLWVVKTRLQTQGMRPG  156

Query  405  K-RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y  +     ++  +EG+ G Y G   +L   +  A I F ++E I  F+
Sbjct  157  VIPYKSMRSAFTRIATEEGMRGLYSGILPSLAGISHVA-IQFPAYEKIKSFM  207



>ref|XP_010499117.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
[Camelina sativa]
Length=363

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R   VPY+  +SA  RI  EEG+RGLYSG++P+LAGVSHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRPDVVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A+ DNTS++ LS  NVA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMADMDNTSVENLSPGNVAIASSIAKVIASVLTYPHEVIRAKLQEQGQM  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGV+DC+ KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  252  RNAETKYSGVVDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 91/175 (52%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG   +++L+ I + EGIRG+Y GL P  +A + + A+ 
Sbjct  38   LDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIVKNEGIRGMYRGLSPTIIALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS  +  VA++ +    S  T P  VV++RL  QG+  +
Sbjct  98   FSVYGKLKDVLQSSDG----KLSIGSNMVAAAGAGAATSIATNPLWVVKTRLMTQGIRPD  153

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  V+    ++  +EG+ G Y G   +L   +  A I F ++E I +++  +
Sbjct  154  VVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHVA-IQFPAYEKIKQYMADM  207



>ref|XP_002978962.1| hypothetical protein SELMODRAFT_109819, partial [Selaginella 
moellendorffii]
 ref|XP_002986475.1| hypothetical protein SELMODRAFT_124353, partial [Selaginella 
moellendorffii]
 gb|EFJ12332.1| hypothetical protein SELMODRAFT_124353, partial [Selaginella 
moellendorffii]
 gb|EFJ19919.1| hypothetical protein SELMODRAFT_109819, partial [Selaginella 
moellendorffii]
Length=312

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN LWVV TRLQTQ +R   VPY+ T SALRRIA EEG+ GLYSGL+PALAGVSHVA+
Sbjct  109  LITNPLWVVKTRLQTQRLRPDLVPYKNTFSALRRIAAEEGLSGLYSGLIPALAGVSHVAV  168

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG--L  415
            QFP YE++K Y A  D T+ D+LS   VA+ASS+SK+ ASTMTYPHEVVR+RLQ+QG   
Sbjct  169  QFPVYEQLKQYFAKLDGTTTDRLSTGRVAIASSISKVLASTMTYPHEVVRARLQQQGQVA  228

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
             +  +Y+GV+DCVRK++ +EGI GFYRGC TNL+RTTPAAVITFTSFE+I RFL S+ PP
Sbjct  229  VTHMKYAGVVDCVRKIWVEEGIAGFYRGCGTNLMRTTPAAVITFTSFELIMRFLQSLEPP  288


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 93/176 (53%), Gaps = 9/176 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGTLS---ALRRIAREEGIRGLYSGLVPA-LAGVSHVAI  589
            L VV TRLQ Q + +AG +   G L     L+ I R+EG+RGLY GL P  LA + + A+
Sbjct  11   LDVVKTRLQIQRIPKAGQLGVNGKLVYVFTLQSIVRQEGVRGLYQGLAPTILALLPNWAV  70

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
             F TYE++K  L  R      +L+ S+  +A++V+    + +T P  VV++RLQ Q L  
Sbjct  71   FFTTYEQMKRLLQTR--AGKQQLTMSSHLLAATVAGAATNLITNPLWVVKTRLQTQRLRP  128

Query  408  E-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
            +   Y      +R++  +EG+ G Y G    L   +  AV  F  +E + ++   +
Sbjct  129  DLVPYKNTFSALRRIAAEEGLSGLYSGLIPALAGVSHVAV-QFPVYEQLKQYFAKL  183



>ref|XP_010532254.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Tarenaya hassleriana]
Length=363

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN  WVV TRL TQGMR   VPY+  LSA  RI  EEG RGLYSG++P+LAG+SHVAIQF
Sbjct  134  TNPFWVVKTRLMTQGMRPDVVPYKSILSAFSRICHEEGFRGLYSGILPSLAGISHVAIQF  193

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HS  409
            P YEKIK ++A   NTS+DKLS  +VA+ASSVSK+ AS MTYPHEVVRS+LQEQG   + 
Sbjct  194  PAYEKIKQHMAKIGNTSVDKLSPGDVAIASSVSKVIASVMTYPHEVVRSKLQEQGQLRNP  253

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
              +YSGV+DCV+KV ++EGIPGFYRGCATNL+RTTP+AVITFTS+EMIHRFL+   P D
Sbjct  254  AVQYSGVVDCVKKVLRKEGIPGFYRGCATNLLRTTPSAVITFTSYEMIHRFLLRAVPSD  312


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 86/174 (49%), Gaps = 9/174 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  G+       RG   +++L+ I + EG RGLY GL P  +A + + A+ F
Sbjct  38   LDVIKTRLQVLGLPETPAGQRGGVIVTSLQSIIKNEGFRGLYRGLSPTIIALLPNWAVYF  97

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
              Y K+K  L + D     KLS     +A++ +    +  T P  VV++RL  QG+  + 
Sbjct  98   TVYGKLKDLLQSSDG----KLSVGANMIAAAGAGASTAIATNPFWVVKTRLMTQGMRPDV  153

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
              Y  ++    ++  +EG  G Y G   +L   +  A I F ++E I + +  +
Sbjct  154  VPYKSILSAFSRICHEEGFRGLYSGILPSLAGISHVA-IQFPAYEKIKQHMAKI  206



>ref|XP_002311469.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE88836.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=369

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR   VPY+  LSALRRI +EEGIRGLYSG++P+LAG+SHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGMRPDLVPYKNVLSALRRITQEEGIRGLYSGVLPSLAGISHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG--LHSE  406
             YEKIK Y+A R NT++D LS  +VA+ASSV+KI AS +TYPHEVVRSRLQEQG   +SE
Sbjct  195  AYEKIKFYMAKRGNTTVDNLSHGDVAIASSVAKILASVLTYPHEVVRSRLQEQGRLRNSE  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQ  226
              Y+GV+DC++KV ++EG  GFYRGCATNL+RTTP+AVITFTS+EMI +      P D +
Sbjct  255  VHYAGVVDCIKKVSRKEGFRGFYRGCATNLMRTTPSAVITFTSYEMILKCFERALPSDKK  314

Query  225  P  223
            P
Sbjct  315  P  315


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 94/170 (55%), Gaps = 6/170 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL-SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQFP  580
            L V+ TRLQ  G+    V     + S+L+ I + EG +GLY GL P  +A + + A+ F 
Sbjct  37   LDVIKTRLQVHGLPPNSVQGGSIIISSLQHIVKTEGFKGLYRGLSPTIMALLPNWAVYFT  96

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-K  403
             YE++K  L++ D     +LS S   VA++ +    +T+T P  VV++RLQ QG+  +  
Sbjct  97   VYEQLKGILSDVDGDG--QLSVSANMVAAAGAGAATATVTNPLWVVKTRLQTQGMRPDLV  154

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             Y  V+  +R++ Q+EGI G Y G   +L   +  A I F ++E I  ++
Sbjct  155  PYKNVLSALRRITQEEGIRGLYSGVLPSLAGISHVA-IQFPAYEKIKFYM  203



>ref|XP_008243273.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
[Prunus mume]
Length=369

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G +PY+   SA  RIA EEG+RGLYSG++P+LAG+SHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGMRPGVIPYKSMRSAFTRIATEEGMRGLYSGILPSLAGISHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEKIK ++A RD+T++DKL+  NVA+ASS+SK+ AS +TYPHEVVRSRLQEQG   H E
Sbjct  195  AYEKIKSFMAKRDSTTVDKLNPGNVAIASSISKVIASVITYPHEVVRSRLQEQGQARHIE  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             +Y+GVIDC +KVFQ+EG+ GFY GCATNL+RTTP+AVITFTS+EMI RFL
Sbjct  255  AQYAGVIDCTKKVFQKEGLRGFYNGCATNLLRTTPSAVITFTSYEMIDRFL  305


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 90/171 (53%), Gaps = 9/171 (5%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTL--SALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQF  583
            L V+ TRLQ  GM  G    RG++  ++L+ I + EG++G+Y GL P  LA + + A+ F
Sbjct  38   LDVIKTRLQVHGMPPG---QRGSIIITSLQNILKTEGLKGMYRGLSPTILALLPNWAVYF  94

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
              YE++K  L +  + S  +L+     +A++ +    +  T P  VV++RLQ QG+    
Sbjct  95   TVYEQLKGLLQSHVDGS-SELTIGANMIAAAGAGAATAITTNPLWVVKTRLQTQGMRPGV  153

Query  402  -RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              Y  +     ++  +EG+ G Y G   +L   +  A I F ++E I  F+
Sbjct  154  IPYKSMRSAFTRIATEEGMRGLYSGILPSLAGISHVA-IQFPAYEKIKSFM  203



>ref|XP_002893428.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69687.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=364

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 150/183 (82%), Gaps = 3/183 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQ-TQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            +IATN LWVV TRL  TQG+R   VPY+  +SA  RI  EEG+RGLYSG++P+LAGVSHV
Sbjct  132  SIATNPLWVVKTRLMVTQGIRPDVVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHV  191

Query  594  AIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            AIQFP YEKIK Y+AN DNTS++ LS  NVA+ASS++K+ AS +TYPHEV+R++LQEQG 
Sbjct  192  AIQFPAYEKIKQYMANMDNTSVENLSPGNVAIASSIAKVIASVLTYPHEVIRAKLQEQGQ  251

Query  414  --HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVF  241
              ++E +YSGVIDC+ KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V 
Sbjct  252  MKNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVM  311

Query  240  PPD  232
            PP+
Sbjct  312  PPE  314


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 92/181 (51%), Gaps = 21/181 (12%)
 Frame = -2

Query  753  LWVVXTRLQTQGM--------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPA-LAGVS  601
            L V+ TRLQ  G+        R G +     +++L+ I ++EG RG+Y GL P  +A + 
Sbjct  38   LDVIKTRLQVLGLPETPASGQRGGVI-----ITSLKNIVQKEGYRGMYRGLSPTIIALLP  92

Query  600  HVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQ-E  424
            + A+ F  Y K+K  L + D     KLS  +  VA++ +    S  T P  VV++RL   
Sbjct  93   NWAVYFSVYGKLKDVLQSNDG----KLSIGSNVVAAAGAGAATSIATNPLWVVKTRLMVT  148

Query  423  QGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
            QG+  +   Y  V+    ++  +EG+ G Y G   +L   +  A I F ++E I +++ +
Sbjct  149  QGIRPDVVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHVA-IQFPAYEKIKQYMAN  207

Query  246  V  244
            +
Sbjct  208  M  208



>ref|XP_010477935.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Camelina sativa]
Length=363

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R   VPY+  +SA  RI  EEG+RGLYSG++P+LAGVSHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRPDVVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A+ DNT ++ LS  NVA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMADMDNTPVENLSPGNVAIASSIAKVIASVLTYPHEVIRAKLQEQGQM  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGV+DC+ KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V P
Sbjct  252  RNAETKYSGVVDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVP  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 91/175 (52%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG   +++L+ I + EGIRG+Y GL P  +A + + A+ 
Sbjct  38   LDVIKTRLQVLGLPEAPAAGQRGGVIITSLKSIVKNEGIRGMYRGLSPTIIALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS  +  VA++ +    S  T P  VV++RL  QG+  +
Sbjct  98   FSVYGKLKDVLQSSDG----KLSIGSNMVAAAGAGAATSIATNPLWVVKTRLMTQGIRPD  153

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  V+    ++  +EG+ G Y G   +L   +  A I F ++E I +++  +
Sbjct  154  VVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHVA-IQFPAYEKIKQYMADM  207



>ref|XP_010460390.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
[Camelina sativa]
Length=363

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            +IATN LWVV TRL TQG+R   VPY+  +SA  RI  EEG+RGLYSG++P+LAGVSHVA
Sbjct  132  SIATNPLWVVKTRLMTQGIRPDVVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHVA  191

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQFP YEKIK Y+A+ DNTS++ LS  NVA+ASS++K+ AS +TYPHEV+R++LQEQG  
Sbjct  192  IQFPAYEKIKQYMADMDNTSVENLSPGNVAIASSIAKVIASVLTYPHEVIRAKLQEQGQM  251

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             ++E +YSGV+DC+ KVF+ EGIPG YRGCATNL+RTTP+AVITFT++EM+ RF   V  
Sbjct  252  RNAEAKYSGVVDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYEMMLRFFRQVVT  311

Query  237  PD  232
            P+
Sbjct  312  PE  313


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 91/175 (52%), Gaps = 10/175 (6%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQ  586
            L V+ TRLQ  G+  A     RG   +++L+ I + EGIRG+Y GL P  +A + + A+ 
Sbjct  38   LDVIKTRLQVLGLPEAPASGQRGGVIITSLKSIVKNEGIRGMYRGLSPTIIALLPNWAVY  97

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  Y K+K  L + D     KLS  +  VA++ +    S  T P  VV++RL  QG+  +
Sbjct  98   FSVYGKLKDVLQSSDG----KLSIGSNMVAAAGAGAATSIATNPLWVVKTRLMTQGIRPD  153

Query  405  -KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               Y  V+    ++  +EG+ G Y G   +L   +  A I F ++E I +++  +
Sbjct  154  VVPYKSVMSAFSRICHEEGLRGLYSGILPSLAGVSHVA-IQFPAYEKIKQYMADM  207



>ref|XP_009767034.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
isoform X1 [Nicotiana sylvestris]
Length=366

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQG+R G VPY+G LSAL RIA EEGIRG YSGL+P+LAG+SHV IQFP
Sbjct  137  NPLWVVKTRLQTQGIREGVVPYKGILSALIRIAHEEGIRGWYSGLLPSLAGISHVTIQFP  196

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEK+K YLA R N   ++LS   VA+ASS++K+ AS MTYPHEVVRS+LQEQG   +SE
Sbjct  197  AYEKLKSYLAKRANKQTNELSPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQVRNSE  256

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            K Y+GV+DCV+K+F+QE + GFYRGC TNL+RTTP+AVITFTS+EMIHR       P+
Sbjct  257  KAYNGVVDCVKKIFRQERLTGFYRGCGTNLLRTTPSAVITFTSYEMIHRLFQRAILPE  314


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 88/177 (50%), Gaps = 15/177 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAG-VSH  598
            L V+ TRL   G+       R G V     +++L+ I R EG RGLY GL P LA  + +
Sbjct  34   LDVIKTRLIIHGLPQMSQSGRQGSV----IVTSLQNILRTEGFRGLYRGLSPTLAALLPN  89

Query  597  VAIQFPTYEKIKIYLANRDNT-SMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ  421
             A+ F  Y  +K  L + D   S  +L+     +A++ +    +  T P  VV++RLQ Q
Sbjct  90   WAVYFTVYGHLKDSLHSHDAVDSCGQLTIGANMIAAAGAGAATAITTNPLWVVKTRLQTQ  149

Query  420  GLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            G+      Y G++  + ++  +EGI G+Y G   +L   +    I F ++E +  +L
Sbjct  150  GIREGVVPYKGILSALIRIAHEEGIRGWYSGLLPSLAGIS-HVTIQFPAYEKLKSYL  205



>ref|XP_009767035.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
isoform X2 [Nicotiana sylvestris]
Length=364

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQG+R G VPY+G LSAL RIA EEGIRG YSGL+P+LAG+SHV IQFP
Sbjct  135  NPLWVVKTRLQTQGIREGVVPYKGILSALIRIAHEEGIRGWYSGLLPSLAGISHVTIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEK+K YLA R N   ++LS   VA+ASS++K+ AS MTYPHEVVRS+LQEQG   +SE
Sbjct  195  AYEKLKSYLAKRANKQTNELSPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQVRNSE  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            K Y+GV+DCV+K+F+QE + GFYRGC TNL+RTTP+AVITFTS+EMIHR       P+
Sbjct  255  KAYNGVVDCVKKIFRQERLTGFYRGCGTNLLRTTPSAVITFTSYEMIHRLFQRAILPE  312


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 15/176 (9%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAG-VSH  598
            L V+ TRL   G+       R G V     +++L+ I R EG RGLY GL P LA  + +
Sbjct  34   LDVIKTRLIIHGLPQMSQSGRQGSV----IVTSLQNILRTEGFRGLYRGLSPTLAALLPN  89

Query  597  VAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
             A+ F  Y  +K  L +  + S  +L+     +A++ +    +  T P  VV++RLQ QG
Sbjct  90   WAVYFTVYGHLKDSLHSHVD-SCGQLTIGANMIAAAGAGAATAITTNPLWVVKTRLQTQG  148

Query  417  LHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            +      Y G++  + ++  +EGI G+Y G   +L   +    I F ++E +  +L
Sbjct  149  IREGVVPYKGILSALIRIAHEEGIRGWYSGLLPSLAGIS-HVTIQFPAYEKLKSYL  203



>ref|XP_009600753.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
Length=366

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQG+R G VPY+G LSAL RIA EEGIRG YSGL+P+LAG+SHVAIQFP
Sbjct  137  NPLWVVKTRLQTQGIREGVVPYKGILSALIRIAHEEGIRGWYSGLLPSLAGISHVAIQFP  196

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEK+K YLA R N   ++LS   VA+ASS++K+ AS MTYPHEVVRS+LQEQG   +SE
Sbjct  197  AYEKLKSYLAKRANKQTNELSPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQIRNSE  256

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            K Y+GV+DCV+K+F+QE + GFYRGC TNL+RTTP+AVITFTS+EMI R    V  P+
Sbjct  257  KAYNGVVDCVKKIFRQERLTGFYRGCGTNLLRTTPSAVITFTSYEMILRLFQRVILPE  314


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 90/177 (51%), Gaps = 15/177 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAG-VSH  598
            L V+ TRLQ  G+       R G V     +++L+ I R EG +GLY GL P LA  + +
Sbjct  34   LDVIKTRLQVHGLPQISQSGRQGSV----IVTSLQNIIRTEGFKGLYRGLSPTLAALLPN  89

Query  597  VAIQFPTYEKIKIYLANRDNT-SMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ  421
             A+ F  Y  +K  L + D   S  +L+     +A++ +    +  T P  VV++RLQ Q
Sbjct  90   WAVYFTVYGHLKDSLHSHDAVDSCGQLTIGANMIAAAGAGAATAITTNPLWVVKTRLQTQ  149

Query  420  GLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            G+      Y G++  + ++  +EGI G+Y G   +L   +  A I F ++E +  +L
Sbjct  150  GIREGVVPYKGILSALIRIAHEEGIRGWYSGLLPSLAGISHVA-IQFPAYEKLKSYL  205



>ref|XP_009600754.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial 
isoform X2 [Nicotiana tomentosiformis]
Length=364

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQG+R G VPY+G LSAL RIA EEGIRG YSGL+P+LAG+SHVAIQFP
Sbjct  135  NPLWVVKTRLQTQGIREGVVPYKGILSALIRIAHEEGIRGWYSGLLPSLAGISHVAIQFP  194

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
             YEK+K YLA R N   ++LS   VA+ASS++K+ AS MTYPHEVVRS+LQEQG   +SE
Sbjct  195  AYEKLKSYLAKRANKQTNELSPGEVAIASSMAKVVASVMTYPHEVVRSKLQEQGQIRNSE  254

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
            K Y+GV+DCV+K+F+QE + GFYRGC TNL+RTTP+AVITFTS+EMI R    V  P+
Sbjct  255  KAYNGVVDCVKKIFRQERLTGFYRGCGTNLLRTTPSAVITFTSYEMILRLFQRVILPE  312


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 90/176 (51%), Gaps = 15/176 (9%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAG-VSH  598
            L V+ TRLQ  G+       R G V     +++L+ I R EG +GLY GL P LA  + +
Sbjct  34   LDVIKTRLQVHGLPQISQSGRQGSV----IVTSLQNIIRTEGFKGLYRGLSPTLAALLPN  89

Query  597  VAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
             A+ F  Y  +K  L +  + S  +L+     +A++ +    +  T P  VV++RLQ QG
Sbjct  90   WAVYFTVYGHLKDSLHSHVD-SCGQLTIGANMIAAAGAGAATAITTNPLWVVKTRLQTQG  148

Query  417  LHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            +      Y G++  + ++  +EGI G+Y G   +L   +  A I F ++E +  +L
Sbjct  149  IREGVVPYKGILSALIRIAHEEGIRGWYSGLLPSLAGISHVA-IQFPAYEKLKSYL  203



>ref|XP_001772029.1| predicted protein [Physcomitrella patens]
 gb|EDQ63110.1| predicted protein [Physcomitrella patens]
Length=320

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 145/183 (79%), Gaps = 2/183 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN LWVV TRLQTQ +R   VPY+GT SAL RI  EEG RGLYSG+VPALAG+SHVAI
Sbjct  132  LVTNPLWVVKTRLQTQRLRTDIVPYKGTFSALNRILAEEGFRGLYSGIVPALAGISHVAI  191

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFP YE +K Y A +D T+++ LS  NVA+ASS+SK+ AST+TYPHEVVRSRLQEQG   
Sbjct  192  QFPVYEYLKEYFAQKDGTTVEALSTRNVAIASSLSKVTASTLTYPHEVVRSRLQEQGYSK  251

Query  408  --EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
                RY+GV+DC+RK+  +EG+ GFYRGCATNL+RTTPAAVITFTSFE+I R L ++FP 
Sbjct  252  GVHIRYTGVVDCIRKISIEEGVKGFYRGCATNLMRTTPAAVITFTSFELILRHLHTLFPV  311

Query  234  DPQ  226
              Q
Sbjct  312  KHQ  314


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 88/181 (49%), Gaps = 20/181 (11%)
 Frame = -2

Query  753  LWVVXTRLQTQ-------GMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPAL-AGVSH  598
            L VV TRLQ         G++ G +     + +L  I REEG+RGLY GL P + A + +
Sbjct  29   LDVVKTRLQVYRPTVSEVGLKGGLI-----IGSLSTIFREEGVRGLYRGLSPTMVALLPN  83

Query  597  VAIQFPTYEKIKIYLA-----NRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSR  433
             A+ F TYE++K  L      N  +TS  K++ +    A++ +      +T P  VV++R
Sbjct  84   WAVYFTTYEQLKRILQSEAHHNLAHTSDHKMTPAAHVAAAAGAGTATILVTNPLWVVKTR  143

Query  432  LQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRF  256
            LQ Q L ++   Y G    + ++  +EG  G Y G    L   +  A I F  +E +  +
Sbjct  144  LQTQRLRTDIVPYKGTFSALNRILAEEGFRGLYSGIVPALAGISHVA-IQFPVYEYLKEY  202

Query  255  L  253
             
Sbjct  203  F  203



>ref|XP_001763122.1| predicted protein [Physcomitrella patens]
 gb|EDQ71999.1| predicted protein [Physcomitrella patens]
Length=335

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 148/185 (80%), Gaps = 4/185 (2%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN LWVV TRLQTQ +R+  VPY+ T SALRRIA EEG+RGLYSGLVPALAG+SH AI
Sbjct  118  LVTNPLWVVKTRLQTQRLRSDIVPYKSTFSALRRIAAEEGVRGLYSGLVPALAGISHGAI  177

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFP YE +K + ANRD TS+++LS  NVA ASS+SK  AST+TYPHEVVRSRLQEQG HS
Sbjct  178  QFPAYEYLKEFFANRDKTSVEELSPLNVAFASSLSKFIASTLTYPHEVVRSRLQEQG-HS  236

Query  408  ---EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
               + RY+GV+DC++KV  +EG+ GFYRG ATNL+RT PAAVITFTSFE+I + L  +FP
Sbjct  237  KLVQLRYAGVVDCIKKVSVEEGLAGFYRGYATNLMRTIPAAVITFTSFELIIKQLHVLFP  296

Query  237  PDPQP  223
               QP
Sbjct  297  LKHQP  301


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 91/177 (51%), Gaps = 11/177 (6%)
 Frame = -2

Query  747  VVXTRLQ-TQGMRAGFVPYRG--TLSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQFP  580
            VV TRLQ  + +     P +G  T+  L +I R+EG RGLY GL P + A +++  + F 
Sbjct  16   VVKTRLQVNRPILNSEGPLKGWTTIGILSKILRDEGPRGLYFGLSPTMVALLTNWTVYFT  75

Query  579  TYEKIKIYLANR-----DNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
             YE +K  L +      D+T++ ++      VA+S + +  + +T P  VV++RLQ Q L
Sbjct  76   VYEHLKRVLQSEELHDADHTTLHRMPIGTTLVAASGAGVATNLVTNPLWVVKTRLQTQRL  135

Query  414  HSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
             S+   Y      +R++  +EG+ G Y G    L   +  A I F ++E +  F  +
Sbjct  136  RSDIVPYKSTFSALRRIAAEEGVRGLYSGLVPALAGISHGA-IQFPAYEYLKEFFAN  191



>gb|KFK43464.1| hypothetical protein AALP_AA1G128600 [Arabis alpina]
Length=321

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 140/185 (76%), Gaps = 3/185 (2%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TIATN LWV+ TRL TQGMR   VPY   LSA  RI  +EG+RGLYSGLVP+L GVSHV 
Sbjct  130  TIATNPLWVIRTRLVTQGMRTDVVPYTTVLSAFTRIFHQEGLRGLYSGLVPSLIGVSHVV  189

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL-  415
            IQ P YEKIK Y+A   N  +DKLS  ++ VA+S+SK+ AS MTYPHEV+RS+LQEQG  
Sbjct  190  IQLPAYEKIKQYMAEIGNKPVDKLSPESIVVATSISKVIASVMTYPHEVIRSKLQEQGQM  249

Query  414  -HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIH-RFLVSVF  241
             + E +YSGVIDC++KV+Q EG+ GFYRGCATNL+R TPAA+ITFTS+EMIH   L  V 
Sbjct  250  KNVEIKYSGVIDCLKKVYQNEGVIGFYRGCATNLLRITPAAIITFTSYEMIHGHLLQQVL  309

Query  240  PPDPQ  226
            P   Q
Sbjct  310  PKKTQ  314


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 93/178 (52%), Gaps = 15/178 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRG------TLSALRRIAREEGIRGLYSGLVPA-LAGVSHV  595
            L V+ TRLQ  G+     P  G       + +L+ I + EG+ G+Y GL P  +A + + 
Sbjct  35   LDVIKTRLQVIGLP--LAPLSGRQKGSVIIRSLQDIVKNEGVVGMYRGLSPTIIALLPNW  92

Query  594  AIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            AI F  YEK+K  L + D     KLS     VAS+++ +  +  T P  V+R+RL  QG+
Sbjct  93   AIYFSVYEKLKDALKSNDG----KLSVGANIVASAIAGVSTTIATNPLWVIRTRLVTQGM  148

Query  414  HSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
             ++   Y+ V+    ++F QEG+ G Y G   +LI  +   VI   ++E I +++  +
Sbjct  149  RTDVVPYTTVLSAFTRIFHQEGLRGLYSGLVPSLIGVS-HVVIQLPAYEKIKQYMAEI  205



>ref|XP_001754740.1| predicted protein [Physcomitrella patens]
 gb|EDQ80194.1| predicted protein [Physcomitrella patens]
Length=334

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 141/180 (78%), Gaps = 2/180 (1%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN LWVV TR+QTQ +R   +PY+G  SAL RI REEG RGLYSG+VPALAG+SHVAI
Sbjct  151  LVTNPLWVVKTRIQTQSLRPDLIPYKGVASALHRIFREEGARGLYSGVVPALAGISHVAI  210

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH-  412
            QFP +E +K  LA R+ T++DKL    VA+A+S +K+ AST+TYPHEVVRSRLQEQG+  
Sbjct  211  QFPLFEFLKNQLALREGTTVDKLPVGQVAMATSAAKVIASTITYPHEVVRSRLQEQGVAR  270

Query  411  -SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPP  235
              + RY+GV+DC++K+   EGI GFY G ATNL+RTTPAAVITFTSFEMI R L  +FPP
Sbjct  271  LEKLRYTGVVDCIKKITAHEGIRGFYLGYATNLMRTTPAAVITFTSFEMILRQLKIIFPP  330



>ref|XP_002992842.1| hypothetical protein SELMODRAFT_46825, partial [Selaginella moellendorffii]
 gb|EFJ06132.1| hypothetical protein SELMODRAFT_46825, partial [Selaginella moellendorffii]
Length=275

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 134/174 (77%), Gaps = 8/174 (5%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
             IATN LWVV TRLQTQ +++G  PY GT S+L RI REEG+RGLYSGLVPAL GVSHVA
Sbjct  110  NIATNPLWVVKTRLQTQQVKSGIAPYAGTFSSLVRIGREEGLRGLYSGLVPALVGVSHVA  169

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            +QFP YE +K  LA+     +          AS+ SK+ AST+TYPHEVVRSRLQEQG  
Sbjct  170  VQFPVYEHLKERLADSGTLGV--------IGASAASKMIASTVTYPHEVVRSRLQEQGNS  221

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
            +  RYSGV+DCV+K+++QEGI G+YRGCATNL+RTTPAAVITFTSFE I + L+
Sbjct  222  ANPRYSGVVDCVQKIWKQEGIRGYYRGCATNLMRTTPAAVITFTSFEYIKKRLL  275


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 75/144 (52%), Gaps = 3/144 (2%)
 Frame = -2

Query  678  ALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnva  502
            +L  I + EG+ G+Y GL P + A + + A+ F  YE++K YL  RD +   KLS     
Sbjct  40   SLAVIFQNEGVAGMYRGLSPTIFALLPNWAVYFTAYEQMKGYLERRDGSPDKKLSPGEHM  99

Query  501  vassvSKIFASTMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCA  325
            +A+ V+    +  T P  VV++RLQ Q + S    Y+G    + ++ ++EG+ G Y G  
Sbjct  100  IAAVVAGSATNIATNPLWVVKTRLQTQQVKSGIAPYAGTFSSLVRIGREEGLRGLYSGLV  159

Query  324  TNLIRTTPAAVITFTSFEMIHRFL  253
              L+  +  AV  F  +E +   L
Sbjct  160  PALVGVSHVAV-QFPVYEHLKERL  182



>ref|XP_002987576.1| hypothetical protein SELMODRAFT_46815, partial [Selaginella moellendorffii]
 gb|EFJ11412.1| hypothetical protein SELMODRAFT_46815, partial [Selaginella moellendorffii]
Length=275

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 135/174 (78%), Gaps = 8/174 (5%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
             IATN LWVV TRLQTQ +++G  PY GTLS+L RI REEG+RGLYSGLVPAL GVSHVA
Sbjct  110  NIATNPLWVVKTRLQTQQVKSGIAPYVGTLSSLVRIGREEGLRGLYSGLVPALVGVSHVA  169

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            +QFP YE +K  LA+     +          AS+ SK+ AST+TYPHEVVRSRLQEQG  
Sbjct  170  VQFPVYEHLKERLADSGTFGV--------IGASAASKMIASTVTYPHEVVRSRLQEQGSS  221

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
            +  RY+GV+DCV+K+++QEGI G+YRGCATNL+RTTPAAVITFTSFE I + L+
Sbjct  222  ANPRYNGVVDCVQKIWKQEGIRGYYRGCATNLMRTTPAAVITFTSFEYIKKRLL  275


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 86/177 (49%), Gaps = 15/177 (8%)
 Frame = -2

Query  753  LWVVXTRLQTQGM--------RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPAL-AGVS  601
            L VV TRLQ            + G V  R    +L  I + EG+ G+Y GL P + A + 
Sbjct  11   LDVVKTRLQVHKAPVPDQAVAKGGGVIVR----SLAVIFQNEGVAGMYRGLSPTIFALLP  66

Query  600  HVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ  421
            + A+ F  YE++K YL  RD +   KLS     +A+ V+    +  T P  VV++RLQ Q
Sbjct  67   NWAVYFTAYEQMKGYLERRDGSPDKKLSPGEHMIAAVVAGSATNIATNPLWVVKTRLQTQ  126

Query  420  GLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             + S    Y G +  + ++ ++EG+ G Y G    L+  +  AV  F  +E +   L
Sbjct  127  QVKSGIAPYVGTLSSLVRIGREEGLRGLYSGLVPALVGVSHVAV-QFPVYEHLKERL  182



>dbj|BAD73080.1| putative mitochondrial folate transporter [Oryza sativa Japonica 
Group]
 dbj|BAD73272.1| putative mitochondrial folate transporter [Oryza sativa Japonica 
Group]
Length=314

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 133/179 (74%), Gaps = 15/179 (8%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            +ATN LWVV TRLQTQGMR G VPY    SALRRIA EE             AGV+HVAI
Sbjct  148  VATNPLWVVKTRLQTQGMRTGVVPYTSIWSALRRIAEEE-------------AGVTHVAI  194

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--  415
            Q P YE +K+Y A RDNT++DKLS   +A+ SS SK+ AS +TYPHEVVRS+LQEQG   
Sbjct  195  QLPVYENVKLYFAKRDNTTVDKLSPGKLAICSSGSKVAASIITYPHEVVRSKLQEQGRAR  254

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
            H    Y+GVIDC+++V+Q+EGIPGFYRGCATNL+RTTP AVITFTS+EMI+R +  + P
Sbjct  255  HGAVHYTGVIDCIKQVYQKEGIPGFYRGCATNLLRTTPNAVITFTSYEMINRLMHQLLP  313



>ref|XP_007044249.1| NAD+ transporter 2 isoform 2, partial [Theobroma cacao]
 gb|EOY00081.1| NAD+ transporter 2 isoform 2, partial [Theobroma cacao]
Length=352

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 143/211 (68%), Gaps = 50/211 (24%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G VPY G LSALRRI  EEG+RGLYSG++P+LAG+SHVAIQFP
Sbjct  142  NPLWVVKTRLQTQGMRTGVVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVAIQFP  201

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHE----------------  448
             YEKIK Y+A ++NT++D LS ++VA+ASS+SK+ AS MTYPHE                
Sbjct  202  AYEKIKSYMAKKENTTVDHLSPADVAIASSISKVLASIMTYPHEVCFGWTCSIYSTATET  261

Query  447  --------------------------------VVRSRLQEQGL--HSEKRYSGVIDCVRK  370
                                            V+RSRLQEQG   +SE  Y+GV+DC+RK
Sbjct  262  PSLQKLSCSWIEYSTCLFFFINLSYIPISYQQVIRSRLQEQGQVRNSEVHYAGVVDCIRK  321

Query  369  VFQQEGIPGFYRGCATNLIRTTPAAVITFTS  277
            VFQ+EG+PGFYRGCATNL+RTTP+AVITFTS
Sbjct  322  VFQKEGLPGFYRGCATNLLRTTPSAVITFTS  352


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 95/170 (56%), Gaps = 7/170 (4%)
 Frame = -2

Query  747  VVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPA-LAGVSHVAIQFP  580
            V+ TRLQ  G+  A     RG+  +++L+ I + +G++GLY GL P  LA + + A+ F 
Sbjct  43   VIKTRLQVHGLPEASQSGARGSVIITSLQHIIKNDGLKGLYRGLSPTILALLPNWAVYFT  102

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK-  403
             YE++K  L + ++    +L+     VA++ +    +  T P  VV++RLQ QG+ +   
Sbjct  103  LYEQLKGLLTSHEDNG-GQLTIGANMVAAAGAGAATAITTNPLWVVKTRLQTQGMRTGVV  161

Query  402  RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             Y+GV+  +R++  +EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  162  PYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVA-IQFPAYEKIKSYM  210



>ref|NP_001043181.2| Os01g0513200 [Oryza sativa Japonica Group]
 dbj|BAF05095.2| Os01g0513200, partial [Oryza sativa Japonica Group]
Length=145

 Score =   197 bits (502),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = -2

Query  663  AREEGIRGLYSGLVPALAGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvS  484
            A EEGIRGLYSGL+P+LAGV+HVAIQ P YE +K+Y A RDNT++DKLS   +A+ SS S
Sbjct  1    AEEEGIRGLYSGLLPSLAGVTHVAIQLPVYENVKLYFAKRDNTTVDKLSPGKLAICSSGS  60

Query  483  KIFASTMTYPHEVVRSRLQEQG--LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIR  310
            K+ AS +TYPHEVVRS+LQEQG   H    Y+GVIDC+++V+Q+EGIPGFYRGCATNL+R
Sbjct  61   KVAASIITYPHEVVRSKLQEQGRARHGAVHYTGVIDCIKQVYQKEGIPGFYRGCATNLLR  120

Query  309  TTPAAVITFTSFEMIHRFLVSVFP  238
            TTP AVITFTS+EMI+R +  + P
Sbjct  121  TTPNAVITFTSYEMINRLMHQLLP  144



>ref|XP_010906994.1| PREDICTED: nicotinamide adenine dinucleotide transporter 2, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=284

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 126/176 (72%), Gaps = 29/176 (16%)
 Frame = -2

Query  759  NSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQFP  580
            N LWVV TRLQTQGMR G VPYR  LSA RRI  EEG+RGLYS               FP
Sbjct  135  NPLWVVKTRLQTQGMRPGVVPYRNMLSAFRRIVHEEGVRGLYS---------------FP  179

Query  579  TYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL--HSE  406
                        DNT++DKLS  +VA+ASS+SKI ASTMTYPHEVVRSRLQEQG    + 
Sbjct  180  ------------DNTTVDKLSPGSVAIASSLSKIIASTMTYPHEVVRSRLQEQGQARDTA  227

Query  405  KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFP  238
             +Y+GV+DC++KVFQ+EG+PGFYRGC TNL+RTTP AVITFTS+EMI RFL  VFP
Sbjct  228  NQYTGVVDCIKKVFQKEGLPGFYRGCGTNLLRTTPTAVITFTSYEMIQRFLHQVFP  283


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 88/168 (52%), Gaps = 6/168 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQF  583
            L V+ TR Q  G+       R +  +S+L +I + EGI+GLY GL P + A + + A+ F
Sbjct  35   LDVIKTRFQVHGLPKMPPSARRSVIISSLEQIIKNEGIKGLYRGLSPTITALLPNWAVYF  94

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE-  406
              Y ++K  L + ++ + ++LS S   +A+S +    +  T P  VV++RLQ QG+    
Sbjct  95   TVYNQLKGLLHSHEDGN-NQLSISANIIAASGAGAATAVATNPLWVVKTRLQTQGMRPGV  153

Query  405  KRYSGVIDCVRKVFQQEGIPGFYR-GCATNLIRTTPAAVITFTSFEMI  265
              Y  ++   R++  +EG+ G Y     T + + +P +V   +S   I
Sbjct  154  VPYRNMLSAFRRIVHEEGVRGLYSFPDNTTVDKLSPGSVAIASSLSKI  201



>gb|AFK40737.1| unknown [Medicago truncatula]
Length=122

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  576  YEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEKRY  397
            YE IK YLAN+D+ ++DKL A +VA+ASSVSKIFAST+TYPHEV RSRLQEQG HS KR+
Sbjct  2    YETIKFYLANQDDAAVDKLGARDVAIASSVSKIFASTLTYPHEVARSRLQEQGHHSGKRH  61

Query  396  SGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDPQPQP  217
            SG+IDC+RKVFQQEG+PGFYRGCATNL+RTTPAAVITFTSFEMIHRFLVS FP DPQP  
Sbjct  62   SGMIDCIRKVFQQEGVPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSHFPSDPQPHI  121

Query  216  L  214
            L
Sbjct  122  L  122



>gb|AFW81645.1| hypothetical protein ZEAMMB73_626020 [Zea mays]
Length=153

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 107/127 (84%), Gaps = 2/127 (2%)
 Frame = -2

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
             FP YEKIK YLA RDNT+++ LS  +VAVASS++K+ AST+TYPHEVVRSRLQ+Q  HS
Sbjct  25   SFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQDQRAHS  84

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
            + RY GV+DC+RKV+ +EG+ GFY GCATNL+RTTPAAVITFTSFEMIHRFL+ +FP + 
Sbjct  85   DARYKGVVDCIRKVYHKEGVAGFYSGCATNLLRTTPAAVITFTSFEMIHRFLLDLFPAES  144

Query  228  QP--QPL  214
            +P  QPL
Sbjct  145  EPHIQPL  151



>emb|CDY27484.1| BnaC04g51250D [Brassica napus]
Length=255

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TIATN LWVV TRLQTQGMRAG VPY+ TLSALRRIA EEGIRGLYSGLVPALAG+SHVA
Sbjct  141  TIATNPLWVVKTRLQTQGMRAGVVPYKSTLSALRRIAYEEGIRGLYSGLVPALAGISHVA  200

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQ  427
            IQFPTYE +KIYLAN+ + SMD L+A +VAV SS++KIFAST+TYPHEVVR+RLQ
Sbjct  201  IQFPTYELVKIYLANKGDKSMDDLNARDVAVTSSIAKIFASTLTYPHEVVRARLQ  255



>ref|XP_005644233.1| mitochondrial carrier, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE19689.1| mitochondrial carrier, partial [Coccomyxa subellipsoidea C-169]
Length=315

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 120/180 (67%), Gaps = 11/180 (6%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQ--GMRAGFVP------YRGTLSALRRIAREEGIRGLYSGLVPAL  613
            + TN LWVV TRLQTQ  G+R G         Y GT +AL RIAREEGI GLYSGL+P+L
Sbjct  114  LVTNPLWVVKTRLQTQHMGLRMGRASGGRAPLYTGTFNALSRIAREEGIAGLYSGLLPSL  173

Query  612  AGVSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSR  433
             GV HVAIQFP YE  K  +A    TS D+L   ++   S+ SK+ AST TYPHEVVRS 
Sbjct  174  IGVCHVAIQFPLYEACKKRIAEHKGTSPDRLDPLSLVGISAFSKMVASTATYPHEVVRSH  233

Query  432  LQEQGLHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
            +   G      ++G +   ++++++EG+ GFYRGC  NLIRTTPAA +TFT+FE++ R +
Sbjct  234  MHVAG---SGPFNGFLKTCKQIYREEGVKGFYRGCTANLIRTTPAAALTFTTFELLSRHM  290


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 83/175 (47%), Gaps = 12/175 (7%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSG-LVPALAGVSHVAIQFPT  577
            L V+ TRLQ Q  R   V Y G    L +I  EEG++GLY G     LA + + A+ F  
Sbjct  19   LDVLKTRLQVQ-RRVPGVKYNGISGGLSKILAEEGVKGLYRGLTPTLLALLPNWAVYFTV  77

Query  576  YEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ------GL  415
            YE++KI L NR               A++ + +    +T P  VV++RLQ Q      G 
Sbjct  78   YERLKISLGNRAQGHAFIKPPMVHMAAATGAGVATMLVTNPLWVVKTRLQTQHMGLRMGR  137

Query  414  HSEKR---YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHR  259
             S  R   Y+G  + + ++ ++EGI G Y G   +LI     A I F  +E   +
Sbjct  138  ASGGRAPLYTGTFNALSRIAREEGIAGLYSGLLPSLIGVCHVA-IQFPLYEACKK  191



>ref|XP_001420486.1| MC family transporter: folate [Ostreococcus lucimarinus CCE9901]
 gb|ABO98779.1| MC family transporter: folate [Ostreococcus lucimarinus CCE9901]
Length=345

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 120/174 (69%), Gaps = 9/174 (5%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRA------GFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVS  601
            TN LWV  TRLQ Q   A        VPY  T++AL R+ REEG++GLYSG  P+L G++
Sbjct  162  TNPLWVAKTRLQVQHSHALASAMPKRVPYTSTINALTRMMREEGLKGLYSGFGPSLIGIA  221

Query  600  HVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ  421
            HV IQFP YE IK+ LA     +++K+   ++ VAS+++K+ AST+TYPHEV+RS +   
Sbjct  222  HVIIQFPLYESIKVELAREREVAVNKIEPIDLMVASAIAKMIASTLTYPHEVIRSHMHVH  281

Query  420  GLHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHR  259
            GL     +SG+   VR+++ + G+  FYRGCATNLIRTTPAA ITFTSFE++ R
Sbjct  282  GLGP---FSGIGALVRRIYLEGGVAAFYRGCATNLIRTTPAAAITFTSFELVSR  332


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 86/172 (50%), Gaps = 18/172 (10%)
 Frame = -2

Query  753  LWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAG-VSHVAIQFPT  577
            L V+ TRLQ      G   Y  T  ALRRI R EG RGLY GL P +A  + +  + F T
Sbjct  71   LDVLKTRLQVSAATTGTTEYLSTYGALRRIVRHEGARGLYRGLGPTVAALLPNWGVYFST  130

Query  576  YEKIK-IYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS---  409
            Y  +K I++A+ ++      +    A  +  + IF   +T P  V ++RLQ Q  H+   
Sbjct  131  YGALKRIFIADANH-----FAHILAAAGAGAATIF---VTNPLWVAKTRLQVQHSHALAS  182

Query  408  --EKR--YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMI  265
               KR  Y+  I+ + ++ ++EG+ G Y G   +LI      +I F  +E I
Sbjct  183  AMPKRVPYTSTINALTRMMREEGLKGLYSGFGPSLIGIA-HVIIQFPLYESI  233



>ref|XP_007509429.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19232.1| predicted protein [Bathycoccus prasinos]
Length=389

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 127/184 (69%), Gaps = 12/184 (7%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQ---GMRAGFV-----PYRGTLSALRRIAREEGIRGLYSGLVPAL  613
            +ATN LWV  TRLQ Q    + +  V     PY+GTL ALRRIAR EGI GLYSGL P+L
Sbjct  193  LATNPLWVAKTRLQVQYSETLSSSLVGHARAPYKGTLDALRRIARCEGIPGLYSGLAPSL  252

Query  612  AGVSHVAIQFPTYEKIKIYLAN-RDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRS  436
             G+SHVAIQFP YE++K  LA  R   S D+L+A+++A++S V+KI AST+TYPHEV+RS
Sbjct  253  MGISHVAIQFPIYERLKHELAQFRTLRSADELTAADLALSSGVAKIIASTLTYPHEVLRS  312

Query  435  RLQEQGLHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRF  256
             +  +G      +SG +     ++++ G   FYRG  TNL+RTTPAA ITFTSFE+I R 
Sbjct  313  HMHVKGYGP---FSGALTLAADIYREGGAKAFYRGVGTNLLRTTPAAAITFTSFELISRE  369

Query  255  LVSV  244
            L +V
Sbjct  370  LNAV  373



>ref|XP_003082002.1| putative mitochondrial carrier protein (ISS) [Ostreococcus tauri]
 emb|CAL55805.1| Mitochondrial substrate/solute carrier [Ostreococcus tauri]
Length=398

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 119/176 (68%), Gaps = 9/176 (5%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRA--GFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAG  607
            + TN LWV  TRLQ Q  +A  G +P    Y  T+ AL R+AREEG+RGLYSG  P+L G
Sbjct  213  LVTNPLWVAKTRLQVQHSKALAGALPKRAHYTSTVDALTRMAREEGLRGLYSGFGPSLIG  272

Query  606  VSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQ  427
            ++HV IQFP YE IK  +A R    +D ++ +++ +AS+V+K+ ASTMTYPHEV+RS + 
Sbjct  273  IAHVIIQFPLYESIKFDIARRREVPLDDIAPTDLMLASAVAKMIASTMTYPHEVIRSHMH  332

Query  426  EQGLHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHR  259
              GL     + G+   V  +++  G+  FYRGC TNLIRTTPAA ITFTSFE++ R
Sbjct  333  VHGLGP---FRGIGSLVASIYRDGGVVAFYRGCGTNLIRTTPAAAITFTSFELVSR  385



>ref|XP_002509046.1| mitochondrial carrier family [Micromonas sp. RCC299]
 gb|ACO70304.1| mitochondrial carrier family [Micromonas sp. RCC299]
Length=314

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 126/190 (66%), Gaps = 12/190 (6%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQ---GMRAGF---VPYRGTLSALRRIAREEGIRGLYSGLVPALAG  607
            + TN LWVV TRLQ Q    +RA     VPY G  SAL R+A EEG RGLYSGL P+LAG
Sbjct  127  LVTNPLWVVKTRLQVQHSEALRASMPTRVPYSGAFSALGRVAAEEGARGLYSGLAPSLAG  186

Query  606  VSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQ  427
            +SHV IQFP YE++K+ LA+R   +   L+ + + VAS+V+K+ AS++TYPHEV+RS + 
Sbjct  187  ISHVVIQFPVYEQLKLELASRRGKATGDLTPTELVVASAVAKMVASSVTYPHEVIRSHMH  246

Query  426  EQGLHSEKRYSGVIDCVRKVFQQ-EGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL-  253
             QGL     + G+   + ++++   G   FYRG  TNL+RTTPAA ITFTS+E+I R L 
Sbjct  247  VQGLGP---FEGLFGLIGRIYKDGGGWRAFYRGVGTNLVRTTPAAAITFTSYELISRQLR  303

Query  252  -VSVFPPDPQ  226
             +  F  D Q
Sbjct  304  DIGAFYRDSQ  313


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 85/182 (47%), Gaps = 21/182 (12%)
 Frame = -2

Query  747  VVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQFPTYE  571
            V+ TRLQ   +R G   Y  TL +L  IAR EG  GLY GL P + A + + A+ F  YE
Sbjct  31   VLKTRLQVSTLRVGGDAYVSTLQSLSAIARTEGFVGLYRGLTPTIVALLPNWAVYFTVYE  90

Query  570  KIKIYL-----ANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
             +K ++     A   + S   L     A  + V+ +    +T P  VV++RLQ Q  HSE
Sbjct  91   GLKEFMEPVGAAGSQSWSSPHLRHMVSAAGAGVATVL---VTNPLWVVKTRLQVQ--HSE  145

Query  405  KR---------YSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                       YSG    + +V  +EG  G Y G A +L   +   VI F  +E +   L
Sbjct  146  ALRASMPTRVPYSGAFSALGRVAAEEGARGLYSGLAPSLAGIS-HVVIQFPVYEQLKLEL  204

Query  252  VS  247
             S
Sbjct  205  AS  206



>ref|XP_005848904.1| hypothetical protein CHLNCDRAFT_51574 [Chlorella variabilis]
 gb|EFN56802.1| hypothetical protein CHLNCDRAFT_51574 [Chlorella variabilis]
Length=979

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 121/177 (68%), Gaps = 10/177 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQ--GMRAGF----VPYRGTLSALRRIAREEGIRGLYSGLVPALAGVS  601
            TN LWV+ TRLQTQ  G+R G       YRGTL AL RIAREEG+ GLYSGL P+L GV 
Sbjct  332  TNPLWVIKTRLQTQNMGIRMGASGNPALYRGTLDALIRIAREEGVAGLYSGLGPSLLGVM  391

Query  600  HVAIQFPTYEKIK-IYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQE  424
            HV IQFP YE +K  + A   +   D L+   + +AS+ SK+ AST TYPHEVVRSR+  
Sbjct  392  HVVIQFPLYESLKGRFAAQHPHDGGDTLNLYELILASATSKMIASTATYPHEVVRSRMHI  451

Query  423  QGLHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
             G  +   ++G     R++  ++G+PGFYRGC TNL+RTTPAA +TFTSFE+I+R L
Sbjct  452  AGTGA---FTGFARTCRQIMVEDGVPGFYRGCMTNLLRTTPAAAVTFTSFELINRQL  505



>ref|XP_002952313.1| hypothetical protein VOLCADRAFT_62332 [Volvox carteri f. nagariensis]
 gb|EFJ46784.1| hypothetical protein VOLCADRAFT_62332 [Volvox carteri f. nagariensis]
Length=290

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 118/175 (67%), Gaps = 8/175 (5%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            + TN LWVV TR+Q+  +R    PY+ T  AL RIAREEG+RGLYSGL P++AG++HVAI
Sbjct  117  LVTNPLWVVKTRMQSPYLRRP--PYKSTAEALVRIAREEGLRGLYSGLAPSMAGIAHVAI  174

Query  588  QFPTYEKIKIYLANRDNT---SMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            QFP YE  K   +   +    + D L+   +   S+ +K+ AST+TYPHEVVRS +   G
Sbjct  175  QFPLYEYAKQVRSTEYDVVVPATDCLTVPELVATSAFAKVVASTVTYPHEVVRSYMHLSG  234

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                   SG+ + +  V++++G+ GFYRGCA NL+RTTPAA +TFT+FE++ R L
Sbjct  235  ---SGPLSGLKEAMGAVWREDGVRGFYRGCAANLVRTTPAAAMTFTTFELVSRAL  286



>ref|XP_001701258.1| hypothetical protein CHLREDRAFT_122344 [Chlamydomonas reinhardtii]
 gb|EDO97651.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=303

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 117/181 (65%), Gaps = 12/181 (7%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGM-RAGF---VPYR-GTLSALRRIAREEGIRGLYSGLVPALAGV  604
            + TN LWVV TR+Q  GM RAG     P   GT  AL RIAREEG+RGLYSGL P++AG+
Sbjct  122  LVTNPLWVVKTRMQCHGMSRAGVGIATPASSGTAQALLRIAREEGLRGLYSGLAPSMAGI  181

Query  603  SHVAIQFPTYEKIK----IYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRS  436
            +HVAIQFP YE  K       A     + D L+   +   S+ +K+ AST TYPHEVVRS
Sbjct  182  AHVAIQFPLYEYAKQAAAAAAAAAAAATTDTLTVPELVATSAFAKVVASTATYPHEVVRS  241

Query  435  RLQEQGLHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRF  256
             +   G       SG+ + V  V++++G+ GFYRGCA NL+RTTPAA +TFT+FE++ R 
Sbjct  242  YMHLSG---SGPLSGLKEAVTAVWREDGLRGFYRGCAANLVRTTPAAAMTFTTFELVSRA  298

Query  255  L  253
            L
Sbjct  299  L  299



>gb|KJB48099.1| hypothetical protein B456_008G053500 [Gossypium raimondii]
Length=246

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            I TN LWVV TRLQTQGMR G VPY G LSALRRI  EEG+RGLYSG++P+LAG+SHVAI
Sbjct  139  IVTNPLWVVKTRLQTQGMRTGVVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVAI  198

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEV  445
            QFP YEKIK Y+A + NT++D+LS S+VA+ASS+SK+ AS MTYPHEV
Sbjct  199  QFPAYEKIKSYMAKKGNTTVDRLSPSDVAIASSISKVLASIMTYPHEV  246


 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 98/172 (57%), Gaps = 7/172 (4%)
 Frame = -2

Query  753  LWVVXTRLQTQGM-RAGFVPYRGT--LSALRRIAREEGIRGLYSGLVPAL-AGVSHVAIQ  586
            L V+ TRLQ  G+  A     R +  +++L+ I + EG++GLY GL P + A + + A+ 
Sbjct  41   LDVIKTRLQVHGLPTASKTGVRDSVIITSLQHIIKTEGLKGLYRGLSPTIIALLPNWAVY  100

Query  585  FPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSE  406
            F  YE++K  LA+ DN S  +L+     VA++ +    + +T P  VV++RLQ QG+ + 
Sbjct  101  FTVYEQLKGLLASHDNNSA-QLTIGENMVAAAGAGAATAIVTNPLWVVKTRLQTQGMRTG  159

Query  405  K-RYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
               Y+GV+  +R++  +EG+ G Y G   +L   +  A I F ++E I  ++
Sbjct  160  VVPYTGVLSALRRIVHEEGLRGLYSGVLPSLAGISHVA-IQFPAYEKIKSYM  210



>gb|EIE92451.1| hypothetical protein RO3G_16973 [Rhizopus delemar RA 99-880]
Length=180

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 119/175 (68%), Gaps = 6/175 (3%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TI TN LWV+ TRL TQ  R  +  Y  T+ A   IA+EEG RG Y GL P+L G+SHVA
Sbjct  8    TILTNPLWVIKTRLMTQNERTLY-RYNNTIHAFSTIAKEEGFRGFYKGLGPSLIGISHVA  66

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            +QFP YEK+K+ L    +T M    +S++ +AS++SK+ AS  TYPHEV+R+RLQ Q   
Sbjct  67   VQFPLYEKLKVVL----HTEMTTGGSSSILLASALSKMAASLATYPHEVIRTRLQNQ-TR  121

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
               +Y+G++  ++ + ++EG+ GFY+G +TNL+RT P++ +T  ++E++ R L S
Sbjct  122  KPYKYNGIVHAIKVMSKEEGVRGFYKGLSTNLVRTVPSSALTILTYELVVRKLDS  176



>ref|XP_009680639.1| PREDICTED: mitochondrial folate transporter/carrier [Struthio 
camelus australis]
Length=247

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 10/177 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    Y+G L AL++I ++EG+RGLY G VP L G SH 
Sbjct  70   TNPIWVTKTRLVLQ-YNAGVDPSKRQYKGMLDALKKIYKKEGVRGLYKGFVPGLFGTSHG  128

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  129  ALQFMAYEDLKLRYNKYRNRLSDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  187

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+S
Sbjct  188  ---HNTYSGVFDVIRRTWRREGIHGFYKGIIPNVIRVTPACCITFVVYENVSSFLLS  241


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 74/137 (54%), Gaps = 9/137 (7%)
 Frame = -2

Query  666  IAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavass  490
            I + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ LSA+   V+++
Sbjct  4    IWKHEGLRGLYQGVTPNMWGAGASWGLYFFFYNAIKAY---KKEGKLESLSATEHLVSAA  60

Query  489  vSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEGIPGFYRGCAT  322
             +      +T P  V ++RL  Q   G+   KR Y G++D ++K++++EG+ G Y+G   
Sbjct  61   EAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYKGMLDALKKIYKKEGVRGLYKGFVP  120

Query  321  NLIRTTPAAVITFTSFE  271
             L  T+  A + F ++E
Sbjct  121  GLFGTSHGA-LQFMAYE  136



>ref|XP_003061718.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
 gb|EEH54348.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
Length=381

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 121/184 (66%), Gaps = 12/184 (7%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGF------VPYRGTLSALRRIAREEGIRGLYSGLVPALAG  607
            + TN LWVV TRLQ Q   A         PY  T + L R+A EEG+RG YSGL P+L G
Sbjct  182  LTTNPLWVVKTRLQVQSSAALASSLPRRAPYTSTANGLYRLATEEGLRGAYSGLAPSLLG  241

Query  606  VSHVAIQFPTYEKIKIYLANR--DNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSR  433
            +SHVAIQFP YE++K+ +A R  D   +  L+AS + VAS+V+K+ AS +TYPHEV+RS 
Sbjct  242  ISHVAIQFPVYEQLKLEMARRKGDGARVTDLAASELMVASAVAKLTASVVTYPHEVIRSH  301

Query  432  LQEQGLHSEKRYSGVIDCVRKVFQQ-EGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRF  256
            +  +G      + GV   +R++ ++  G+  FYRG  TNLIRTTPAA ITFTS+E+I R 
Sbjct  302  MHVRGFGP---FEGVFCLMRRIHREGGGVRAFYRGVGTNLIRTTPAAAITFTSYELISRK  358

Query  255  LVSV  244
            L ++
Sbjct  359  LRAI  362



>gb|AFK47776.1| unknown [Medicago truncatula]
Length=153

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 5/134 (4%)
 Frame = -2

Query  555  LANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK---RYSGVI  385
            +A +DNT++DKL+  +VA+ASS+SK+ AS MTYPHEV+RSRLQEQG        +Y+GVI
Sbjct  1    MAKKDNTTVDKLNPGSVAIASSISKVTASVMTYPHEVIRSRLQEQGQAKNSSGVQYAGVI  60

Query  384  DCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP--QPQPL*  211
            DC +KVFQ+EGI GFYRGCATNL+RTTP+AVITFTS+EMIHRFL    P +   +P+P  
Sbjct  61   DCTKKVFQKEGIRGFYRGCATNLLRTTPSAVITFTSYEMIHRFLTRTIPQNEPNKPKPEA  120

Query  210  GSISSCIGNYYGLS  169
              I    G+  G S
Sbjct  121  SDIDMKNGDDRGES  134



>gb|KFV85122.1| Mitochondrial folate transporter/carrier, partial [Struthio camelus 
australis]
Length=266

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 10/177 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    Y+G L AL++I ++EG+RGLY G VP L G SH 
Sbjct  89   TNPIWVTKTRLVLQ-YNAGVDPSKRQYKGMLDALKKIYKKEGVRGLYKGFVPGLFGTSHG  147

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  148  ALQFMAYEDLKLRYNKYRNRLSDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  206

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+S
Sbjct  207  ---HNTYSGVFDVIRRTWRREGIHGFYKGIIPNVIRVTPACCITFVVYENVSSFLLS  260


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 78/147 (53%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  I + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  13   YHGILHCMTTIWKHEGLRGLYQGVTPNMWGAGASWGLYFFFYNAIKAY---KKEGKLESL  69

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G++D ++K++++EG
Sbjct  70   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYKGMLDALKKIYKKEG  129

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            + G Y+G    L  T+  A + F ++E
Sbjct  130  VRGLYKGFVPGLFGTSHGA-LQFMAYE  155



>ref|XP_003700146.1| PREDICTED: mitochondrial folate transporter/carrier-like [Megachile 
rotundata]
Length=332

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 115/190 (61%), Gaps = 9/190 (5%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVS  601
            + TN LWVV TRL  Q M    +P    Y G + A+R+I R EG+RGLY G +P + GVS
Sbjct  139  VMTNPLWVVKTRLCLQYMDDKHLPETLRYNGMVDAIRKIYRTEGVRGLYRGFIPGMFGVS  198

Query  600  HVAIQFPTYEKIKIYLANRDNTSMD-KLsasnvavassvSKIFASTMTYPHEVVRSRLQE  424
            H AIQF  YE++K +     N  +D KLS       ++VSK+ A+  TYP++VVR+RLQ+
Sbjct  199  HGAIQFMVYEELKNWYNEYLNAPIDSKLSTLEYIFFAAVSKLIAAATTYPYQVVRARLQD  258

Query  423  QGLHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
               H    Y+G +DCV+ +++ EG  G+Y+G + NL R TPA VITF  +E + R+L+  
Sbjct  259  HHHH----YNGSVDCVKSIWRYEGWRGYYKGLSANLTRVTPATVITFVVYENVSRYLLHR  314

Query  243  FPPDPQPQPL  214
               D  P P 
Sbjct  315  RDEDRAPLPF  324


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 75/153 (49%), Gaps = 9/153 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV-AIQFPTYEKIKIYLANRDNTSMDKL  520
            Y+   SA+ +I + EGI+GLY G+ P + G        F  Y  IK ++   +N     L
Sbjct  64   YKSLKSAVMQIVKTEGIKGLYRGVTPNVLGSGGAWGCYFFFYNTIKTWINGGNNKK--SL  121

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRL-----QEQGLHSEKRYSGVIDCVRKVFQQE  355
                   A++ + I    MT P  VV++RL      ++ L    RY+G++D +RK+++ E
Sbjct  122  GPCMHMFAAADAGILTLVMTNPLWVVKTRLCLQYMDDKHLPETLRYNGMVDAIRKIYRTE  181

Query  354  GIPGFYRGCATNLIRTTPAAVITFTSFEMIHRF  256
            G+ G YRG    +   +  A I F  +E +  +
Sbjct  182  GVRGLYRGFIPGMFGVSHGA-IQFMVYEELKNW  213



>ref|XP_004343599.2| substrate carrier family protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE97291.1| substrate carrier family protein [Capsaspora owczarzaki ATCC 
30864]
Length=452

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 109/180 (61%), Gaps = 4/180 (2%)
 Frame = -2

Query  768  IATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAI  589
            +ATN LWVV TR+ TQ   A    Y G L A + IAR EG+RG Y GLVP+L GV HV I
Sbjct  277  LATNPLWVVKTRMMTQN-SASHHQYNGLLHAFQTIARTEGVRGFYKGLVPSLLGVVHVGI  335

Query  588  QFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHS  409
            QFP YE++K Y   ++      L    +  ++++SKI AS + YPHEVVR+RLQ Q   S
Sbjct  336  QFPLYERLKGYFLAQNPD--HPLGPVQLMTSAALSKIVASVIWYPHEVVRARLQNQS-QS  392

Query  408  EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPDP  229
              +Y GVI  VR   Q+ G+   Y G  TNL+R  PA  ITFT++EM +R L+ V    P
Sbjct  393  PPKYHGVIHTVRLTVQESGVRALYAGLFTNLLRVVPAGAITFTTYEMFNRMLLQVLEGSP  452



>ref|XP_003287851.1| hypothetical protein DICPUDRAFT_87783 [Dictyostelium purpureum]
 gb|EGC35614.1| hypothetical protein DICPUDRAFT_87783 [Dictyostelium purpureum]
Length=288

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVAIQF  583
            TN +W++ TR  TQ M      YRG   ++  I  EEG R LY GL P+L GV HV +QF
Sbjct  113  TNPIWLIKTRFITQEMDGRQKRYRGVFHSISSIYHEEGFRALYKGLGPSLLGVLHVGVQF  172

Query  582  PTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLHSEK  403
            P YEK K+Y A+++ +  D+L+   +  ASS+SKI AS + YPHEV+RSRLQ+    S  
Sbjct  173  PLYEKFKVYFAHQNKS--DELTVVQIMAASSLSKIIASIVAYPHEVLRSRLQDSSPDSPN  230

Query  402  R-YSG-VIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
            R Y G ++  V+++ ++EG  G Y+G   NL+R TP+ VITFTS+E I ++L  +
Sbjct  231  RTYQGNLVQMVKQIIREEGWRGLYKGMGVNLLRVTPSCVITFTSYEFIKKYLTQL  285



>gb|KFO74010.1| Mitochondrial folate transporter/carrier, partial [Cuculus canorus]
Length=266

 Score =   147 bits (371),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  89   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  147

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   RD  S  KL+     + +++SKIFA + TYP++VVR+RLQ+Q 
Sbjct  148  ALQFMAYEDLKLRYNKYRDRVSDTKLNTVEYIMMAAISKIFAVSATYPYQVVRARLQDQ-  206

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D + + +++EGI GFY+G   N+IR TPA  ITF  +E + RFL+
Sbjct  207  ---HNTYSGVFDVISRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSRFLL  259


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  13   YNGILHCMTTVWKHEGLRGLYQGVTPNMFGAGASWGLYFFFYNAIKAY---KKEGKLESL  69

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  70   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  129

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  130  IRGLYKGFVPGLFGTSHGA-LQFMAYE  155



>gb|KFV65548.1| Mitochondrial folate transporter/carrier, partial [Picoides pubescens]
Length=264

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   ALR+I R EG+RGLY G VP L G SH 
Sbjct  87   TNPIWVTKTRLVLQ-YDAGVDPSKRQYRGMCDALRKIYRAEGVRGLYKGFVPGLFGTSHG  145

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  146  ALQFMAYEDLKLRYNQYRNRVSDTKLNTVEYILMAAVSKIFAVSATYPYQVVRARLQDQ-  204

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D + + +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  205  ---HNTYSGVFDVIHRTWRKEGIHGFYKGIVANVIRVTPACCITFVVYENVSSFLL  257


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 76/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    M+ L
Sbjct  11   YNGILHCMSTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKMESL  67

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRL---QEQGLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL    + G+   KR Y G+ D +RK+++ EG
Sbjct  68   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYDAGVDPSKRQYRGMCDALRKIYRAEG  127

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            + G Y+G    L  T+  A + F ++E
Sbjct  128  VRGLYKGFVPGLFGTSHGA-LQFMAYE  153



>ref|XP_009911822.1| PREDICTED: mitochondrial folate transporter/carrier isoform X2 
[Haliaeetus albicilla]
Length=183

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  6    TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  64

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE++K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  65   ALQFMAYEELKLRYNKYRNRASDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  123

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  124  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACSITFVVYENVSGFLL  176



>ref|XP_009935817.1| PREDICTED: mitochondrial folate transporter/carrier [Opisthocomus 
hoazin]
Length=247

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQ---GMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TN +WV  TRL  Q   G+ +    YRG   AL +I + EGIRGLY G VP L G SH A
Sbjct  70   TNPIWVTKTRLVLQYNAGVDSSKRQYRGMFDALIKIYKMEGIRGLYKGFVPGLFGTSHGA  129

Query  591  IQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            +QF  YE +K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q  
Sbjct  130  LQFMAYEDLKLRYNKYRNRGSDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ--  187

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                 YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E + RFL+
Sbjct  188  --HNTYSGVFDVIRRTWRKEGIHGFYKGITPNVIRVTPACCITFVVYENLSRFLL  240


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 72/137 (53%), Gaps = 9/137 (7%)
 Frame = -2

Query  666  IAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavass  490
            + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ LSA+   V+++
Sbjct  4    VWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESLSATEHLVSAA  60

Query  489  vSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEGIPGFYRGCAT  322
             +      +T P  V ++RL  Q   G+ S KR Y G+ D + K+++ EGI G Y+G   
Sbjct  61   EAGAMTLCVTNPIWVTKTRLVLQYNAGVDSSKRQYRGMFDALIKIYKMEGIRGLYKGFVP  120

Query  321  NLIRTTPAAVITFTSFE  271
             L  T+  A + F ++E
Sbjct  121  GLFGTSHGA-LQFMAYE  136



>gb|ETS62730.1| hypothetical protein PaG_02468 [Pseudozyma aphidis DSM 70725]
Length=310

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 109/181 (60%), Gaps = 5/181 (3%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            T+ T+ LWVV TR   Q  R+    YR T  A  +I R EG+RG Y GL+P+L GVSHVA
Sbjct  134  TVCTSPLWVVKTRFMLQSSRSSVQRYRHTADAFVQIYRSEGLRGFYKGLLPSLLGVSHVA  193

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            +QFP YE  K     RD    D L+A+ +   SS +K+ AS  TYPHEV+R+RLQ Q   
Sbjct  194  VQFPLYESFKSL--ARDRVGRDDLTAAEILTCSSSAKMIASVTTYPHEVLRTRLQMQPRG  251

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSVFPPD  232
              + YSGV    + + + EG+ GFY+G   NL+RT P++ +T  ++E+I + L     PD
Sbjct  252  EGRTYSGVWQACKTIARDEGVRGFYKGMTVNLVRTVPSSALTILTYELIMQHLTH---PD  308

Query  231  P  229
            P
Sbjct  309  P  309


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 88/193 (46%), Gaps = 23/193 (12%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMR------------AGFVP------YRGTLSALRRIAREEGI  646
            ++ T  L VV TRLQ Q  R               +P      Y G    LR+I  ++GI
Sbjct  16   SVLTCPLDVVKTRLQAQEGRRRPTAVSAPIADVAAIPSVEAQRYLGLRGTLRKIWADDGI  75

Query  645  RGLYSGLVPALAG-VSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFAS  469
            RG Y GL P + G +   AI F  Y+  K  LA RD     +    N  V++  +   ++
Sbjct  76   RGFYRGLGPTIFGYLPTWAIYFSVYDSCKTILA-RDVAGSGEEDFVNHIVSAMTAGAAST  134

Query  468  TMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAV  292
              T P  VV++R   Q   S  +RY    D   ++++ EG+ GFY+G   +L+  +  AV
Sbjct  135  VCTSPLWVVKTRFMLQSSRSSVQRYRHTADAFVQIYRSEGLRGFYKGLLPSLLGVSHVAV  194

Query  291  I--TFTSFEMIHR  259
                + SF+ + R
Sbjct  195  QFPLYESFKSLAR  207



>ref|XP_003219480.1| PREDICTED: mitochondrial folate transporter/carrier [Anolis carolinensis]
Length=331

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 111/177 (63%), Gaps = 8/177 (5%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQ---GMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TN +WV  TRL  Q   G+ +    Y+G L AL +I + EGIRGLY G VP L G SH A
Sbjct  155  TNPIWVTKTRLVLQYEAGIDSSKRQYKGMLDALIKIYKYEGIRGLYKGFVPGLFGTSHGA  214

Query  591  IQFPTYEKIKIYLANRDNTSMD-KLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            +QF  YE++K       N   D KLSA      +++SKIFA   TYP++VVR+RLQ+Q  
Sbjct  215  LQFMVYEELKTKYNRYKNRQFDLKLSALEYITMAALSKIFAVCATYPYQVVRARLQDQ--  272

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVSV  244
                RYSGV+D +R+ +++EG+ GFY+G   N+IR TPA  ITF  +E +  FL+S+
Sbjct  273  --HNRYSGVVDVIRRTWRKEGVHGFYKGIVPNVIRVTPACCITFVVYEKVSHFLISL  327


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  L  I RE+G RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  79   YNGILHCLATIWREDGFRGLYRGVTPNVWGAGASWGLYFYFYNAIKAY---KTEDRLEGL  135

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRL---QEQGLHSEKR-YSGVIDCVRKVFQQEG  352
             A+   V+++ +      +T P  V ++RL    E G+ S KR Y G++D + K+++ EG
Sbjct  136  GATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYEAGIDSSKRQYKGMLDALIKIYKYEG  195

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F  +E
Sbjct  196  IRGLYKGFVPGLFGTSHGA-LQFMVYE  221



>emb|CEG79270.1| hypothetical protein RMATCC62417_13755 [Rhizopus microsporus]
Length=305

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 117/174 (67%), Gaps = 6/174 (3%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            T  TN LWV+ TRL TQ  R  +  Y  T+ A   IA+EEG RG Y GL P+L G+SHVA
Sbjct  131  TTLTNPLWVIKTRLMTQSERTSY-RYNNTIHAFATIAKEEGFRGFYKGLGPSLIGISHVA  189

Query  591  IQFPTYEKIKIYL-ANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            +QFP YEK+K+ L  +RD++S      +++ +AS++SK+ AS  TYPHEV+R+RLQ Q  
Sbjct  190  VQFPLYEKLKVVLHVDRDSSSYGS---TSILLASALSKMSASLATYPHEVIRTRLQNQ-T  245

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
                +Y G++  ++ + ++EG+ GFY+G  TNL+RT P++ +T  ++E+I R L
Sbjct  246  RKPYKYKGILHAIKIMSKEEGLSGFYKGLTTNLLRTVPSSAMTILTYELIVRKL  299


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 83/162 (51%), Gaps = 5/162 (3%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMR-AGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAG-VSH  598
            +I T  L V  TRLQ QG+   G   Y+GT+  L RI  EEGIRGLY GL P + G +  
Sbjct  32   SIVTCPLDVAKTRLQNQGVTLPGEKIYKGTVGTLSRIWHEEGIRGLYRGLGPTILGYLPT  91

Query  597  VAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
             AI F  Y+  K   AN      + L     A+++      ++T+T P  V+++RL  Q 
Sbjct  92   WAIYFTAYDYCKSQWANEIGNEKEWLLHIISAMSAGA---LSTTLTNPLWVIKTRLMTQS  148

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAV  292
              +  RY+  I     + ++EG  GFY+G   +LI  +  AV
Sbjct  149  ERTSYRYNNTIHAFATIAKEEGFRGFYKGLGPSLIGISHVAV  190


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = -2

Query  480  IFASTMTYPHEVVRSRLQEQG--LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRT  307
            I +S +T P +V ++RLQ QG  L  EK Y G +  + +++ +EGI G YRG    ++  
Sbjct  29   IVSSIVTCPLDVAKTRLQNQGVTLPGEKIYKGTVGTLSRIWHEEGIRGLYRGLGPTILGY  88

Query  306  TPAAVITFTSFE  271
             P   I FT+++
Sbjct  89   LPTWAIYFTAYD  100



>gb|KFR01756.1| Mitochondrial folate transporter/carrier, partial [Nipponia nippon]
Length=268

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 108/176 (61%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKMEGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++ SKIFA T TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYIMMAAASKIFAVTATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIVPNVIRVTPACCITFVVYENVSGFLL  261


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKMEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>gb|KFR13075.1| Mitochondrial folate transporter/carrier, partial [Opisthocomus 
hoazin]
Length=268

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQ---GMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TN +WV  TRL  Q   G+ +    YRG   AL +I + EGIRGLY G VP L G SH A
Sbjct  91   TNPIWVTKTRLVLQYNAGVDSSKRQYRGMFDALIKIYKMEGIRGLYKGFVPGLFGTSHGA  150

Query  591  IQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            +QF  YE +K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q  
Sbjct  151  LQFMAYEDLKLRYNKYRNRGSDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ--  208

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                 YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E + RFL+
Sbjct  209  --HNTYSGVFDVIRRTWRKEGIHGFYKGITPNVIRVTPACCITFVVYENLSRFLL  261


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 76/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+ S KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLCVTNPIWVTKTRLVLQYNAGVDSSKRQYRGMFDALIKIYKMEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>ref|XP_010403479.1| PREDICTED: mitochondrial folate transporter/carrier, partial 
[Corvus cornix cornix]
Length=265

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  88   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMCDALIKIYKTEGIRGLYKGFVPGLFGTSHG  146

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K  Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  147  ALQFMAYEDLKERYNKYRNRVSDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  205

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGIPGFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  206  ---HNTYSGVFDVIRRTWRKEGIPGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  258


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    M+ L
Sbjct  12   YNGILHCMTTVWKHEGLRGLYQGVTPNMVGAGASWGLYFFFYNAIKAY---KKEGKMESL  68

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SAS   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  69   SASEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMCDALIKIYKTEG  128

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  129  IRGLYKGFVPGLFGTSHGA-LQFMAYE  154



>dbj|GAK63323.1| mitochondrial NAD transporter [Pseudozyma antarctica]
Length=310

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 107/173 (62%), Gaps = 2/173 (1%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            T+ T+ LWVV TR   Q  R+    YR T  A  +I R EG+RG Y GL+P+L GVSHVA
Sbjct  134  TVCTSPLWVVKTRFMLQSSRSSVQRYRHTADAFVQIYRSEGLRGFYKGLLPSLLGVSHVA  193

Query  591  IQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGLH  412
            +QFP YE  K     RD    D L+A+ +   SS +K+ AS  TYPHEV+R+RLQ Q   
Sbjct  194  VQFPLYESFKSL--ARDRVGRDDLTAAEILTCSSSAKMIASVTTYPHEVLRTRLQMQPRG  251

Query  411  SEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFL  253
              + YSGV+   + + + EG+ GFY+G   NL+RT P++ +T  ++E+I + L
Sbjct  252  QGRTYSGVLQACKTIARDEGVRGFYKGMTVNLVRTVPSSALTILTYELIMQHL  304


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 88/193 (46%), Gaps = 23/193 (12%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMR----AGFVP--------------YRGTLSALRRIAREEGI  646
            ++ T  L VV TRLQ Q  R    A   P              Y G    LR+I  ++GI
Sbjct  16   SVLTCPLDVVKTRLQAQEGRRRPAALSTPIADASAISSVETQRYLGLRGTLRKIWADDGI  75

Query  645  RGLYSGLVPALAG-VSHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFAS  469
            RG Y GL P + G +   AI F  Y+  K  LA RD     +    N  V++  +   ++
Sbjct  76   RGFYRGLGPTIFGYLPTWAIYFSVYDSCKTILA-RDVAGSGEEDFVNHIVSAMTAGAAST  134

Query  468  TMTYPHEVVRSRLQEQGLHSE-KRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAV  292
              T P  VV++R   Q   S  +RY    D   ++++ EG+ GFY+G   +L+  +  AV
Sbjct  135  VCTSPLWVVKTRFMLQSSRSSVQRYRHTADAFVQIYRSEGLRGFYKGLLPSLLGVSHVAV  194

Query  291  --ITFTSFEMIHR  259
                + SF+ + R
Sbjct  195  QFPLYESFKSLAR  207



>ref|XP_009556344.1| PREDICTED: mitochondrial folate transporter/carrier [Cuculus 
canorus]
Length=306

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 109/177 (62%), Gaps = 10/177 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  129  TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  187

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   RD  S  KL+     + +++SKIFA + TYP++VVR+RLQ+Q 
Sbjct  188  ALQFMAYEDLKLRYNKYRDRVSDTKLNTVEYIMMAAISKIFAVSATYPYQVVRARLQDQ-  246

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                  YSGV D + + +++EGI GFY+G   N+IR TPA  ITF  +E + RFL+ 
Sbjct  247  ---HNTYSGVFDVISRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSRFLLG  300


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  53   YNGILHCMTTVWKHEGLRGLYQGVTPNMFGAGASWGLYFFFYNAIKAY---KKEGKLESL  109

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  110  SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  169

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  170  IRGLYKGFVPGLFGTSHGA-LQFMAYE  195



>gb|KFO56811.1| Mitochondrial folate transporter/carrier, partial [Corvus brachyrhynchos]
Length=268

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMCDALIKIYKTEGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K  Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKERYNKYRNRVSDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGIPGFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVFDVIRRTWRKEGIPGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  261


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    M+ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMVGAGASWGLYFFFYNAIKAY---KKEGKMESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SAS   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SASEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMCDALIKIYKTEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>ref|XP_010294543.1| PREDICTED: mitochondrial folate transporter/carrier isoform X2 
[Phaethon lepturus]
Length=183

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    Y+G   AL +I + EGIRGLY G VP L G SH 
Sbjct  6    TNPIWVTKTRLVLQ-YNAGVDPSKRQYKGMFDALIKIYKAEGIRGLYKGFVPGLFGTSHG  64

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  65   ALQFMAYEDLKLRYNKYRNRESDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  123

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EG+ GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  124  ---HNMYSGVFDVIRRTWRKEGVHGFYKGVVPNVIRVTPACCITFVVYENVSGFLL  176



>gb|KFQ30737.1| Mitochondrial folate transporter/carrier, partial [Merops nubicus]
Length=268

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPVWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALTKIYKTEGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNTYRNRVSDAKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSSFLL  261


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    +  L
Sbjct  15   YNGILHCITTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLQGL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLCITNPVWVTKTRLVLQYNAGVDPSKRQYRGMFDALTKIYKTEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>ref|XP_009911820.1| PREDICTED: mitochondrial folate transporter/carrier isoform X1 
[Haliaeetus albicilla]
 ref|XP_009911821.1| PREDICTED: mitochondrial folate transporter/carrier isoform X1 
[Haliaeetus albicilla]
Length=247

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  70   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  128

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE++K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  129  ALQFMAYEELKLRYNKYRNRASDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  187

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  188  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACSITFVVYENVSGFLL  240


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 72/137 (53%), Gaps = 9/137 (7%)
 Frame = -2

Query  666  IAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavass  490
            + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ LSA+   V+++
Sbjct  4    VWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESLSATEHLVSAA  60

Query  489  vSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEGIPGFYRGCAT  322
             +     ++T P  V ++RL  Q   G+   KR Y G+ D + K+++ EGI G Y+G   
Sbjct  61   EAGAMTLSITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVP  120

Query  321  NLIRTTPAAVITFTSFE  271
             L  T+  A + F ++E
Sbjct  121  GLFGTSHGA-LQFMAYE  136



>gb|KFW66445.1| Mitochondrial folate transporter/carrier, partial [Pygoscelis 
adeliae]
Length=268

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVFDVIRRTWRKEGIHGFYKGVIPNVIRVTPACCITFVVYENVSSFLL  261


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 76/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +     ++T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLSITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>ref|XP_009321366.1| PREDICTED: mitochondrial folate transporter/carrier, partial 
[Pygoscelis adeliae]
Length=264

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  87   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  145

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  146  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  204

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  205  ---HNTYSGVFDVIRRTWRKEGIHGFYKGVIPNVIRVTPACCITFVVYENVSSFLL  257


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 76/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  11   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  67

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +     ++T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  68   SATEHLVSAAEAGAMTLSITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  127

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  128  IRGLYKGFVPGLFGTSHGA-LQFMAYE  153



>ref|XP_010194050.1| PREDICTED: mitochondrial folate transporter/carrier [Colius striatus]
Length=247

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 108/177 (61%), Gaps = 10/177 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  70   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALMKIHKREGIRGLYKGFVPGLFGTSHG  128

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  129  ALQFMAYEDLKLRYNKYRNRGSDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  187

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+ 
Sbjct  188  ---HNVYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLLG  241


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 71/137 (52%), Gaps = 9/137 (7%)
 Frame = -2

Query  666  IAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavass  490
            + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ LSA+   V+++
Sbjct  4    VWKHEGLRGLYQGVTPNMVGAGASWGLYFFFYNAIKAY---KKEGKLESLSATEHLVSAA  60

Query  489  vSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEGIPGFYRGCAT  322
             +      +T P  V ++RL  Q   G+   KR Y G+ D + K+ ++EGI G Y+G   
Sbjct  61   EAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALMKIHKREGIRGLYKGFVP  120

Query  321  NLIRTTPAAVITFTSFE  271
             L  T+  A + F ++E
Sbjct  121  GLFGTSHGA-LQFMAYE  136



>ref|XP_010161870.1| PREDICTED: mitochondrial folate transporter/carrier [Caprimulgus 
carolinensis]
Length=247

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  70   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  128

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  129  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  187

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  188  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  240


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (52%), Gaps = 9/137 (7%)
 Frame = -2

Query  666  IAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavass  490
            + + EG+RGLY G+ P + G  +   + F  Y  IK Y   R    ++ LSA+   V+++
Sbjct  4    VWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---RKEGKLESLSATEHLVSAA  60

Query  489  vSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEGIPGFYRGCAT  322
             +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EGI G Y+G   
Sbjct  61   EAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVP  120

Query  321  NLIRTTPAAVITFTSFE  271
             L  T+  A + F ++E
Sbjct  121  GLFGTSHGA-LQFMAYE  136



>gb|KFM06049.1| Mitochondrial folate transporter/carrier, partial [Aptenodytes 
forsteri]
Length=268

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKMEGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVFDVIRRTWRKEGIHGFYKGVIPNVIRVTPACCITFVVYENVSSFLL  261


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 76/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +     ++T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLSITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKMEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>ref|XP_009275444.1| PREDICTED: mitochondrial folate transporter/carrier, partial 
[Aptenodytes forsteri]
Length=265

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  88   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKMEGIRGLYKGFVPGLFGTSHG  146

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  147  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  205

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  206  ---HNTYSGVFDVIRRTWRKEGIHGFYKGVIPNVIRVTPACCITFVVYENVSSFLL  258


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 76/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  12   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  68

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +     ++T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  69   SATEHLVSAAEAGAMTLSITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKMEG  128

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  129  IRGLYKGFVPGLFGTSHGA-LQFMAYE  154



>gb|KFP15573.1| Mitochondrial folate transporter/carrier, partial [Egretta garzetta]
Length=266

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  89   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALVKIYKAEGIRGLYKGFVPGLFGTSHG  147

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  148  ALQFMAYEDLKLRYNKYRNRASDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  206

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  207  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  259


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G +  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  13   YNGIVHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  69

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  70   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALVKIYKAEG  129

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  130  IRGLYKGFVPGLFGTSHGA-LQFMAYE  155



>gb|KFQ89150.1| Mitochondrial folate transporter/carrier, partial [Phoenicopterus 
ruber ruber]
Length=268

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 110/176 (63%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+ +     ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNKYRNRLSDTKLNTAEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV+D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVLDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  261


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>ref|XP_009509434.1| PREDICTED: mitochondrial folate transporter/carrier, partial 
[Phalacrocorax carbo]
Length=266

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 109/177 (62%), Gaps = 10/177 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EG+RGLY G VP L G SH 
Sbjct  89   TNPIWVTKTRLVLQ-YDAGVDPSKRQYRGMFDALIKIYKTEGVRGLYKGFVPGLFGTSHG  147

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  148  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  206

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL++
Sbjct  207  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIVPNVIRVTPACCITFVVYEKVSGFLLA  260


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  13   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  69

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  70   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYDAGVDPSKRQYRGMFDALIKIYKTEG  129

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            + G Y+G    L  T+  A + F ++E
Sbjct  130  VRGLYKGFVPGLFGTSHGA-LQFMAYE  155



>ref|XP_009467694.1| PREDICTED: mitochondrial folate transporter/carrier [Nipponia 
nippon]
Length=309

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 108/176 (61%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  132  TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKMEGIRGLYKGFVPGLFGTSHG  190

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++ SKIFA T TYP++VVR+RLQ+Q 
Sbjct  191  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYIMMAAASKIFAVTATYPYQVVRARLQDQ-  249

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  250  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIVPNVIRVTPACCITFVVYENVSGFLL  302


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  56   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  112

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  113  SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKMEG  172

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  173  IRGLYKGFVPGLFGTSHGA-LQFMAYE  198



>gb|KFW78137.1| Mitochondrial folate transporter/carrier, partial [Phalacrocorax 
carbo]
Length=268

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 109/177 (62%), Gaps = 10/177 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EG+RGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YDAGVDPSKRQYRGMFDALIKIYKTEGVRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL++
Sbjct  209  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIVPNVIRVTPACCITFVVYEKVSGFLLA  262


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYDAGVDPSKRQYRGMFDALIKIYKTEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            + G Y+G    L  T+  A + F ++E
Sbjct  132  VRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>ref|XP_006122490.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial folate transporter/carrier 
[Pelodiscus sinensis]
Length=293

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 112/176 (64%), Gaps = 8/176 (5%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQ---GMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TN +WV  TRL  Q   G+ +    Y+G   AL +I + EGIRGLY G VP L G SH A
Sbjct  116  TNPIWVTKTRLVLQYDTGIESSKHQYKGMFDALIKIYKLEGIRGLYKGFVPGLFGTSHGA  175

Query  591  IQFPTYEKIKIYLANRDNTSMD-KLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            +QF  YE++K+      N  +D KL++      +++SKIFA + TYP++VVR+RLQ+Q  
Sbjct  176  LQFMAYEELKLRYNKHRNRLLDTKLTSLEYITMAALSKIFAVSATYPYQVVRARLQDQ--  233

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                RYSG++D +R+ +++EG+ GFY+G   NL+R TPA  ITF  +E +  FL++
Sbjct  234  --HNRYSGMVDVIRRTWRKEGVHGFYKGIIPNLLRVTPACCITFVVYENVSNFLLN  287


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 77/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  L  + ++EG++GLY G+ P + G  +   + F     IK Y   ++   ++ L
Sbjct  40   YNGILHCLTTVWKQEGLQGLYKGVTPNIWGAGASWGLYFFFXYAIKAY---KEERKLESL  96

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEK-RYSGVIDCVRKVFQQEG  352
             A+   V+++ + +    +T P  V ++RL  Q   G+ S K +Y G+ D + K+++ EG
Sbjct  97   GATEHLVSAAEAGVMTLCITNPIWVTKTRLVLQYDTGIESSKHQYKGMFDALIKIYKLEG  156

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  157  IRGLYKGFVPGLFGTSHGA-LQFMAYE  182



>ref|XP_009805360.1| PREDICTED: mitochondrial folate transporter/carrier [Gavia stellata]
Length=247

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 109/177 (62%), Gaps = 10/177 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  70   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  128

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  129  ALQFMAYEDLKLRYNKYRNRGSDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  187

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLVS  247
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+ 
Sbjct  188  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLLG  241


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 71/137 (52%), Gaps = 9/137 (7%)
 Frame = -2

Query  666  IAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKLsasnvavass  490
            + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ LSA+   V+++
Sbjct  4    VWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KMEGKLESLSATEHLVSAA  60

Query  489  vSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEGIPGFYRGCAT  322
             +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EGI G Y+G   
Sbjct  61   EAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVP  120

Query  321  NLIRTTPAAVITFTSFE  271
             L  T+  A + F ++E
Sbjct  121  GLFGTSHGA-LQFMAYE  136



>dbj|GAN03363.1| mitochondrial NAD transporter [Mucor ambiguus]
Length=305

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 116/172 (67%), Gaps = 11/172 (6%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGMRAGFVPYR--GTLSALRRIAREEGIRGLYSGLVPALAGVSH  598
            T+ TN LWV+ TRL TQ  R    PYR   TL A   IAREEG RG Y GL P+L G+SH
Sbjct  132  TMLTNPLWVIKTRLMTQNER---TPYRYNNTLHAFFTIAREEGFRGFYKGLGPSLIGISH  188

Query  597  VAIQFPTYEKIK-IYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQ  421
            VA+QFP YEK+K ++  +RD  S     +S++ +AS++SK+ AS  TYPHEV+R+RLQ Q
Sbjct  189  VAVQFPLYEKLKVVFHVDRDIAS----GSSSILLASALSKMAASLATYPHEVIRTRLQNQ  244

Query  420  GLHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMI  265
                  +Y G++  +  + ++EGI GFY+G +TNL+RT P++ +T  ++EM+
Sbjct  245  -TRKPYKYEGILHAIEVMSKEEGIRGFYKGLSTNLVRTVPSSAMTILTYEMV  295


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 84/162 (52%), Gaps = 5/162 (3%)
 Frame = -2

Query  771  TIATNSLWVVXTRLQTQGM-RAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAG-VSH  598
            +I T  L V  TRLQ QG+ + G   Y+GT+  L RI +EEGIRGLY GL P + G +  
Sbjct  33   SIVTCPLDVAKTRLQNQGIAKPGEKLYKGTVGTLSRIWQEEGIRGLYRGLGPTILGYLPT  92

Query  597  VAIQFPTYEKIKIYLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
             AI F  Y+  K + A  D    DK        ++  +   ++ +T P  V+++RL  Q 
Sbjct  93   WAIYFTAYDYCKSHWA--DELGHDK-EWLLHISSAMSAGAASTMLTNPLWVIKTRLMTQN  149

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAV  292
              +  RY+  +     + ++EG  GFY+G   +LI  +  AV
Sbjct  150  ERTPYRYNNTLHAFFTIAREEGFRGFYKGLGPSLIGISHVAV  191


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -2

Query  480  IFASTMTYPHEVVRSRLQEQGLHS--EKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRT  307
            I +S +T P +V ++RLQ QG+    EK Y G +  + +++Q+EGI G YRG    ++  
Sbjct  30   IVSSIVTCPLDVAKTRLQNQGIAKPGEKLYKGTVGTLSRIWQEEGIRGLYRGLGPTILGY  89

Query  306  TPAAVITFTSFE  271
             P   I FT+++
Sbjct  90   LPTWAIYFTAYD  101



>ref|XP_010575435.1| PREDICTED: mitochondrial folate transporter/carrier, partial 
[Haliaeetus leucocephalus]
Length=265

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  88   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  146

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE++K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  147  ALQFMAYEELKLRYNKYRNRASDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  205

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  206  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACSITFVVYENVSGFLL  258


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 76/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  12   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  68

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +     ++T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  69   SATEHLVSAAEAGAMTLSITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  128

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  129  IRGLYKGFVPGLFGTSHGA-LQFMAYE  154



>gb|KFP99838.1| Mitochondrial folate transporter/carrier, partial [Haliaeetus 
albicilla]
Length=268

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE++K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEELKLRYNKYRNRASDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACSITFVVYENVSGFLL  261


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 76/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +     ++T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLSITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>gb|KGL74093.1| Mitochondrial folate transporter/carrier, partial [Tinamus guttatus]
Length=264

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 110/176 (63%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    Y+G L AL +I ++EGIRGLY G VP L G SH 
Sbjct  87   TNPIWVTKTRLVLQ-YDAGADPSKRQYKGMLDALLKIYKKEGIRGLYKGFVPGLFGTSHG  145

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+     KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  146  ALQFMAYEDLKLRYNKYRNRVPDKKLNTVEYITTAAVSKIFAVSATYPYQVVRARLQDQ-  204

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV+D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  205  ---HNTYSGVLDVIRRTWRREGIRGFYKGIIANVIRVTPACCITFVVYENVSSFLL  257


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 77/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  11   YNGILHCMTTVWKHEGLRGLYQGVTPNVWGAGASWGLYFFFYNAIKAY---KKEGKLESL  67

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ----GLHSEKRYSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q       S+++Y G++D + K++++EG
Sbjct  68   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYDAGADPSKRQYKGMLDALLKIYKKEG  127

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  128  IRGLYKGFVPGLFGTSHGA-LQFMAYE  153



>ref|XP_009874644.1| PREDICTED: mitochondrial folate transporter/carrier, partial 
[Apaloderma vittatum]
Length=263

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  86   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  144

Query  594  AIQFPTYEKIKIYLAN-RDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+   N R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  145  ALQFMAYEDLKLRYNNYRNRISDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  203

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  204  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  256


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  10   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  66

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  67   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  126

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  127  IRGLYKGFVPGLFGTSHGA-LQFMAYE  152



>gb|KFP92228.1| Mitochondrial folate transporter/carrier, partial [Apaloderma 
vittatum]
Length=268

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKIYLAN-RDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+   N R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNNYRNRISDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  261


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>gb|ETE73913.1| Mitochondrial folate transporter/carrier, partial [Ophiophagus 
hannah]
Length=221

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 105/175 (60%), Gaps = 8/175 (5%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQ---GMRAGFVPYRGTLSALRRIAREEGIRGLYSGLVPALAGVSHVA  592
            TN +WV  TRL  Q   G       Y+G   AL +I R EGIRGLY G VP L G SH A
Sbjct  51   TNPIWVTKTRLVLQYEAGADLSKKQYKGMFDALIKIYRHEGIRGLYKGFVPGLFGTSHGA  110

Query  591  IQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQGL  415
            +QF  YE +K  Y   ++  S  KL+       ++ SKIFA T TYP++VVR+RLQ+Q  
Sbjct  111  LQFMAYEDLKSRYNKYKNKPSHMKLNTLEYITMAATSKIFAVTATYPYQVVRARLQDQ--  168

Query  414  HSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                RYSGV+D +R+ +++EG+ GFY+G   N+IR TPA  ITF  +E +   L+
Sbjct  169  --HNRYSGVLDVIRRTWRKEGVHGFYKGIMPNVIRVTPACCITFVVYEKVSHLLL  221



>ref|XP_009989131.1| PREDICTED: mitochondrial folate transporter/carrier, partial 
[Tauraco erythrolophus]
Length=265

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    Y+G   AL +I + EG+RGLY G VP L G SH 
Sbjct  88   TNPIWVTKTRLVLQ-YNAGVDPSKRQYKGMFDALIKIYKTEGVRGLYKGFVPGLFGTSHG  146

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + +++SKIFA + TYP++VVR+RLQ+Q 
Sbjct  147  ALQFMAYEDLKLRYNKYRNRVSDTKLNTLEYIMMAAISKIFAVSATYPYQVVRARLQDQ-  205

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ ++QEGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  206  ---HNTYSGVFDVIRRTWRQEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  258


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  12   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  68

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  69   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYKGMFDALIKIYKTEG  128

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            + G Y+G    L  T+  A + F ++E
Sbjct  129  VRGLYKGFVPGLFGTSHGA-LQFMAYE  154



>ref|XP_010226229.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial folate transporter/carrier 
[Tinamus guttatus]
Length=271

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 110/176 (63%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    Y+G L AL +I ++EGIRGLY G VP L G SH 
Sbjct  94   TNPIWVTKTRLVLQ-YDAGADPSKRQYKGMLDALLKIYKKEGIRGLYKGFVPGLFGTSHG  152

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+     KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  153  ALQFMAYEDLKLRYNKYRNRVPDKKLNTVEYITTAAVSKIFAVSATYPYQVVRARLQDQ-  211

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV+D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  212  ---HNTYSGVLDVIRRTWRREGIRGFYKGIIANVIRVTPACCITFVVYENVSSFLL  264


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 77/147 (52%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  18   YNGILHCMTTVWKHEGLRGLYQGVTPNVWGAGASWGLYFFFYNAIKAY---KKEGKLESL  74

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ----GLHSEKRYSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q       S+++Y G++D + K++++EG
Sbjct  75   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYDAGADPSKRQYKGMLDALLKIYKKEG  134

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  135  IRGLYKGFVPGLFGTSHGA-LQFMAYE  160



>gb|KFZ46265.1| Mitochondrial folate transporter/carrier, partial [Caprimulgus 
carolinensis]
Length=268

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNKYRNRVSDTKLNTVEYIMMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  261


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   R    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---RKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALIKIYKTEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>gb|KFP24304.1| Mitochondrial folate transporter/carrier, partial [Colius striatus]
Length=268

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 108/176 (61%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYRGMFDALMKIHKREGIRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+       ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNKYRNRGSDTKLNTVEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNVYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  261


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMVGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+ ++EG
Sbjct  72   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYRGMFDALMKIHKREG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  132  IRGLYKGFVPGLFGTSHGA-LQFMAYE  157



>gb|EOB07891.1| Mitochondrial folate transporter/carrier, partial [Anas platyrhynchos]
Length=266

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    YRG   AL +I + EGIRGLY G VP L G SH 
Sbjct  89   TNPIWVTKTRLVLQ-YDAGVDPSKRQYRGMFDALIKIYKTEGIRGLYKGFVPGLFGTSHG  147

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+ +     ++VSKIFA + TYP++VVR+RLQ+Q 
Sbjct  148  ALQFMAYEDLKLRYNKYRNRGSDTKLNTAEYITMAAVSKIFAVSATYPYQVVRARLQDQ-  206

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ +++EGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  207  ---HNTYSGVFDVIRRTWRKEGIHGFYKGIIPNVIRVTPACCITFVVYENVSSFLL  259


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  13   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  69

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRL---QEQGLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL    + G+   KR Y G+ D + K+++ EG
Sbjct  70   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYDAGVDPSKRQYRGMFDALIKIYKTEG  129

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            I G Y+G    L  T+  A + F ++E
Sbjct  130  IRGLYKGFVPGLFGTSHGA-LQFMAYE  155



>gb|KFV20638.1| Mitochondrial folate transporter/carrier, partial [Tauraco erythrolophus]
Length=268

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 109/176 (62%), Gaps = 10/176 (6%)
 Frame = -2

Query  762  TNSLWVVXTRLQTQGMRAGFVP----YRGTLSALRRIAREEGIRGLYSGLVPALAGVSHV  595
            TN +WV  TRL  Q   AG  P    Y+G   AL +I + EG+RGLY G VP L G SH 
Sbjct  91   TNPIWVTKTRLVLQ-YNAGVDPSKRQYKGMFDALIKIYKTEGVRGLYKGFVPGLFGTSHG  149

Query  594  AIQFPTYEKIKI-YLANRDNTSMDKLsasnvavassvSKIFASTMTYPHEVVRSRLQEQG  418
            A+QF  YE +K+ Y   R+  S  KL+     + +++SKIFA + TYP++VVR+RLQ+Q 
Sbjct  150  ALQFMAYEDLKLRYNKYRNRVSDTKLNTLEYIMMAAISKIFAVSATYPYQVVRARLQDQ-  208

Query  417  LHSEKRYSGVIDCVRKVFQQEGIPGFYRGCATNLIRTTPAAVITFTSFEMIHRFLV  250
                  YSGV D +R+ ++QEGI GFY+G   N+IR TPA  ITF  +E +  FL+
Sbjct  209  ---HNTYSGVFDVIRRTWRQEGIHGFYKGIIPNVIRVTPACCITFVVYENVSGFLL  261


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = -2

Query  696  YRGTLSALRRIAREEGIRGLYSGLVPALAGV-SHVAIQFPTYEKIKIYLANRDNTSMDKL  520
            Y G L  +  + + EG+RGLY G+ P + G  +   + F  Y  IK Y   +    ++ L
Sbjct  15   YNGILHCMTTVWKHEGLRGLYQGVTPNMLGAGASWGLYFFFYNAIKAY---KKEGKLESL  71

Query  519  sasnvavassvSKIFASTMTYPHEVVRSRLQEQ---GLHSEKR-YSGVIDCVRKVFQQEG  352
            SA+   V+++ +      +T P  V ++RL  Q   G+   KR Y G+ D + K+++ EG
Sbjct  72   SATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQYNAGVDPSKRQYKGMFDALIKIYKTEG  131

Query  351  IPGFYRGCATNLIRTTPAAVITFTSFE  271
            + G Y+G    L  T+  A + F ++E
Sbjct  132  VRGLYKGFVPGLFGTSHGA-LQFMAYE  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310