BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF021G01

Length=725
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36508.1|  hypothetical protein MIMGU_mgv1a008665mg                251   3e-78   Erythranthe guttata [common monkey flower]
gb|KGN60339.1|  hypothetical protein Csa_3G895850                       239   2e-75   Cucumis sativus [cucumbers]
gb|KHN19749.1|  Putative methyltransferase, chloroplastic               244   2e-75   Glycine soja [wild soybean]
ref|XP_003522802.1|  PREDICTED: uncharacterized methyltransferase...    244   2e-75   Glycine max [soybeans]
ref|XP_002285799.1|  PREDICTED: uncharacterized methyltransferase...    243   5e-75   Vitis vinifera
ref|XP_011074175.1|  PREDICTED: uncharacterized methyltransferase...    243   6e-75   Sesamum indicum [beniseed]
ref|XP_010105909.1|  putative methyltransferase                         239   8e-75   
ref|XP_004136403.1|  PREDICTED: uncharacterized methyltransferase...    241   1e-74   
ref|XP_004161765.1|  PREDICTED: uncharacterized methyltransferase...    239   2e-73   
emb|CDP01043.1|  unnamed protein product                                238   7e-73   Coffea canephora [robusta coffee]
gb|AFK47008.1|  unknown                                                 237   1e-72   Lotus japonicus
gb|KDO80932.1|  hypothetical protein CISIN_1g018003mg                   233   1e-72   Citrus sinensis [apfelsine]
ref|XP_006434004.1|  hypothetical protein CICLE_v10001682mg             233   2e-72   
ref|XP_007018799.1|  S-adenosylmethionine-dependent methyltransfe...    236   3e-72   
gb|KDP41368.1|  hypothetical protein JCGZ_15775                         235   5e-72   Jatropha curcas
ref|XP_003527908.1|  PREDICTED: uncharacterized methyltransferase...    232   6e-72   
ref|XP_002302290.2|  hypothetical protein POPTR_0002s09570g             234   2e-71   Populus trichocarpa [western balsam poplar]
ref|XP_007136240.1|  hypothetical protein PHAVU_009G030200g             235   2e-71   Phaseolus vulgaris [French bean]
ref|XP_004500619.1|  PREDICTED: uncharacterized methyltransferase...    233   2e-71   Cicer arietinum [garbanzo]
ref|XP_011016296.1|  PREDICTED: uncharacterized methyltransferase...    234   2e-71   Populus euphratica
ref|XP_010059991.1|  PREDICTED: uncharacterized methyltransferase...    234   2e-71   Eucalyptus grandis [rose gum]
ref|XP_007222212.1|  hypothetical protein PRUPE_ppa007824mg             233   3e-71   Prunus persica
ref|XP_002513908.1|  S-adenosylmethionine-dependent methyltransfe...    233   4e-71   
ref|XP_006434005.1|  hypothetical protein CICLE_v10001682mg             233   4e-71   
gb|KDO80931.1|  hypothetical protein CISIN_1g018003mg                   233   4e-71   Citrus sinensis [apfelsine]
ref|XP_002306578.1|  methyltransferase-related family protein           229   4e-71   
ref|XP_010269234.1|  PREDICTED: uncharacterized methyltransferase...    233   5e-71   Nelumbo nucifera [Indian lotus]
ref|XP_006472621.1|  PREDICTED: uncharacterized methyltransferase...    232   5e-71   
ref|XP_006472620.1|  PREDICTED: uncharacterized methyltransferase...    233   5e-71   
ref|XP_008466034.1|  PREDICTED: uncharacterized methyltransferase...    232   8e-71   Cucumis melo [Oriental melon]
gb|KHN03912.1|  Putative methyltransferase, chloroplastic               227   1e-70   Glycine soja [wild soybean]
gb|KEH34908.1|  S-adenosylmethionine-dependent methyltransferase        231   2e-70   Medicago truncatula
ref|XP_008219673.1|  PREDICTED: uncharacterized methyltransferase...    231   3e-70   Prunus mume [ume]
ref|XP_004299641.1|  PREDICTED: uncharacterized methyltransferase...    229   6e-70   Fragaria vesca subsp. vesca
gb|KJB59931.1|  hypothetical protein B456_009G281700                    229   1e-69   Gossypium raimondii
gb|KJB59929.1|  hypothetical protein B456_009G281700                    229   2e-69   Gossypium raimondii
gb|KCW67137.1|  hypothetical protein EUGRSUZ_F00926                     226   2e-69   Eucalyptus grandis [rose gum]
ref|XP_010428930.1|  PREDICTED: uncharacterized methyltransferase...    228   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010428929.1|  PREDICTED: uncharacterized methyltransferase...    228   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006386404.1|  hypothetical protein POPTR_0002s09570g             228   5e-69   
ref|XP_010064389.1|  PREDICTED: uncharacterized methyltransferase...    227   7e-69   
ref|XP_010061813.1|  PREDICTED: uncharacterized methyltransferase...    227   8e-69   Eucalyptus grandis [rose gum]
ref|XP_010064206.1|  PREDICTED: uncharacterized methyltransferase...    226   1e-68   Eucalyptus grandis [rose gum]
gb|KHG01878.1|  hypothetical protein F383_23026                         225   3e-68   Gossypium arboreum [tree cotton]
ref|XP_002889176.1|  predicted protein                                  225   5e-68   
ref|XP_010416782.1|  PREDICTED: uncharacterized methyltransferase...    224   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010416783.1|  PREDICTED: uncharacterized methyltransferase...    224   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010472019.1|  PREDICTED: uncharacterized methyltransferase...    223   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010472020.1|  PREDICTED: uncharacterized methyltransferase...    223   5e-67   Camelina sativa [gold-of-pleasure]
emb|CDY14625.1|  BnaC02g24880D                                          221   8e-67   Brassica napus [oilseed rape]
ref|XP_006300528.1|  hypothetical protein CARUB_v10020572mg             221   9e-67   
ref|XP_006390018.1|  hypothetical protein EUTSA_v10018789mg             221   2e-66   Eutrema salsugineum [saltwater cress]
ref|NP_565170.1|  S-adenosyl-L-methionine-dependent methyltransfe...    221   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106463.1|  PREDICTED: uncharacterized methyltransferase...    220   3e-66   
ref|XP_009373157.1|  PREDICTED: uncharacterized methyltransferase...    220   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_009106462.1|  PREDICTED: uncharacterized methyltransferase...    220   3e-66   Brassica rapa
ref|XP_010667997.1|  PREDICTED: uncharacterized methyltransferase...    220   5e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008391145.1|  PREDICTED: uncharacterized methyltransferase...    217   1e-65   
ref|XP_009128280.1|  PREDICTED: uncharacterized methyltransferase...    218   1e-65   Brassica rapa
emb|CDY26853.1|  BnaA02g18780D                                          218   1e-65   Brassica napus [oilseed rape]
ref|XP_008374425.1|  PREDICTED: uncharacterized methyltransferase...    219   2e-65   
emb|CDX88421.1|  BnaC06g38650D                                          218   2e-65   
ref|XP_008374488.1|  PREDICTED: uncharacterized methyltransferase...    218   2e-65   
ref|XP_010534071.1|  PREDICTED: uncharacterized methyltransferase...    218   2e-65   
ref|XP_010534070.1|  PREDICTED: uncharacterized methyltransferase...    218   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_008391080.1|  PREDICTED: uncharacterized methyltransferase...    217   8e-65   
emb|CDX87473.1|  BnaA07g34000D                                          210   3e-62   
ref|XP_010937469.1|  PREDICTED: uncharacterized methyltransferase...    207   2e-61   Elaeis guineensis
ref|XP_009394965.1|  PREDICTED: uncharacterized methyltransferase...    206   7e-61   
ref|XP_009394964.1|  PREDICTED: uncharacterized methyltransferase...    206   8e-61   
ref|XP_008808068.1|  PREDICTED: uncharacterized methyltransferase...    202   2e-59   Phoenix dactylifera
gb|AFK36862.1|  unknown                                                 193   2e-58   Lotus japonicus
ref|XP_010939635.1|  PREDICTED: uncharacterized methyltransferase...    196   2e-57   Elaeis guineensis
ref|XP_008790838.1|  PREDICTED: uncharacterized methyltransferase...    192   9e-56   Phoenix dactylifera
gb|KDO80930.1|  hypothetical protein CISIN_1g018003mg                   192   2e-55   Citrus sinensis [apfelsine]
ref|XP_008790837.1|  PREDICTED: uncharacterized methyltransferase...    191   2e-55   
ref|XP_009386973.1|  PREDICTED: uncharacterized methyltransferase...    187   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928270.1|  PREDICTED: uncharacterized methyltransferase...    184   1e-52   
ref|XP_010928269.1|  PREDICTED: uncharacterized methyltransferase...    184   1e-52   
ref|XP_008788786.1|  PREDICTED: uncharacterized methyltransferase...    184   2e-52   
gb|AFW76188.1|  hypothetical protein ZEAMMB73_680706                    179   3e-52   
ref|XP_010928268.1|  PREDICTED: uncharacterized methyltransferase...    184   4e-52   
ref|XP_010928267.1|  PREDICTED: uncharacterized methyltransferase...    184   4e-52   Elaeis guineensis
gb|KJB14720.1|  hypothetical protein B456_002G140100                    184   5e-52   Gossypium raimondii
gb|EEE66113.1|  hypothetical protein OsJ_22149                          180   5e-52   Oryza sativa Japonica Group [Japonica rice]
gb|AAG52104.1|AC012680_15  hypothetical protein; 38642-36701            182   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003563313.1|  PREDICTED: uncharacterized methyltransferase...    183   8e-52   Brachypodium distachyon [annual false brome]
ref|XP_006659389.1|  PREDICTED: uncharacterized methyltransferase...    182   1e-51   
ref|XP_003574470.1|  PREDICTED: uncharacterized methyltransferase...    181   4e-51   Brachypodium distachyon [annual false brome]
ref|XP_002445476.1|  hypothetical protein SORBIDRAFT_07g020130          181   4e-51   Sorghum bicolor [broomcorn]
ref|NP_001150427.1|  S-adenosylmethionine-dependent methyltransfe...    181   4e-51   Zea mays [maize]
ref|NP_001058196.1|  Os06g0646000                                       179   1e-50   
dbj|BAJ94151.1|  predicted protein                                      179   1e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91607.1|  predicted protein                                      179   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002438745.1|  hypothetical protein SORBIDRAFT_10g025400          179   2e-50   Sorghum bicolor [broomcorn]
ref|XP_006657188.1|  PREDICTED: uncharacterized methyltransferase...    179   2e-50   
ref|NP_001061786.1|  Os08g0411200                                       179   3e-50   
gb|ACG27569.1|  S-adenosylmethionine-dependent methyltransferase        179   3e-50   Zea mays [maize]
ref|XP_004973409.1|  PREDICTED: uncharacterized methyltransferase...    179   3e-50   Setaria italica
gb|ACF85541.1|  unknown                                                 179   3e-50   Zea mays [maize]
ref|XP_004965743.1|  PREDICTED: uncharacterized methyltransferase...    177   3e-50   Setaria italica
ref|NP_001132053.1|  uncharacterized LOC100193465                       179   4e-50   Zea mays [maize]
gb|EMT30153.1|  Putative methyltransferase                              179   9e-50   
gb|EMT07919.1|  Putative methyltransferase                              177   1e-49   
ref|XP_004488470.1|  PREDICTED: uncharacterized methyltransferase...    177   1e-49   Cicer arietinum [garbanzo]
ref|XP_004965742.1|  PREDICTED: uncharacterized methyltransferase...    177   1e-49   Setaria italica
gb|EEE68668.1|  hypothetical protein OsJ_27281                          176   6e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004974685.1|  PREDICTED: uncharacterized methyltransferase...    174   1e-48   
ref|XP_003546595.1|  PREDICTED: uncharacterized methyltransferase...    173   3e-48   Glycine max [soybeans]
ref|XP_011470644.1|  PREDICTED: uncharacterized methyltransferase...    172   1e-47   Fragaria vesca subsp. vesca
gb|EMT00494.1|  Putative methyltransferase                              175   1e-47   
ref|XP_011017926.1|  PREDICTED: uncharacterized methyltransferase...    171   1e-47   Populus euphratica
gb|KDP30197.1|  hypothetical protein JCGZ_16979                         171   2e-47   Jatropha curcas
ref|XP_010099510.1|  putative methyltransferase                         171   2e-47   Morus notabilis
ref|XP_008348560.1|  PREDICTED: uncharacterized methyltransferase...    173   2e-47   
ref|XP_011470680.1|  PREDICTED: uncharacterized methyltransferase...    170   3e-47   Fragaria vesca subsp. vesca
ref|XP_004287240.1|  PREDICTED: uncharacterized methyltransferase...    170   4e-47   Fragaria vesca subsp. vesca
ref|XP_002531454.1|  phosphatidylethanolamine n-methyltransferase...    169   6e-47   
ref|XP_006381066.1|  methyltransferase-related family protein           169   6e-47   
emb|CDP10502.1|  unnamed protein product                                169   9e-47   Coffea canephora [robusta coffee]
ref|XP_008374562.1|  PREDICTED: uncharacterized methyltransferase...    169   1e-46   
gb|KEH37884.1|  S-adenosylmethionine-dependent methyltransferase        167   1e-46   Medicago truncatula
ref|XP_011020252.1|  PREDICTED: uncharacterized methyltransferase...    169   1e-46   Populus euphratica
ref|XP_011078555.1|  PREDICTED: uncharacterized methyltransferase...    168   3e-46   Sesamum indicum [beniseed]
ref|XP_006586686.1|  PREDICTED: uncharacterized protein LOC100798...    168   3e-46   Glycine max [soybeans]
gb|KHN28439.1|  Putative methyltransferase, chloroplastic               168   4e-46   Glycine soja [wild soybean]
ref|XP_002324579.2|  methyltransferase-related family protein           167   4e-46   
gb|EYU34934.1|  hypothetical protein MIMGU_mgv1a009522mg                167   6e-46   Erythranthe guttata [common monkey flower]
ref|NP_001242875.1|  uncharacterized protein LOC100798970               167   7e-46   
gb|ACJ84583.1|  unknown                                                 167   1e-45   Medicago truncatula
ref|XP_008456635.1|  PREDICTED: uncharacterized methyltransferase...    166   1e-45   Cucumis melo [Oriental melon]
gb|EMT14235.1|  Putative methyltransferase                              169   1e-45   
ref|XP_008242913.1|  PREDICTED: uncharacterized methyltransferase...    164   2e-45   
gb|AFK46366.1|  unknown                                                 166   3e-45   Medicago truncatula
ref|XP_010050326.1|  PREDICTED: uncharacterized methyltransferase...    165   4e-45   Eucalyptus grandis [rose gum]
gb|KDO80933.1|  hypothetical protein CISIN_1g018003mg                   166   5e-45   Citrus sinensis [apfelsine]
gb|KJB53960.1|  hypothetical protein B456_009G013400                    164   5e-45   Gossypium raimondii
ref|XP_002268107.1|  PREDICTED: uncharacterized methyltransferase...    165   6e-45   Vitis vinifera
ref|XP_004139262.1|  PREDICTED: uncharacterized methyltransferase...    164   6e-45   Cucumis sativus [cucumbers]
ref|XP_002988667.1|  hypothetical protein SELMODRAFT_46133              162   8e-45   
ref|XP_004167998.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    164   9e-45   
gb|KJB53958.1|  hypothetical protein B456_009G013400                    164   2e-44   Gossypium raimondii
ref|XP_008456627.1|  PREDICTED: uncharacterized methyltransferase...    163   2e-44   Cucumis melo [Oriental melon]
emb|CBI25578.3|  unnamed protein product                                163   2e-44   Vitis vinifera
ref|XP_002268200.1|  PREDICTED: uncharacterized methyltransferase...    163   3e-44   Vitis vinifera
gb|KDO59313.1|  hypothetical protein CISIN_1g019950mg                   162   3e-44   Citrus sinensis [apfelsine]
ref|XP_006453728.1|  hypothetical protein CICLE_v10008875mg             162   3e-44   Citrus clementina [clementine]
ref|XP_002986403.1|  hypothetical protein SELMODRAFT_235009             163   3e-44   Selaginella moellendorffii
gb|KDO59312.1|  hypothetical protein CISIN_1g019950mg                   162   3e-44   Citrus sinensis [apfelsine]
ref|XP_007202300.1|  hypothetical protein PRUPE_ppa007882mg             163   3e-44   Prunus persica
ref|XP_009602551.1|  PREDICTED: uncharacterized methyltransferase...    158   4e-44   
gb|KHG21340.1|  hypothetical protein F383_03824                         164   5e-44   Gossypium arboreum [tree cotton]
ref|XP_007013645.1|  S-adenosyl-L-methionine-dependent methyltran...    162   5e-44   
ref|XP_008336947.1|  PREDICTED: uncharacterized methyltransferase...    162   6e-44   
ref|XP_006473930.1|  PREDICTED: uncharacterized methyltransferase...    162   7e-44   
gb|KGN60753.1|  hypothetical protein Csa_2G009410                       161   1e-43   Cucumis sativus [cucumbers]
ref|XP_009802104.1|  PREDICTED: uncharacterized methyltransferase...    160   3e-43   Nicotiana sylvestris
ref|XP_010047200.1|  PREDICTED: uncharacterized methyltransferase...    160   3e-43   Eucalyptus grandis [rose gum]
ref|XP_010533098.1|  PREDICTED: uncharacterized methyltransferase...    160   4e-43   Tarenaya hassleriana [spider flower]
ref|XP_010687777.1|  PREDICTED: uncharacterized methyltransferase...    159   5e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008344066.1|  PREDICTED: uncharacterized methyltransferase...    158   1e-42   
ref|XP_008336950.1|  PREDICTED: uncharacterized methyltransferase...    158   1e-42   
ref|XP_010656529.1|  PREDICTED: uncharacterized methyltransferase...    158   1e-42   Vitis vinifera
ref|XP_009338403.1|  PREDICTED: uncharacterized methyltransferase...    158   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_006852799.1|  hypothetical protein AMTR_s00033p00159870          158   2e-42   
ref|XP_009358530.1|  PREDICTED: uncharacterized methyltransferase...    158   2e-42   
gb|KJB27062.1|  hypothetical protein B456_004G275300                    158   2e-42   Gossypium raimondii
ref|XP_006411367.1|  hypothetical protein EUTSA_v10016844mg             157   7e-42   Eutrema salsugineum [saltwater cress]
gb|KHG26587.1|  hypothetical protein F383_01046                         156   7e-42   Gossypium arboreum [tree cotton]
ref|XP_009141962.1|  PREDICTED: uncharacterized methyltransferase...    157   8e-42   Brassica rapa
ref|XP_009338401.1|  PREDICTED: uncharacterized methyltransferase...    157   8e-42   Pyrus x bretschneideri [bai li]
ref|XP_006359517.1|  PREDICTED: uncharacterized methyltransferase...    156   8e-42   Solanum tuberosum [potatoes]
emb|CDY57579.1|  BnaC04g56820D                                          155   4e-41   Brassica napus [oilseed rape]
ref|XP_010517586.1|  PREDICTED: uncharacterized methyltransferase...    155   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010508773.1|  PREDICTED: uncharacterized methyltransferase...    155   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002879904.1|  hypothetical protein ARALYDRAFT_903411             154   5e-41   
ref|NP_181637.2|  uncharacterized methyltransferase                     154   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004242719.1|  PREDICTED: uncharacterized methyltransferase...    153   1e-40   Solanum lycopersicum
ref|XP_004242718.1|  PREDICTED: uncharacterized methyltransferase...    153   2e-40   Solanum lycopersicum
ref|XP_009394966.1|  PREDICTED: uncharacterized methyltransferase...    152   2e-40   
ref|XP_001778776.1|  predicted protein                                  152   2e-40   
ref|XP_010505866.1|  PREDICTED: uncharacterized methyltransferase...    153   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006293382.1|  hypothetical protein CARUB_v10023510mg             153   2e-40   Capsella rubella
emb|CDY06948.1|  BnaA04g23670D                                          157   3e-40   
ref|XP_008336951.1|  PREDICTED: uncharacterized methyltransferase...    152   3e-40   
ref|XP_009363912.1|  PREDICTED: uncharacterized methyltransferase...    152   4e-40   Pyrus x bretschneideri [bai li]
gb|ABR16838.1|  unknown                                                 150   9e-40   Picea sitchensis
ref|XP_004287239.1|  PREDICTED: uncharacterized methyltransferase...    149   1e-39   Fragaria vesca subsp. vesca
gb|KFK36957.1|  hypothetical protein AALP_AA4G194500                    150   2e-39   Arabis alpina [alpine rockcress]
gb|EEC83568.1|  hypothetical protein OsI_29220                          150   3e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_006359516.1|  PREDICTED: uncharacterized methyltransferase...    148   1e-38   Solanum tuberosum [potatoes]
ref|XP_009337420.1|  PREDICTED: uncharacterized methyltransferase...    132   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_009337419.1|  PREDICTED: uncharacterized methyltransferase...    132   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_002968407.1|  hypothetical protein SELMODRAFT_89857              135   4e-34   
ref|XP_002954755.1|  hypothetical protein VOLCADRAFT_106536             135   1e-33   Volvox carteri f. nagariensis
ref|XP_007510827.1|  predicted protein                                  134   6e-33   Bathycoccus prasinos
gb|KDO59316.1|  hypothetical protein CISIN_1g019950mg                   132   8e-33   Citrus sinensis [apfelsine]
gb|KDO59315.1|  hypothetical protein CISIN_1g019950mg                   132   8e-33   Citrus sinensis [apfelsine]
ref|XP_001418638.1|  predicted protein                                  126   1e-31   Ostreococcus lucimarinus CCE9901
gb|KCW79027.1|  hypothetical protein EUGRSUZ_C00449                     128   1e-31   Eucalyptus grandis [rose gum]
gb|KCW79026.1|  hypothetical protein EUGRSUZ_C00449                     128   1e-31   Eucalyptus grandis [rose gum]
emb|CAN77779.1|  hypothetical protein VITISV_004172                     132   2e-31   Vitis vinifera
gb|KJB27061.1|  hypothetical protein B456_004G275300                    127   4e-31   Gossypium raimondii
ref|XP_001694737.1|  predicted protein                                  125   1e-30   Chlamydomonas reinhardtii
ref|XP_003080221.1|  methyltransferase-related (ISS)                    127   1e-30   Ostreococcus tauri
dbj|BAC99645.1|  hypothetical protein                                   123   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003056709.1|  predicted protein                                  121   2e-28   Micromonas pusilla CCMP1545
gb|KJB59930.1|  hypothetical protein B456_009G281700                    118   5e-28   Gossypium raimondii
ref|XP_002506188.1|  predicted protein                                  119   9e-28   Micromonas commoda
gb|KIY98469.1|  putative methyltransferase                              116   2e-27   Monoraphidium neglectum
ref|XP_002500021.1|  predicted protein                                  117   6e-27   Micromonas commoda
ref|XP_006434006.1|  hypothetical protein CICLE_v10001682mg             115   8e-27   
ref|XP_005643537.1|  S-adenosyl-L-methionine-dependent methyltran...    115   2e-26   Coccomyxa subellipsoidea C-169
ref|XP_007227385.1|  hypothetical protein PRUPE_ppb016862mg             111   6e-26   
ref|XP_002967385.1|  hypothetical protein SELMODRAFT_408369             112   2e-24   
ref|XP_010040339.1|  PREDICTED: uncharacterized methyltransferase...    104   5e-23   Eucalyptus grandis [rose gum]
ref|XP_008356589.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    104   6e-23   
gb|KDO59317.1|  hypothetical protein CISIN_1g019950mg                   101   1e-21   Citrus sinensis [apfelsine]
gb|AEJ88263.1|  putative S-adenosylmethionine-dependent methyltra...    100   2e-21   Wolffia arrhiza
gb|EMS47735.1|  hypothetical protein TRIUR3_02804                     99.4    3e-21   Triticum urartu
gb|KJB53959.1|  hypothetical protein B456_009G013400                  99.4    3e-21   Gossypium raimondii
gb|AAD12007.1|  hypothetical protein                                  99.0    5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389527.1|  PREDICTED: uncharacterized methyltransferase...  98.6    1e-20   
ref|XP_007514982.1|  predicted protein                                97.4    4e-20   Bathycoccus prasinos
ref|XP_003057905.1|  predicted protein                                92.8    5e-19   Micromonas pusilla CCMP1545
ref|XP_002960327.1|  hypothetical protein SELMODRAFT_402502           95.9    5e-19   
ref|XP_005824779.1|  hypothetical protein GUITHDRAFT_116106           92.0    2e-18   Guillardia theta CCMP2712
ref|XP_006826926.1|  hypothetical protein AMTR_s00010p00172800        90.1    3e-18   
ref|XP_005536724.1|  hypothetical protein, conserved                  92.4    4e-18   Cyanidioschyzon merolae strain 10D
ref|XP_005713645.1|  unnamed protein product                          89.7    1e-17   Chondrus crispus [carageen]
ref|XP_002502147.1|  predicted protein                                87.4    1e-16   Micromonas commoda
gb|EJK66010.1|  hypothetical protein THAOC_13088                      87.0    3e-16   Thalassiosira oceanica
ref|XP_005855405.1|  hypothetical protein NGA_2005920                 85.5    6e-16   Nannochloropsis gaditana CCMP526
gb|EWM24600.1|  phosphatidylethanolamine n                            85.5    6e-16   Nannochloropsis gaditana
ref|XP_002503324.1|  chloroplast envelope protein translocase family  85.1    3e-15   Micromonas commoda
ref|WP_033335056.1|  hypothetical protein                             76.3    2e-14   
ref|XP_002185698.1|  predicted protein                                81.3    3e-14   Phaeodactylum tricornutum CCAP 1055/1
gb|KIE07218.1|  hypothetical protein DA73_0239355                     79.0    3e-14   Tolypothrix bouteillei VB521301
emb|CBJ26935.1|  S-adenosyl-L-methionine-dependent methyltransfer...  78.6    3e-13   Ectocarpus siliculosus
ref|XP_002992310.1|  hypothetical protein SELMODRAFT_430530           75.5    4e-13   
ref|XP_005705444.1|  phosphatidylethanolamine n-methyltransferase...  75.1    2e-12   Galdieria sulphuraria
ref|WP_009647626.1|  SAM-dependent methyltransferase                  73.2    2e-12   Actinomyces sp. ICM47
ref|WP_005984449.1|  SAM-dependent methyltransferase                  72.8    2e-12   Actinomyces graevenitzii
ref|XP_005781281.1|  hypothetical protein EMIHUDRAFT_442892           75.1    3e-12   Emiliania huxleyi CCMP1516
ref|WP_003790083.1|  SAM-dependent methyltransferase                  72.0    5e-12   Actinomyces odontolyticus
ref|WP_003794338.1|  SAM-dependent methyltransferase                  72.0    5e-12   Actinomyces odontolyticus
ref|WP_034501983.1|  SAM-dependent methyltransferase                  72.0    6e-12   Actinomyces sp. S6-Spd3
ref|WP_034465932.1|  SAM-dependent methyltransferase                  71.6    6e-12   Actinomyces sp. ICM54
ref|WP_037584032.1|  hypothetical protein                             71.2    2e-11   
ref|WP_007588477.1|  SAM-dependent methyltransferase                  70.5    2e-11   Actinomyces sp. ICM39
gb|ADO73882.1|  Methyltransferase type 11                             71.2    2e-11   Stigmatella aurantiaca DW4/3-1
ref|WP_027728386.1|  SAM-dependent methyltransferase                  70.1    2e-11   Treponema sp. C6A8
ref|WP_022122196.1|  hypothetical protein                             70.5    2e-11   
ref|WP_021603648.1|  methyltransferase domain protein                 68.9    5e-11   Actinomyces graevenitzii
ref|XP_007514207.1|  predicted protein                                67.0    3e-10   Bathycoccus prasinos
ref|WP_021611333.1|  methyltransferase domain protein                 66.6    4e-10   Actinomyces sp. oral taxon 172
emb|CEF97980.1|  Methyltransferase type 11                            67.4    4e-10   Ostreococcus tauri
ref|WP_044509270.1|  SAM-dependent methyltransferase                  66.6    6e-10   Mycobacterium simiae
ref|WP_006242682.1|  SAM-dependent methyltransferase                  66.6    7e-10   Mycolicibacterium tusciae
ref|WP_011557522.1|  MULTISPECIES: SAM-dependent methyltransferase    66.2    8e-10   Mycobacteriaceae
ref|WP_007577247.1|  putative methyltransferase                       66.2    1e-09   
ref|WP_034251379.1|  SAM-dependent methyltransferase                  65.1    1e-09   Actinomyces sp. oral taxon 181
ref|XP_003079346.1|  non-transporter ABC protein (ISS)                67.8    2e-09   
gb|EKY16220.1|  methyltransferase domain protein                      64.7    2e-09   Actinomyces sp. oral taxon 181 str. F0379
ref|WP_009058751.1|  SAM-dependent methyltransferase                  64.3    3e-09   Actinomyces sp. ICM58
gb|AJR18080.1|  methyltransferase                                     64.7    3e-09   Pimelobacter simplex
ref|WP_031116772.1|  MULTISPECIES: hypothetical protein               65.1    3e-09   
ref|WP_011024227.1|  fibrillarin-like rRNA methylase                  63.2    5e-09   
ref|WP_018358192.1|  hypothetical protein                             63.5    6e-09   Porphyromonas levii
ref|WP_021591497.1|  hypothetical protein                             63.2    6e-09   Actinomadura madurae
ref|WP_028509762.1|  SAM-dependent methyltransferase                  62.8    1e-08   Ruminococcus sp. NK3A76
ref|WP_019127220.1|  hypothetical protein                             62.8    1e-08   Actinomyces sp. ph3
ref|WP_008332456.1|  methyltransferase, UbiE/COQ5 family protein      62.8    1e-08   Maritimibacter alkaliphilus
ref|WP_028655549.1|  hypothetical protein                             62.8    1e-08   
ref|WP_038683354.1|  hypothetical protein                             60.8    2e-08   
ref|WP_028263827.1|  SAM-dependent methyltransferase                  62.0    2e-08   Atopobium fossor
ref|WP_036550599.1|  hypothetical protein                             62.0    2e-08   
ref|WP_016460104.1|  hypothetical protein                             62.0    2e-08   Actinobacteria
ref|WP_036227573.1|  hypothetical protein                             61.6    2e-08   
ref|WP_029231175.1|  hypothetical protein                             62.8    2e-08   
ref|WP_039694375.1|  methyltransferase                                62.0    2e-08   
ref|XP_010250394.1|  PREDICTED: uncharacterized protein LOC104592660  63.9    2e-08   
ref|WP_014620256.1|  methyltransferase                                62.0    2e-08   
ref|WP_006530961.1|  MULTISPECIES: methyltransferase                  62.0    3e-08   
ref|WP_029113106.1|  ubiquinone biosynthesis protein                  61.6    3e-08   
ref|WP_013643503.1|  methyltransferase                                61.6    3e-08   
ref|WP_007167123.1|  SAM-dependent methyltransferase                  62.4    3e-08   
ref|WP_009254158.1|  MULTISPECIES: methyltransferase                  61.2    3e-08   
ref|WP_043403276.1|  hypothetical protein                             61.6    5e-08   
ref|WP_037324629.1|  methyltransferase                                60.8    5e-08   
gb|KCW45297.1|  hypothetical protein EUGRSUZ_L01041                   61.2    5e-08   
ref|WP_041437843.1|  dimethylmenaquinone methyltransferase            60.8    6e-08   
ref|XP_003056909.1|  predicted protein                                62.4    6e-08   
ref|WP_026523167.1|  SAM-dependent methyltransferase                  60.5    6e-08   
gb|KFA90141.1|  hypothetical protein Q664_29640                       61.2    7e-08   
ref|WP_009273390.1|  menaquinone biosynthesis methyltransferase UbiE  60.1    8e-08   
gb|ACL04197.1|  Methyltransferase type 11                             61.2    9e-08   
ref|WP_028235830.1|  SAM-dependent methyltransferase                  60.1    9e-08   
ref|WP_035040441.1|  SAM-dependent methyltransferase                  60.1    9e-08   
ref|WP_004083064.1|  type 11 methyltransferase                        60.1    1e-07   
ref|WP_036368657.1|  SAM-dependent methyltransferase                  60.5    1e-07   
ref|WP_032076775.1|  ubiquinone/menaquinone biosynthesis protein      60.1    1e-07   
ref|WP_042432128.1|  methyltransferase                                59.3    1e-07   
ref|WP_036465838.1|  SAM-dependent methyltransferase                  60.5    1e-07   
ref|WP_011777434.1|  SAM-dependent methyltransferase                  60.5    1e-07   
gb|AGB21077.1|  methylase involved in ubiquinone/menaquinone bios...  60.1    1e-07   
ref|WP_012828704.1|  type 11 methyltransferase                        60.8    1e-07   
gb|ESL03201.1|  methyltransferase domain protein                      60.1    1e-07   
ref|WP_007049331.1|  hypothetical protein                             59.7    1e-07   
ref|WP_008521718.1|  MULTISPECIES: methyltransferase                  60.1    1e-07   
ref|WP_034433269.1|  methyltransferase                                59.7    1e-07   
ref|WP_041311233.1|  SAM-dependent methyltransferase                  59.7    2e-07   
gb|ACM06774.1|  menaquinone biosynthesis methyltransferase UbiE       60.5    2e-07   
ref|WP_024448835.1|  SAM-dependent methyltransferase                  60.1    2e-07   
ref|WP_026511611.1|  SAM-dependent methyltransferase                  59.3    2e-07   
ref|WP_028504361.1|  methyltransferase                                59.7    2e-07   
ref|WP_036430237.1|  SAM-dependent methyltransferase                  59.7    2e-07   
ref|WP_027435503.1|  SAM-dependent methyltransferase                  58.9    2e-07   
ref|WP_036881765.1|  ubiquinone biosynthesis methyltransferase UbiE   59.3    2e-07   
ref|WP_006905290.1|  type 11 methyltransferase                        58.9    2e-07   
ref|WP_040742155.1|  hypothetical protein                             59.7    2e-07   
ref|WP_035151246.1|  methyltransferase                                59.3    2e-07   
ref|WP_024468379.1|  methyltransferase                                58.2    2e-07   
ref|WP_022848725.1|  type 11 methyltransferase                        59.3    3e-07   
ref|WP_003505027.1|  methyltransferase [                              58.9    3e-07   
gb|ETB46623.1|  SAM-dependent methyltransferase                       59.7    3e-07   
gb|ETB14793.1|  SAM-dependent methyltransferase                       59.7    3e-07   
ref|WP_011726543.1|  SAM-dependent methyltransferase                  59.3    3e-07   
gb|ETA95861.1|  SAM-dependent methyltransferase                       59.7    3e-07   
gb|ETB32802.1|  SAM-dependent methyltransferase                       59.7    3e-07   
ref|WP_033712326.1|  MULTISPECIES: SAM-dependent methyltransferase    59.3    3e-07   
ref|WP_033721305.1|  SAM-dependent methyltransferase                  59.3    3e-07   
ref|WP_031353789.1|  SAM-dependent methyltransferase                  59.3    3e-07   
ref|WP_003874284.1|  SAM-dependent methyltransferase                  59.3    3e-07   
ref|WP_031348458.1|  SAM-dependent methyltransferase                  59.3    3e-07   
ref|WP_009979883.1|  SAM-dependent methyltransferase                  59.3    3e-07   
gb|ETB02671.1|  SAM-dependent methyltransferase                       59.3    3e-07   
gb|ETB01440.1|  SAM-dependent methyltransferase                       59.3    3e-07   
ref|WP_018992020.1|  hypothetical protein                             59.3    4e-07   
ref|WP_020221539.1|  hypothetical protein                             57.4    4e-07   
ref|WP_025491690.1|  methyltransferase                                58.5    4e-07   
ref|WP_007978534.1|  type 11 methyltransferase                        58.2    4e-07   
ref|WP_028505466.1|  SAM-dependent methyltransferase                  58.2    5e-07   
ref|WP_012896263.1|  type 11 methyltransferase                        58.2    5e-07   
ref|WP_035770868.1|  hypothetical protein                             58.2    5e-07   
ref|WP_000774686.1|  ubiquinone/menaquinone biosynthesis methyltr...  58.5    5e-07   
ref|WP_020074409.1|  methyltransferase [                              58.2    5e-07   
ref|WP_040710863.1|  SAM-dependent methyltransferase                  58.2    6e-07   
gb|EGB91889.1|  methyltransferase, UbiE/COQ5 family                   57.8    6e-07   
gb|ADU21708.1|  Methyltransferase type 11                             59.3    6e-07   
ref|WP_040589166.1|  hypothetical protein                             57.0    6e-07   
ref|WP_023059264.1|  methionine biosynthesis protein MetW-like pr...  57.8    6e-07   
ref|WP_014739643.1|  ubiquinone biosynthesis methyltransferase UbiE   57.8    6e-07   
ref|WP_026526112.1|  SAM-dependent methyltransferase                  57.4    7e-07   
ref|WP_026518812.1|  SAM-dependent methyltransferase                  57.8    7e-07   
ref|WP_008901426.1|  methyltransferase                                57.8    7e-07   
ref|WP_029320050.1|  SAM-dependent methyltransferase                  57.8    7e-07   
ref|WP_022779708.1|  SAM-dependent methyltransferase                  57.4    7e-07   
ref|WP_009251535.1|  methyltransferase                                57.8    7e-07   
ref|WP_006894188.1|  putative methyltransferase                       57.8    7e-07   
ref|WP_021779624.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...  57.8    8e-07   
ref|WP_037345954.1|  hypothetical protein                             56.6    8e-07   
ref|WP_037972343.1|  2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4...  58.2    8e-07   
ref|WP_022853373.1|  hypothetical protein                             57.4    9e-07   
ref|WP_022785408.1|  SAM-dependent methyltransferase                  57.4    9e-07   
ref|WP_007722294.1|  methylase                                        58.2    9e-07   
ref|WP_006617666.1|  methyltransferase type 11                        57.4    9e-07   
gb|AHG00272.1|  SAM-dependent methlyltransferase                      57.4    9e-07   
ref|WP_040692770.1|  hypothetical protein                             57.4    1e-06   
ref|WP_006906917.1|  methyltransferase                                56.6    1e-06   
ref|WP_026669429.1|  SAM-dependent methyltransferase                  57.0    1e-06   
ref|WP_034483566.1|  methyltransferase                                57.8    1e-06   
ref|WP_037328854.1|  methyltransferase                                57.4    1e-06   
ref|WP_034547175.1|  methyltransferase                                57.4    1e-06   
ref|WP_000311361.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.6    1e-06   
ref|WP_031586768.1|  SAM-dependent methyltransferase                  57.0    1e-06   
ref|XP_001026317.1|  methyltransferase, UbiE/COQ5 family protein      58.2    1e-06   
ref|WP_022766187.1|  methyltransferase                                57.4    1e-06   
ref|WP_016211044.1|  methyltransferase domain protein                 58.2    1e-06   
ref|WP_022753571.1|  MULTISPECIES: methyltransferase                  57.4    1e-06   
ref|WP_035316534.1|  methyltransferase                                57.0    1e-06   
ref|WP_005039618.1|  ubiquinone/menaquinone biosynthesis methyltr...  57.0    1e-06   
ref|WP_007788433.1|  type 11 methyltransferase                        57.0    1e-06   
ref|WP_016741716.1|  methylase                                        57.8    1e-06   
ref|WP_021349912.1|  ubiquinone/menaquinone biosynthesis methyltr...  57.4    1e-06   
ref|WP_040668137.1|  dimethylmenaquinone methyltransferase            56.6    1e-06   
ref|WP_041086098.1|  hypothetical protein                             57.8    1e-06   
ref|WP_020681005.1|  hypothetical protein                             57.0    1e-06   
ref|WP_023465902.1|  ubiquinone/menaquinone biosynthesis methyltr...  57.4    1e-06   
ref|WP_024500970.1|  ubiquinone biosynthesis methyltransferase UbiE   57.4    1e-06   
ref|WP_009382429.1|  ubiquinone/menaquinone biosynthesis methyltr...  57.4    1e-06   
ref|WP_039645698.1|  ubiquinone biosynthesis methyltransferase UbiE   57.4    1e-06   
ref|WP_028506503.1|  hypothetical protein                             56.6    1e-06   
gb|KGP68999.1|  ubiquinone biosynthesis methyltransferase UbiE        57.4    1e-06   
ref|WP_021816190.1|  ubiquinone/menaquinone biosynthesis methyltr...  57.4    1e-06   
ref|WP_003683485.1|  ubiquinone/menaquinone biosynthesis methyltr...  57.4    1e-06   
gb|KIL52011.1|  hypothetical protein KP78_03810                       57.8    1e-06   
gb|EJF41683.1|  methyltransferase domain protein                      57.0    1e-06   
ref|WP_034235127.1|  SAM-dependent methyltransferase                  56.6    1e-06   
ref|WP_040580452.1|  ubiquinone biosynthesis methyltransferase UbiE   57.0    1e-06   
ref|WP_041812816.1|  ubiquinone biosynthesis methyltransferase UbiE   57.4    1e-06   
ref|WP_007769532.1|  SAM-dependent methyltransferase                  57.4    1e-06   
ref|WP_007321706.1|  type 11 methyltransferase                        57.0    2e-06   
ref|WP_028519025.1|  SAM-dependent methyltransferase                  56.6    2e-06   
ref|WP_025085117.1|  ubiquinone biosynthesis protein UbiE             57.4    2e-06   
ref|WP_034929816.1|  methyltransferase                                57.0    2e-06   
ref|WP_043644505.1|  hypothetical protein                             56.2    2e-06   
ref|XP_010534072.1|  PREDICTED: uncharacterized methyltransferase...  47.4    2e-06   
ref|WP_003525492.1|  methyltransferase [                              56.6    2e-06   
ref|WP_021802285.1|  hypothetical protein                             57.0    2e-06   
ref|WP_029410613.1|  methyltransferase                                56.6    2e-06   
gb|EZH90389.1|  ribosomal RNA large subunit methyltransferase J-l...  56.6    2e-06   
ref|WP_008010752.1|  Methyltransferase type 11                        56.6    2e-06   
ref|WP_031762179.1|  ubiquinone biosynthesis methyltransferase UbiE   57.0    2e-06   
ref|WP_035152134.1|  methyltransferase                                57.4    2e-06   
ref|WP_011443635.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    2e-06   
ref|WP_006180302.1|  MULTISPECIES: SAM-dependent methlyltransferase   56.6    2e-06   
gb|AGB25690.1|  methylase involved in ubiquinone/menaquinone bios...  57.0    2e-06   
ref|WP_013328392.1|  type 11 methyltransferase                        56.6    2e-06   
ref|WP_031775513.1|  ubiquinone biosynthesis methyltransferase UbiE   57.0    2e-06   
ref|WP_041315040.1|  SAM-dependent methyltransferase                  57.0    2e-06   
ref|WP_023554536.1|  methylase                                        57.4    2e-06   
ref|WP_026297017.1|  methylase                                        57.4    2e-06   
ref|WP_011305165.1|  demethylmenaquinone methyltransferase            55.8    2e-06   
ref|WP_022769875.1|  MULTISPECIES: SAM-dependent methyltransferase    56.2    2e-06   
ref|WP_044543828.1|  SAM-dependent methyltransferase                  56.6    2e-06   
ref|WP_003921361.1|  SAM-dependent methyltransferase                  57.0    2e-06   
ref|WP_015321662.1|  methylase involved in ubiquinone/menaquinone...  56.2    2e-06   
ref|WP_035544367.1|  hypothetical protein                             57.0    2e-06   
ref|WP_038322194.1|  methyltransferase                                56.6    2e-06   
ref|WP_026858073.1|  ubiquinone biosynthesis methyltransferase UbiE   56.6    2e-06   
ref|WP_017377351.1|  hypothetical protein                             57.4    2e-06   
ref|WP_015203444.1|  type 11 methyltransferase                        56.2    2e-06   
ref|WP_033397012.1|  hypothetical protein                             54.7    2e-06   
ref|WP_000774687.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.6    2e-06   
ref|WP_002497897.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.6    2e-06   
ref|WP_006183841.1|  Methyltransferase type 11                        56.2    2e-06   
ref|WP_017247314.1|  methylase                                        57.0    2e-06   
ref|WP_015392101.1|  methylase involved in ubiquinone/menaquinone...  56.2    2e-06   
ref|WP_029321310.1|  methyltransferase                                56.6    2e-06   
ref|WP_031126010.1|  hypothetical protein                             55.8    2e-06   
ref|WP_013056673.1|  methyltransferase                                56.6    2e-06   
ref|WP_031787066.1|  ubiquinone biosynthesis methyltransferase UbiE   56.6    2e-06   
ref|WP_003464373.1|  transcriptional regulator                        57.0    3e-06   
ref|WP_013823230.1|  ubiquinone biosynthesis protein UbiE             56.2    3e-06   
ref|WP_006430418.1|  Methyltransferase type 11                        56.2    3e-06   
ref|WP_043013118.1|  hypothetical protein                             57.0    3e-06   
ref|WP_007070555.1|  SAM-dependent methyltransferase                  56.2    3e-06   
ref|WP_030394695.1|  MULTISPECIES: 2-polyprenyl-3-methyl-5-hydrox...  56.6    3e-06   
ref|WP_032753181.1|  methyltransferase                                56.6    3e-06   
ref|WP_022768910.1|  SAM-dependent methyltransferase                  55.8    3e-06   
ref|WP_044157560.1|  methylase                                        56.6    3e-06   
ref|WP_035808794.1|  ubiquinone biosynthesis methyltransferase UbiE   56.6    3e-06   
ref|WP_027357282.1|  ubiquinone biosynthesis protein UbiE             55.8    3e-06   
gb|EEN83064.1|  methyltransferase domain protein                      57.0    3e-06   
ref|WP_031789514.1|  ubiquinone biosynthesis methyltransferase UbiE   56.6    3e-06   
ref|WP_003926596.1|  ubiquinone biosynthesis protein                  56.2    3e-06   
ref|WP_030245520.1|  MULTISPECIES: hypothetical protein               55.5    3e-06   
ref|WP_012684915.1|  methylase                                        56.6    3e-06   
ref|WP_013330439.1|  type 11 methyltransferase                        56.2    3e-06   
ref|WP_018911115.1|  methyltransferase UbiE                           56.2    3e-06   
ref|WP_035801559.1|  hypothetical protein                             56.6    3e-06   
ref|WP_034482563.1|  hypothetical protein                             56.6    3e-06   
ref|WP_015608375.1|  Methyltransferase type 11                        56.6    3e-06   
ref|WP_024984910.1|  methylase                                        56.6    3e-06   
ref|WP_018562919.1|  hypothetical protein                             56.6    3e-06   
ref|WP_012983862.1|  type 11 methyltransferase                        55.8    4e-06   
ref|WP_000774674.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
emb|CDR65994.1|  Ubiquinone/menaquinone biosynthesis methyltransf...  56.2    4e-06   
ref|WP_000774679.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
ref|WP_020964655.1|  type 11 methyltransferase                        55.5    4e-06   
emb|CEH25646.1|  2-heptaprenyl-1,4-naphthoquinone methyltransferase   56.2    4e-06   
ref|WP_000774678.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
ref|WP_037550475.1|  ubiquinone biosynthesis methyltransferase UbiE   56.2    4e-06   
ref|WP_031906991.1|  ubiquinone biosynthesis methyltransferase UbiE   56.2    4e-06   
ref|WP_000774677.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
ref|WP_000774688.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
ref|WP_025788067.1|  ubiquinone biosynthesis methyltransferase UbiE   56.2    4e-06   
gb|EUA43477.1|  ubiE/COQ5 methyltransferase family protein            53.9    4e-06   
ref|WP_000774689.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
emb|CDR24976.1|  Ubiquinone/menaquinone biosynthesis methyltransf...  56.2    4e-06   
ref|WP_000774681.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
ref|WP_000774683.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
ref|WP_000774684.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
ref|WP_031925721.1|  ubiquinone biosynthesis methyltransferase UbiE   56.2    4e-06   
ref|WP_000774685.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
emb|CDR60710.1|  Ubiquinone/menaquinone biosynthesis methyltransf...  56.2    4e-06   
ref|WP_000774676.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
ref|WP_007110670.1|  Methyltransferase type 11                        55.5    4e-06   
ref|WP_031890813.1|  ubiquinone biosynthesis methyltransferase UbiE   56.2    4e-06   
ref|WP_036426619.1|  ubiquinone biosynthesis protein                  55.5    4e-06   
ref|WP_044483243.1|  SAM-dependent methyltransferase                  56.2    4e-06   
ref|WP_008455382.1|  MULTISPECIES: SAM-dependent methlyltransferase   55.5    4e-06   
ref|WP_003447389.1|  hypothetical protein                             56.2    4e-06   
emb|CDR63535.1|  Ubiquinone/menaquinone biosynthesis methyltransf...  56.2    4e-06   
ref|WP_000774675.1|  ubiquinone/menaquinone biosynthesis methyltr...  56.2    4e-06   
gb|AJP65889.1|  ubiquinone biosynthesis methyltransferase UbiE        56.2    4e-06   
ref|WP_029376452.1|  ubiquinone biosynthesis methyltransferase UbiE   56.2    4e-06   
ref|WP_031902504.1|  ubiquinone biosynthesis methyltransferase UbiE   56.2    4e-06   
ref|WP_033849399.1|  ubiquinone biosynthesis methyltransferase UbiE   56.2    4e-06   



>gb|EYU36508.1| hypothetical protein MIMGU_mgv1a008665mg [Erythranthe guttata]
Length=366

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSETMLQQCY+FIKQ++NFP EN+I+VRADISRLPF SSSVDAVHAGAALHCWPS
Sbjct  220  VVALDFSETMLQQCYDFIKQDKNFPEENLIMVRADISRLPFPSSSVDAVHAGAALHCWPS  279

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS+AVAEISRVL+PGG+FVATTYIVDG++S+ P  RPLR+N AQISGSH+FL EKELE+L
Sbjct  280  PSSAVAEISRVLKPGGMFVATTYIVDGLFSYLPLSRPLRQNIAQISGSHVFLSEKELEEL  339

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            CT+CGLV F   RNR F+M++AMKP
Sbjct  340  CTSCGLVNFTSTRNRMFVMISAMKP  364



>gb|KGN60339.1| hypothetical protein Csa_3G895850 [Cucumis sativus]
Length=220

 Score =   239 bits (611),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEFIKQEENFPNE ++L+RADI+RLPFASSSVDAVHAGAALHCWPS
Sbjct  75   VVALDYSENMLRQCYEFIKQEENFPNERLVLIRADIARLPFASSSVDAVHAGAALHCWPS  134

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISR+LRPGGVFVA+T+I+DG YSF PF+R   E   QISGS IFL E+ELE+L
Sbjct  135  PSAAVAEISRILRPGGVFVASTFIMDGPYSFVPFLRIQIEGIQQISGSRIFLSERELEEL  194

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            CT CGLV FKC+RNR+F+ML+A K S
Sbjct  195  CTACGLVDFKCLRNRQFVMLSATKCS  220



>gb|KHN19749.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=353

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            +VA D+SE MLQQCYEFI+QEENFP EN ILVRADISRLPF SSSVDAVHAGAALHCWPS
Sbjct  208  IVALDYSENMLQQCYEFIQQEENFPKENFILVRADISRLPFVSSSVDAVHAGAALHCWPS  267

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P AAVAEISRVLRPGGVFVATTYI+DG +S  PF+  LR+N  Q+SGS+IFL E+ELEDL
Sbjct  268  PLAAVAEISRVLRPGGVFVATTYILDGPFSVIPFLSSLRQNVRQVSGSYIFLSERELEDL  327

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVGFKCIRN  F+M++A KPS
Sbjct  328  CRACGLVGFKCIRNGLFVMISATKPS  353



>ref|XP_003522802.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=352

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            +VA D+SE MLQQCYEFI+QEENFP EN ILVRADISRLPF SSSVDAVHAGAALHCWPS
Sbjct  207  IVALDYSENMLQQCYEFIQQEENFPKENFILVRADISRLPFVSSSVDAVHAGAALHCWPS  266

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P AAVAEISRVLRPGGVFVATTYI+DG +S  PF+  LR+N  Q+SGS+IFL E+ELEDL
Sbjct  267  PLAAVAEISRVLRPGGVFVATTYILDGPFSVIPFLSSLRQNVRQVSGSYIFLSERELEDL  326

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVGFKCIRN  F+M++A KPS
Sbjct  327  CRACGLVGFKCIRNGLFVMISATKPS  352



>ref|XP_002285799.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Vitis vinifera]
 emb|CBI19149.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCYEFIKQEE FP ENI+LVRADISRLPFASSSVDAVHAGAALHCWPS
Sbjct  205  VVALDFSENMLRQCYEFIKQEEGFPKENILLVRADISRLPFASSSVDAVHAGAALHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVATTY++DG +S  PF++ LR+N  +++GSH FL E+ELEDL
Sbjct  265  PSIAVAEISRVLRPGGVFVATTYLLDGPFSVLPFLKTLRQNMVRVAGSHAFLSERELEDL  324

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            CT CGL GF C+RN RF+M++A KPS
Sbjct  325  CTACGLGGFTCVRNGRFVMISATKPS  350



>ref|XP_011074175.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   243 bits (620),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE+MLQQCY+FIKQE+NFP EN+ILVRADISRLPFASS+VDAVHAGAALHCWPS
Sbjct  215  VVALDFSESMLQQCYDFIKQEDNFPEENLILVRADISRLPFASSTVDAVHAGAALHCWPS  274

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSA VAEISRVL+PGG+FVA+TYI DG+ S+ P    LR+N AQ SGSH+FL + ELEDL
Sbjct  275  PSAGVAEISRVLKPGGMFVASTYIADGLVSYIPLRGALRQNIAQFSGSHVFLSDTELEDL  334

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C +CGL+ F C RNRRF+ML+AMKP
Sbjct  335  CKSCGLIDFTCTRNRRFVMLSAMKP  359



>ref|XP_010105909.1| putative methyltransferase [Morus notabilis]
 gb|EXC06728.1| putative methyltransferase [Morus notabilis]
Length=266

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEFI QEENFP ENIILVRADISRLPF SSS+DAVHAGAALHCWPS
Sbjct  121  VVALDYSENMLRQCYEFINQEENFPKENIILVRADISRLPFVSSSIDAVHAGAALHCWPS  180

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISRVLRPGGVFVATTYI+DG ++F PF+R LR+   QISG++ FL E+ELEDL
Sbjct  181  PSAAVAEISRVLRPGGVFVATTYILDGPFTFVPFLRELRQYTRQISGNYSFLSERELEDL  240

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVGF C+RN  F+M++A KP+
Sbjct  241  CKACGLVGFTCVRNGAFVMISATKPT  266



>ref|XP_004136403.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=313

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEFIKQEENFPNE ++L+RADI+RLPFASSSVDAVHAGAALHCWPS
Sbjct  168  VVALDYSENMLRQCYEFIKQEENFPNERLVLIRADIARLPFASSSVDAVHAGAALHCWPS  227

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISR+LRPGGVFVA+T+I+DG YSF PF+R   E   QISGS IFL E+ELE+L
Sbjct  228  PSAAVAEISRILRPGGVFVASTFIMDGPYSFVPFLRIQIEGIQQISGSRIFLSERELEEL  287

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            CT CGLV FKC+RNR+F+ML+A K S
Sbjct  288  CTACGLVDFKCLRNRQFVMLSATKCS  313



>ref|XP_004161765.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=376

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEFIKQEENFPNE ++L+RADI+RLPFASSSVDAVHAGAALHCWPS
Sbjct  231  VVALDYSENMLRQCYEFIKQEENFPNERLVLIRADIARLPFASSSVDAVHAGAALHCWPS  290

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISR+LRPGGVFVA+T+I+DG YSF PF+R   E   QISGS IFL E+ELE+L
Sbjct  291  PSAAVAEISRILRPGGVFVASTFIMDGPYSFVPFLRIQIEGIQQISGSRIFLSERELEEL  350

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            CT CGLV FKC+RNR+F+ML+A K S
Sbjct  351  CTACGLVDFKCLRNRQFVMLSATKCS  376



>emb|CDP01043.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC EFI QEENFP E IILVRADISRLPFAS +VDAVHAGAALHCWPS
Sbjct  213  VVALDFSEAMLRQCSEFINQEENFPKEKIILVRADISRLPFASGTVDAVHAGAALHCWPS  272

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGG+FVATTYI+DG++S+ P V PLR+N AQ+SGSH+FL  KELEDL
Sbjct  273  PSVAVAEISRVLRPGGMFVATTYILDGLFSYIPLVGPLRQNVAQVSGSHVFLSNKELEDL  332

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            CT CGLV  K  RNR F+M+ A KP
Sbjct  333  CTACGLVDAKVTRNRMFVMICATKP  357



>gb|AFK47008.1| unknown [Lotus japonicus]
Length=352

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML QCYEFI+QE+NFP EN ILVRADI+RLPF +SSVDAVHAGAALHCWPS
Sbjct  207  VVALDYSENMLAQCYEFIQQEDNFPKENFILVRADIARLPFVTSSVDAVHAGAALHCWPS  266

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSA VAEISRVLRPGGVFVATTYI+DG ++F PF+  +R+N  Q SGS+IFL E+ELEDL
Sbjct  267  PSAVVAEISRVLRPGGVFVATTYILDGPFTFVPFLSTVRQNIRQASGSYIFLSERELEDL  326

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C  CGLVGFKCIRN  F+M++A KP
Sbjct  327  CRACGLVGFKCIRNGPFVMISAAKP  351



>gb|KDO80932.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=235

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW S
Sbjct  88   VVALDYSENMLKQCYEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSS  147

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS  VAEISRVLRPGGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDL
Sbjct  148  PSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDL  207

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV FKC RNR F+M TA KPS
Sbjct  208  CRACGLVDFKCTRNRGFVMFTATKPS  233



>ref|XP_006434004.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47244.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=233

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW S
Sbjct  88   VVALDYSENMLKQCYEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSS  147

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS  VAEISRVLRPGGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDL
Sbjct  148  PSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDL  207

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV FKC RNR F+M TA KPS
Sbjct  208  CRACGLVDFKCTRNRGFVMFTATKPS  233



>ref|XP_007018799.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
 gb|EOY16024.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
Length=366

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V A D+SE ML+QCYEFI++EENFP E + LVRADISRLPF SSSVDAVHAGAALHCWPS
Sbjct  221  VFALDYSENMLRQCYEFIEKEENFPKEKVTLVRADISRLPFKSSSVDAVHAGAALHCWPS  280

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVATTYI+DG + F PF+R  R+N   I+GSHIFL E+EL+DL
Sbjct  281  PSTAVAEISRVLRPGGVFVATTYILDGPFGFVPFLRTFRQNIMGIAGSHIFLSERELKDL  340

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGLVGF C+RN  F+M++A KPS
Sbjct  341  CRTCGLVGFTCVRNGLFVMISARKPS  366



>gb|KDP41368.1| hypothetical protein JCGZ_15775 [Jatropha curcas]
Length=350

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEFIKQEENFP EN+ILVRADISRLPF S SVDAVHAGAA+HCWPS
Sbjct  205  VVALDYSENMLRQCYEFIKQEENFPKENLILVRADISRLPFRSGSVDAVHAGAAIHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGV VA+TYI+DG ++F P + PLR+N AQ+SGS IFL E+ELED+
Sbjct  265  PSVAVAEISRVLRPGGVLVASTYILDGPFNFVPLLGPLRQNIAQVSGSQIFLRERELEDI  324

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C  CGLVGF   RNR+F+M +A KP
Sbjct  325  CRACGLVGFTATRNRQFVMFSARKP  349



>ref|XP_003527908.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=248

 Score =   232 bits (591),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE MLQQCYEFI++EENFP EN ILVRADISRLPF SSSVDAVHAGAALHCWPS
Sbjct  103  VVALDYSENMLQQCYEFIQKEENFPKENFILVRADISRLPFVSSSVDAVHAGAALHCWPS  162

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P A VAEISRVLRPGGVFV TTY++DG +S  PF+  LR+N  Q+SGS+IFL E+ELED 
Sbjct  163  PIAVVAEISRVLRPGGVFVVTTYMLDGPFSVIPFLSTLRQNARQVSGSYIFLSERELEDH  222

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVGFKCIRN  F M++A KPS
Sbjct  223  CRACGLVGFKCIRNGLFEMISATKPS  248



>ref|XP_002302290.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|EEE81563.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=349

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V A D+SE ML+QCYEFIKQEENFP EN+ILVRADI+RLPF S S+DAVHAGAA+HCWPS
Sbjct  204  VTALDYSENMLKQCYEFIKQEENFPKENLILVRADIARLPFVSGSLDAVHAGAAIHCWPS  263

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAE+SRVLRPGGVFVATTYI+DG +SF PF++P+ + F Q SG++ FL E+ELE +
Sbjct  264  PSAAVAEVSRVLRPGGVFVATTYILDGPFSFIPFLKPISQRFTQASGNNFFLSERELEAV  323

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV F C RNR+FIM +A KPS
Sbjct  324  CRACGLVNFTCTRNRQFIMFSATKPS  349



>ref|XP_007136240.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
 gb|ESW08234.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
Length=376

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE MLQQCYEFI+Q+ENFP  N ILVRADISRLPF S+SVDAVHAGAALHCWPS
Sbjct  231  VVALDYSENMLQQCYEFIQQDENFPKGNFILVRADISRLPFVSNSVDAVHAGAALHCWPS  290

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P AAVAEISRVLRPGGVFVATTYI+DG  S  PF   LR+N  Q SGS+IFL E+ELEDL
Sbjct  291  PLAAVAEISRVLRPGGVFVATTYILDGPLSVIPFRSTLRQNIRQASGSYIFLSERELEDL  350

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVGFKCIRN  F+M++A KPS
Sbjct  351  CRACGLVGFKCIRNGLFVMISARKPS  376



>ref|XP_004500619.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cicer arietinum]
Length=338

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEFI+QE NFP EN  LVRADI+RLPF SSSVDAVHAGAALHCWPS
Sbjct  193  VVALDYSENMLRQCYEFIQQENNFPKENFNLVRADIARLPFVSSSVDAVHAGAALHCWPS  252

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISRVLRPGGVFVATTYI+DG ++  PF+  LR+N  Q+SGS+IFL E+ELE L
Sbjct  253  PSAAVAEISRVLRPGGVFVATTYILDGPFTPVPFLSTLRQNIRQVSGSYIFLSERELEAL  312

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C  CGLVGFKCIRN  F+M++A KP
Sbjct  313  CKACGLVGFKCIRNGLFVMISATKP  337



>ref|XP_011016296.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Populus euphratica]
Length=379

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V A D+SE ML+QCYEF++QEENFP EN ILVRADI+RLPF S S+DAVHAGAA+HCWPS
Sbjct  234  VTALDYSENMLKQCYEFVQQEENFPKENFILVRADIARLPFVSGSLDAVHAGAAIHCWPS  293

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAE+SRVLRPGGVFVATTYI+DG +SF PF++P+ + F Q+SGS+ FL E+ELE +
Sbjct  294  PSAAVAEVSRVLRPGGVFVATTYILDGPFSFIPFLKPISQRFTQVSGSNFFLSERELEAV  353

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV F C RNR+FIM +A KPS
Sbjct  354  CRACGLVNFTCTRNRQFIMFSATKPS  379



>ref|XP_010059991.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66499.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
 gb|KCW66500.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
Length=364

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML+QCYEFI+ EENFP E + LVRADISRLPFAS S+DAVHAGAALHCWPS
Sbjct  219  VIALDYSENMLKQCYEFIQGEENFPEEKLALVRADISRLPFASGSIDAVHAGAALHCWPS  278

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVATTY++DG ++  P +RPL +N +QISGSHIFL E ELEDL
Sbjct  279  PSTAVAEISRVLRPGGVFVATTYLLDGPFALFPLLRPLCQNISQISGSHIFLSEGELEDL  338

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C TCGL+GFK +RN RF+M++A +P
Sbjct  339  CRTCGLIGFKFLRNERFVMISASRP  363



>ref|XP_007222212.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
 gb|EMJ23411.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
Length=354

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+Q YEFIK+EENFP ENIILVRADISRLPFA+SSVDAVHAGAALHCWPS
Sbjct  209  VVALDYSENMLKQTYEFIKKEENFPEENIILVRADISRLPFATSSVDAVHAGAALHCWPS  268

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVATTYI+DG  S+ PF+R + +   QISGS IF  E+ELEDL
Sbjct  269  PSTAVAEISRVLRPGGVFVATTYILDGPLSYIPFLRNITQRTKQISGSQIFTSERELEDL  328

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVG+ C+RN  F+M++A KPS
Sbjct  329  CKACGLVGYTCVRNGLFVMISATKPS  354



>ref|XP_002513908.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48491.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=351

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE MLQQCY+FIKQEENFP EN+I VRADISRLPF   SVDAVHAGAA+HCWPS
Sbjct  206  VVALDYSENMLQQCYDFIKQEENFPTENLISVRADISRLPFLFGSVDAVHAGAAIHCWPS  265

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISRVLRPGGVFVA+T+I+DG +SF P + PLR+N AQISGS IFL E ELED+
Sbjct  266  PSAAVAEISRVLRPGGVFVASTFILDGPFSFVPLMGPLRQNIAQISGSQIFLREYELEDI  325

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C  CGLVGF  IR+R+F+M +A KP
Sbjct  326  CRACGLVGFTAIRDRQFVMFSARKP  350



>ref|XP_006434005.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 ref|XP_006434007.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47245.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47247.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=349

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW S
Sbjct  204  VVALDYSENMLKQCYEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSS  263

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS  VAEISRVLRPGGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDL
Sbjct  264  PSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDL  323

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV FKC RNR F+M TA KPS
Sbjct  324  CRACGLVDFKCTRNRGFVMFTATKPS  349



>gb|KDO80931.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=351

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW S
Sbjct  204  VVALDYSENMLKQCYEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSS  263

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS  VAEISRVLRPGGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDL
Sbjct  264  PSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDL  323

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV FKC RNR F+M TA KPS
Sbjct  324  CRACGLVDFKCTRNRGFVMFTATKPS  349



>ref|XP_002306578.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEE93574.1| methyltransferase-related family protein [Populus trichocarpa]
Length=244

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE MLQQCYEFIKQEENFP EN+ILVRADI+RLPF S S+DAV AGAA+HCWPS
Sbjct  99   VMALDYSENMLQQCYEFIKQEENFPKENLILVRADIARLPFISGSLDAVPAGAAIHCWPS  158

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAE+SRVLRPGGVFVATTYI+DG +S  PF++P+ + F Q+SGS+IFL E+ELED+
Sbjct  159  PSVAVAEVSRVLRPGGVFVATTYILDGHFSLIPFLKPISQRFTQVSGSNIFLSERELEDV  218

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C  CGLV F C RN RF+M +A KP
Sbjct  219  CRACGLVDFTCTRNGRFVMFSATKP  243



>ref|XP_010269234.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Nelumbo nucifera]
Length=349

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FI QE++FP EN+ILVRADISRLPF SSS+DAVHAGAALHCWPS
Sbjct  204  VVALDFSENMLKQCYDFINQEKSFPKENLILVRADISRLPFVSSSIDAVHAGAALHCWPS  263

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISRVLRPGGVFVATTYIVDGI    P  R LR+   QIS SHIFL E+ELEDL
Sbjct  264  PSAAVAEISRVLRPGGVFVATTYIVDGIVGALPVSRILRQYIGQISSSHIFLSERELEDL  323

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVGF C RN  FIM++A KP+
Sbjct  324  CKACGLVGFTCTRNGPFIMMSATKPT  349



>ref|XP_006472621.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=333

 Score =   232 bits (592),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++QE NFP EN +LVRADISRLPFA+SS+DAVHAGAA+HCWPS
Sbjct  186  VVALDYSENMLKQCYEFVQQEANFPKENFLLVRADISRLPFAASSIDAVHAGAAIHCWPS  245

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS  VAEISRVLRPGGVFV TTYI DG ++  PF R LR+N  QISGS+ FL E+E+EDL
Sbjct  246  PSTGVAEISRVLRPGGVFVGTTYIFDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDL  305

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV FKC RNR F+M TA KPS
Sbjct  306  CRACGLVDFKCTRNRGFVMFTATKPS  331



>ref|XP_006472620.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=351

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++QE NFP EN +LVRADISRLPFA+SS+DAVHAGAA+HCWPS
Sbjct  204  VVALDYSENMLKQCYEFVQQEANFPKENFLLVRADISRLPFAASSIDAVHAGAAIHCWPS  263

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS  VAEISRVLRPGGVFV TTYI DG ++  PF R LR+N  QISGS+ FL E+E+EDL
Sbjct  264  PSTGVAEISRVLRPGGVFVGTTYIFDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDL  323

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV FKC RNR F+M TA KPS
Sbjct  324  CRACGLVDFKCTRNRGFVMFTATKPS  349



>ref|XP_008466034.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Cucumis melo]
Length=356

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCY FIKQEENFPNE ++L+RADI+RLPFASSSVDAVHAGAA+HCWPS
Sbjct  211  VVALDYSENMLRQCYGFIKQEENFPNERLVLIRADIARLPFASSSVDAVHAGAAVHCWPS  270

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSA VAEISR+LRPGGVFVA+T+I+DG +SF PF+R   E   QI+GS IFL E+ELE+L
Sbjct  271  PSAGVAEISRILRPGGVFVASTFIMDGPFSFVPFLRIQIEGIQQIAGSRIFLSERELEEL  330

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            CT CGLV FKC+RNR+F+ML+A K S
Sbjct  331  CTACGLVDFKCLRNRQFVMLSATKRS  356



>gb|KHN03912.1| Putative methyltransferase, chloroplastic, partial [Glycine soja]
Length=213

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE MLQQCYEFI++EENFP EN ILVRADISRLPF SSSVDAVHAGAALHCWPS
Sbjct  69   VVALDYSENMLQQCYEFIQKEENFPKENFILVRADISRLPFVSSSVDAVHAGAALHCWPS  128

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P  AVAEISRVLRPGGVFV TTY++DG +S  PF+  LR+N  Q+SGS+IFL E+ELED 
Sbjct  129  P-IAVAEISRVLRPGGVFVVTTYMLDGPFSVIPFLSTLRQNARQVSGSYIFLSERELEDH  187

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVGFKCIRN  F M++A KPS
Sbjct  188  CRACGLVGFKCIRNGLFEMISATKPS  213



>gb|KEH34908.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++Q++NFP EN ILVRADI+RLPF SSS+DAVHAGAALHCWPS
Sbjct  197  VVALDYSENMLRQCYEFVQQKDNFPKENFILVRADIARLPFVSSSIDAVHAGAALHCWPS  256

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISRVLRPGGVFVATTYI+DG ++  PF+  LR+   Q+SG + FL E+ELE L
Sbjct  257  PSAAVAEISRVLRPGGVFVATTYILDGPFTIVPFLSTLRQTINQVSGIYTFLSERELEAL  316

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C TCGLVGFKCIRN  F+M++A KP
Sbjct  317  CKTCGLVGFKCIRNGPFVMISAAKP  341



>ref|XP_008219673.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Prunus mume]
Length=354

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+Q YEFIK+EENFP ENIILVRADISRLPFA+SSVDAVHAGAALHCWPS
Sbjct  209  VVALDYSENMLKQTYEFIKKEENFPEENIILVRADISRLPFATSSVDAVHAGAALHCWPS  268

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P+  VAEISRVLRPGGVFVATTYI+DG  S+ PF+R + +   QISGS IF  E+ELEDL
Sbjct  269  PATGVAEISRVLRPGGVFVATTYILDGPLSYIPFLRNITQRTKQISGSQIFTSERELEDL  328

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVG+ C+RN  F+M++A KPS
Sbjct  329  CKACGLVGYTCVRNGLFVMISATKPS  354



>ref|XP_004299641.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEFI++EENFP ENI LVRADISRLPFA+SS+DAVHAGAA+HCWPS
Sbjct  200  VVALDYSENMLKQCYEFIEKEENFPKENITLVRADISRLPFATSSIDAVHAGAAIHCWPS  259

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P+ AVAEISRVLRPGGVFVATTYI+DG ++F PF+R   +   Q+SGS IFL E ELED+
Sbjct  260  PTGAVAEISRVLRPGGVFVATTYILDGPFAFVPFLREGTKRARQVSGSQIFLSEGELEDI  319

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            CT CGLVG   +RNR+F+M++A KPS
Sbjct  320  CTACGLVGVTVVRNRQFVMISATKPS  345



>gb|KJB59931.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=339

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE MLQQCYEFI+QEENFP E + LVRADISRLPF SSS+DAVHAGAALHCWPS
Sbjct  193  VIALDYSENMLQQCYEFIEQEENFPKEKVTLVRADISRLPFESSSIDAVHAGAALHCWPS  252

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVATTYIVDG ++F PFV   R+N   I+GS+  + E+ELEDL
Sbjct  253  PSTAVAEISRVLRPGGVFVATTYIVDGPFTFLPFVNAFRQNMMGIAGSYFAVSERELEDL  312

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGLVGF C+RN  F+M++A K S
Sbjct  313  CRTCGLVGFTCMRNGPFVMISARKRS  338



>gb|KJB59929.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=349

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE MLQQCYEFI+QEENFP E + LVRADISRLPF SSS+DAVHAGAALHCWPS
Sbjct  203  VIALDYSENMLQQCYEFIEQEENFPKEKVTLVRADISRLPFESSSIDAVHAGAALHCWPS  262

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVATTYIVDG ++F PFV   R+N   I+GS+  + E+ELEDL
Sbjct  263  PSTAVAEISRVLRPGGVFVATTYIVDGPFTFLPFVNAFRQNMMGIAGSYFAVSERELEDL  322

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGLVGF C+RN  F+M++A K S
Sbjct  323  CRTCGLVGFTCMRNGPFVMISARKRS  348



>gb|KCW67137.1| hypothetical protein EUGRSUZ_F00926, partial [Eucalyptus grandis]
Length=294

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML+QCYEFI+QEENFP EN  LVRADISRLPFASSS+DAVHAGAALHCWPS
Sbjct  149  VIALDYSENMLKQCYEFIQQEENFPEENFALVRADISRLPFASSSIDAVHAGAALHCWPS  208

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEISRVLRPGGVFVATT+++DG  +  P +RPL +   Q+SGSHIFL E ELE L
Sbjct  209  PSTAIAEISRVLRPGGVFVATTFLLDGPSALFPLLRPLCQISTQLSGSHIFLSEGELEGL  268

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGL+G K +RN RF+M++A KPS
Sbjct  269  CRTCGLIGVKFVRNERFVMISASKPS  294



>ref|XP_010428930.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=355

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA D+SE ML+QCYE + QEENFPN EN++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  209  VVALDYSENMLRQCYELLNQEENFPNKENLVLVRADIARLPFLSGSVDAVHAGAALHCWP  268

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG++SF PFV+  R+   + SG+H+FL E+ELED
Sbjct  269  SPSSAVAEISRVLRPGGVFVATTFIYDGLFSFIPFVKNFRQEIMRYSGAHVFLSERELED  328

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT CGLVGF  +RN  FIML+A KP
Sbjct  329  LCTACGLVGFTRVRNGPFIMLSATKP  354



>ref|XP_010428929.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=356

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA D+SE ML+QCYE + QEENFPN EN++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  210  VVALDYSENMLRQCYELLNQEENFPNKENLVLVRADIARLPFLSGSVDAVHAGAALHCWP  269

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG++SF PFV+  R+   + SG+H+FL E+ELED
Sbjct  270  SPSSAVAEISRVLRPGGVFVATTFIYDGLFSFIPFVKNFRQEIMRYSGAHVFLSERELED  329

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT CGLVGF  +RN  FIML+A KP
Sbjct  330  LCTACGLVGFTRVRNGPFIMLSATKP  355



>ref|XP_006386404.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|ERP64201.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=355

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 6/152 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V A D+SE ML+QCYEFIKQEENFP EN+ILVRADI+RLPF S S+DAVHAGAA+HCWPS
Sbjct  204  VTALDYSENMLKQCYEFIKQEENFPKENLILVRADIARLPFVSGSLDAVHAGAAIHCWPS  263

Query  545  PSAA------VAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDE  384
            PSAA      VAE+SRVLRPGGVFVATTYI+DG +SF PF++P+ + F Q SG++ FL E
Sbjct  264  PSAALFFNSQVAEVSRVLRPGGVFVATTYILDGPFSFIPFLKPISQRFTQASGNNFFLSE  323

Query  383  KELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            +ELE +C  CGLV F C RNR+FIM +A KPS
Sbjct  324  RELEAVCRACGLVNFTCTRNRQFIMFSATKPS  355



>ref|XP_010064389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
Length=354

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML+QCYEFI+QEENFP EN  LVRADISRLPFASSS+DAVHAGAALHCWPS
Sbjct  209  VIALDYSENMLKQCYEFIQQEENFPEENFALVRADISRLPFASSSIDAVHAGAALHCWPS  268

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEISRVLRPGGVFVATT+++DG  +  P +RPL +   Q+SGSHIFL E ELE L
Sbjct  269  PSTAIAEISRVLRPGGVFVATTFLLDGPSALFPLLRPLCQISTQLSGSHIFLSEGELEGL  328

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGL+G K +RN RF+M++A KPS
Sbjct  329  CRTCGLIGVKFVRNERFVMISASKPS  354



>ref|XP_010061813.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW68836.1| hypothetical protein EUGRSUZ_F02436 [Eucalyptus grandis]
Length=346

 Score =   227 bits (578),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML++CYEFIK+EENFP E++ILVRADISRLPF SSSVDAVHAGAA+HCW S
Sbjct  201  VVALDYSENMLRECYEFIKKEENFPKEDLILVRADISRLPFVSSSVDAVHAGAAVHCWSS  260

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS+AVAEISRVLRPGG+FVATT+I DG Y+  PF + +++N  +ISG   FL E ELEDL
Sbjct  261  PSSAVAEISRVLRPGGIFVATTFIYDGPYALNPFSKLMQKNMFRISGGQFFLSEHELEDL  320

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGL  FKC RNRRF+M++A KPS
Sbjct  321  CKTCGLEDFKCTRNRRFVMISATKPS  346



>ref|XP_010064206.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66498.1| hypothetical protein EUGRSUZ_F00305 [Eucalyptus grandis]
Length=354

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML+QCYEFI+QEENFP EN +LVRADISRLPFASSS+DAVHAGAALHCWPS
Sbjct  209  VIALDYSENMLKQCYEFIQQEENFPEENFLLVRADISRLPFASSSIDAVHAGAALHCWPS  268

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEISRVLRPGGV VATT ++DG ++  P +RPL +   Q+SGSHIF  E ELE L
Sbjct  269  PSTAIAEISRVLRPGGVLVATTLLLDGPFALFPLLRPLSQISTQLSGSHIFRSEGELEGL  328

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGL+G K +RN+RF+M++A KPS
Sbjct  329  CRTCGLIGVKFVRNKRFVMISASKPS  354



>gb|KHG01878.1| hypothetical protein F383_23026 [Gossypium arboreum]
Length=349

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML+QCYEFIKQEENFP E + LVRADISRLPF S+S+DAVHAGAALHCWPS
Sbjct  203  VIALDYSENMLRQCYEFIKQEENFPKEKVTLVRADISRLPFESNSIDAVHAGAALHCWPS  262

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVATTYI DG ++F PFV   R+N   I+GS+  + E+ELEDL
Sbjct  263  PSTAVAEISRVLRPGGVFVATTYIFDGPFTFLPFVNTFRQNMMGIAGSYFAVSEQELEDL  322

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGLVGF C+RN  F+M++A K S
Sbjct  323  CRTCGLVGFTCMRNGPFVMISARKRS  348



>ref|XP_002889176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QCYE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  206  VIALDYSENMLRQCYELLNQEENFPNREKLVLVRADIARLPFLSGSVDAVHAGAALHCWP  265

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ LR+   + SGSH+FL+E+ELED
Sbjct  266  SPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNLRQELMRYSGSHMFLNERELED  325

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            LC  CGLVGF  +RN  FIML+A KPS
Sbjct  326  LCKACGLVGFTRVRNGPFIMLSATKPS  352



>ref|XP_010416782.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=360

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA D+SE ML+QCYE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  214  VVALDYSENMLRQCYELLNQEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWP  273

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG++SF PF++  R+   + SG+H+FL E+ELED
Sbjct  274  SPSSAVAEISRVLRPGGVFVATTFIYDGLFSFIPFLKNFRQEIMRYSGAHVFLSERELED  333

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT CGLVGF  +RN  FIML+A KP
Sbjct  334  LCTACGLVGFTRVRNGPFIMLSATKP  359



>ref|XP_010416783.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=359

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA D+SE ML+QCYE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  213  VVALDYSENMLRQCYELLNQEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWP  272

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG++SF PF++  R+   + SG+H+FL E+ELED
Sbjct  273  SPSSAVAEISRVLRPGGVFVATTFIYDGLFSFIPFLKNFRQEIMRYSGAHVFLSERELED  332

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT CGLVGF  +RN  FIML+A KP
Sbjct  333  LCTACGLVGFTRVRNGPFIMLSATKP  358



>ref|XP_010472019.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=357

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA D+SE ML+QCYE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  211  VVALDYSENMLRQCYELLNQEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWP  270

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++  R+   + SG+H+FL E+ELED
Sbjct  271  SPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNFRQEIMRYSGAHVFLSERELED  330

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT CGLVGF  +RN  FIML+A KP
Sbjct  331  LCTACGLVGFTRVRNGPFIMLSATKP  356



>ref|XP_010472020.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=356

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA D+SE ML+QCYE + QEENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  210  VVALDYSENMLRQCYELLNQEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWP  269

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++  R+   + SG+H+FL E+ELED
Sbjct  270  SPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNFRQEIMRYSGAHVFLSERELED  329

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT CGLVGF  +RN  FIML+A KP
Sbjct  330  LCTACGLVGFTRVRNGPFIMLSATKP  355



>emb|CDY14625.1| BnaC02g24880D [Brassica napus]
Length=339

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QCYEF+ QEEN  N EN++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  192  VIALDYSENMLKQCYEFLNQEENLTNKENVVLVRADIARLPFLSGSVDAVHAGAALHCWP  251

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ LR+   + SGSHIFL E+ELED
Sbjct  252  SPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNLRQELMRYSGSHIFLSERELED  311

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            LC   GLVGF  +RN  FIML+A KPS
Sbjct  312  LCKAGGLVGFTRVRNGLFIMLSATKPS  338



>ref|XP_006300528.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
 gb|EOA33426.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
Length=348

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA D+SE ML+QCYE + QEENFPN E ++LVRADI+RLPF S S+DAVHAGAALHCWP
Sbjct  200  VVALDYSENMLRQCYELLNQEENFPNKEKLVLVRADIARLPFLSGSLDAVHAGAALHCWP  259

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ LR+ F   SGSH+FL E+ELED
Sbjct  260  SPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNLRQEFMSYSGSHVFLSERELED  319

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMK  294
            LC  CGLVGF  +RN  FIML+A K
Sbjct  320  LCKACGLVGFTRVRNGPFIMLSATK  344



>ref|XP_006390018.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
 gb|ESQ27304.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
Length=351

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QCYEF+ QEEN  N E ++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  204  VIALDYSENMLRQCYEFLNQEENVTNKEKVVLVRADIARLPFLSGSVDAVHAGAALHCWP  263

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVL+PGGVFVATT+I DG +SF PF++ +R+   + SGSHIFL E+EL+D
Sbjct  264  SPSSAVAEISRVLKPGGVFVATTFIYDGPFSFIPFLKNIRQEIMRYSGSHIFLSERELKD  323

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            +C  CGLVGF C+RN  FIML+A KPS
Sbjct  324  ICGACGLVGFTCVRNGPFIMLSATKPS  350



>ref|NP_565170.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q8LBV4.1|Y1814_ARATH RecName: Full=Uncharacterized methyltransferase At1g78140, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM64539.1| unknown [Arabidopsis thaliana]
 gb|AAO42148.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50518.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36071.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=355

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QCYE + +EENFPN E ++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  209  VIALDYSENMLRQCYELLNKEENFPNKEKLVLVRADIARLPFLSGSVDAVHAGAALHCWP  268

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ LR+   + SGSHIFL+E+ELED
Sbjct  269  SPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNLRQEIMRYSGSHIFLNERELED  328

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            +C  CGLV F  +RN  FIML+A KPS
Sbjct  329  ICKACGLVNFTRVRNGPFIMLSATKPS  355



>ref|XP_009106463.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=337

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENII-LVRADISRLPFASSSVDAVHAGAALHCWP  549
            V A D+SE ML+QCYEF+KQE N  ++ I+ L RADI+RLPF S SVDAVHAGAALHCWP
Sbjct  190  VYALDYSENMLRQCYEFLKQEANLIDKKIVVLARADIARLPFLSGSVDAVHAGAALHCWP  249

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG++ F PF++ LR+   + SGSH+FL E+ELED
Sbjct  250  SPSSAVAEISRVLRPGGVFVATTFIYDGLFRFVPFLKELRQEIMRYSGSHMFLSERELED  309

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            LC +CGLVGF C+RN  FIML+A KP+
Sbjct  310  LCKSCGLVGFTCVRNGLFIMLSATKPT  336



>ref|XP_009373157.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Pyrus x bretschneideri]
Length=348

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML++CY FI+QEENFP EN+ILVRADISRLPFA+SSVDAVHAGAA+HCWPS
Sbjct  203  VVALDYSENMLKECYGFIQQEENFPKENMILVRADISRLPFATSSVDAVHAGAAIHCWPS  262

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS+AVAEISRVLRPGGVFVATT+I DG +S  PF R + +   Q+SG+ +F  E ELED+
Sbjct  263  PSSAVAEISRVLRPGGVFVATTFIWDGPFSLIPFQRNIAQRTKQMSGNQLFTSESELEDI  322

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C  CGLVGF  +RNRRF+M++  KP
Sbjct  323  CQACGLVGFTKVRNRRFVMISCTKP  347



>ref|XP_009106462.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=348

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 1/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENII-LVRADISRLPFASSSVDAVHAGAALHCWP  549
            V A D+SE ML+QCYEF+KQE N  ++ I+ L RADI+RLPF S SVDAVHAGAALHCWP
Sbjct  201  VYALDYSENMLRQCYEFLKQEANLIDKKIVVLARADIARLPFLSGSVDAVHAGAALHCWP  260

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG++ F PF++ LR+   + SGSH+FL E+ELED
Sbjct  261  SPSSAVAEISRVLRPGGVFVATTFIYDGLFRFVPFLKELRQEIMRYSGSHMFLSERELED  320

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            LC +CGLVGF C+RN  FIML+A KP+
Sbjct  321  LCKSCGLVGFTCVRNGLFIMLSATKPT  347



>ref|XP_010667997.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=349

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE MLQQCYEF+K++  FP E +ILVRADISRLPF S S+DAVHAGAALHCWPS
Sbjct  204  VVALDYSEAMLQQCYEFVKEDPGFPKEKLILVRADISRLPFVSGSIDAVHAGAALHCWPS  263

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A AEISR+LRPGGVFVATT I DG ++  PF    RE   QISGS IFL E+ELEDL
Sbjct  264  PSNAGAEISRILRPGGVFVATTTIGDGPFTLVPFRSNFREYLQQISGSRIFLSERELEDL  323

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            CTTCGLV F+C RN  F+M++A KP+
Sbjct  324  CTTCGLVDFRCTRNGLFVMISATKPN  349



>ref|XP_008391145.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=291

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML++CY FI+QE+NFP EN+ILVRADISRLPFA+SSVDAVHAGAA+HCWPS
Sbjct  146  VVALDYSENMLKECYGFIQQEDNFPKENMILVRADISRLPFATSSVDAVHAGAAIHCWPS  205

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS+AVAEISRVLRPGGVFVATT+I DG +S  PF R + +   Q+SG+ +F  E EL+D+
Sbjct  206  PSSAVAEISRVLRPGGVFVATTFIWDGPFSLIPFQRNIAQRTKQMSGNQLFTSESELQDI  265

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C  CGLVGF  +RN RF+M++A KP
Sbjct  266  CQACGLVGFTKVRNGRFVMISATKP  290



>ref|XP_009128280.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Brassica rapa]
Length=341

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA D+SE ML+QCY+F+ QEEN  N E ++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  194  VVALDYSENMLKQCYDFLNQEENLTNKEKVVLVRADIARLPFLSGSVDAVHAGAALHCWP  253

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ LR+   + SGSHIFL E+ELED
Sbjct  254  SPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNLRQELMRYSGSHIFLSERELED  313

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            LC   GLVGF  +RN  FIML+A KPS
Sbjct  314  LCKAGGLVGFTRVRNGLFIMLSATKPS  340



>emb|CDY26853.1| BnaA02g18780D [Brassica napus]
Length=341

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-ENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA D+SE ML+QCY+F+ QEEN  N E ++LVRADI+RLPF S SVDAVHAGAALHCWP
Sbjct  194  VVALDYSENMLKQCYDFLNQEENLTNKEKVVLVRADIARLPFLSGSVDAVHAGAALHCWP  253

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG +SF PF++ LR+   + SGSHIFL E+ELED
Sbjct  254  SPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNLRQELMRYSGSHIFLSERELED  313

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            LC   GLVGF  +RN  FIML+A KPS
Sbjct  314  LCKAGGLVGFTRVRNGLFIMLSATKPS  340



>ref|XP_008374425.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Malus domestica]
Length=355

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML++CY FI+QEENFP EN ILVRADISRLPFA+SSVDAVHAGAALHCWPS
Sbjct  210  VVALDYSENMLKECYGFIQQEENFPKENXILVRADISRLPFATSSVDAVHAGAALHCWPS  269

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISRVLRPGGVFVA+TYI+DG +S  PF+R +     QISGS +F  E E EDL
Sbjct  270  PSAAVAEISRVLRPGGVFVASTYILDGRFSLIPFLRNITRVTKQISGSQVFTSESEFEDL  329

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVGF  +R   F+M++A KP+
Sbjct  330  CQACGLVGFTKVRYGLFVMISATKPT  355



>emb|CDX88421.1| BnaC06g38650D [Brassica napus]
Length=353

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 122/150 (81%), Gaps = 1/150 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENII-LVRADISRLPFASSSVDAVHAGAALHCWP  549
            V A D+SE ML+QCYEF+KQE N  ++ I+ L RADI+RLPF S SVDAVHAGAALHCWP
Sbjct  201  VYALDYSENMLRQCYEFLKQEANLIDKKIVVLARADIARLPFLSGSVDAVHAGAALHCWP  260

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS+AVAEISRVLRPGGVFVATT+I DG+  F PF++ LR+     SGSH+FL E+ELED
Sbjct  261  SPSSAVAEISRVLRPGGVFVATTFIYDGLVRFVPFLKELRQEVMGYSGSHMFLSERELED  320

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS*LL  279
            LC +CGLVGF C+RN  FIML+A KP+ +L
Sbjct  321  LCKSCGLVGFTCVRNGLFIMLSATKPTDML  350



>ref|XP_008374488.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Malus domestica]
Length=348

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML++CY FI+QEENFP EN ILVRADISRLPFA+SSVDAVHAGAALHCWPS
Sbjct  203  VVALDYSENMLKECYGFIQQEENFPKENXILVRADISRLPFATSSVDAVHAGAALHCWPS  262

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISRVLRPGGVFVA+TYI+DG +S  PF+R +     QISGS +F  E E EDL
Sbjct  263  PSAAVAEISRVLRPGGVFVASTYILDGRFSLIPFLRNITRVTKQISGSQVFTSESEFEDL  322

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVGF  +R   F+M++A KP+
Sbjct  323  CQACGLVGFTKVRYGLFVMISATKPT  348



>ref|XP_010534071.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=349

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML+QCYEF+ QEENFP E I+LVRADISRLPF S SVDAVHAGAALHCWPS
Sbjct  205  VIALDYSENMLRQCYEFVNQEENFPKEKIVLVRADISRLPFLSGSVDAVHAGAALHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P++AVAE+SRVLRPGGVFVATT+I + + SF PF R +R+   + SGSH FL E+ELED+
Sbjct  265  PASAVAEVSRVLRPGGVFVATTFINEPL-SFIPFSRNIRQGVIRYSGSHFFLSERELEDV  323

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C  CGLVGF C+RN  FIML+A KP
Sbjct  324  CRACGLVGFNCVRNGPFIMLSATKP  348



>ref|XP_010534070.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML+QCYEF+ QEENFP E I+LVRADISRLPF S SVDAVHAGAALHCWPS
Sbjct  212  VIALDYSENMLRQCYEFVNQEENFPKEKIVLVRADISRLPFLSGSVDAVHAGAALHCWPS  271

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P++AVAE+SRVLRPGGVFVATT+I + + SF PF R +R+   + SGSH FL E+ELED+
Sbjct  272  PASAVAEVSRVLRPGGVFVATTFINEPL-SFIPFSRNIRQGVIRYSGSHFFLSERELEDV  330

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C  CGLVGF C+RN  FIML+A KP
Sbjct  331  CRACGLVGFNCVRNGPFIMLSATKP  355



>ref|XP_008391080.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=355

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML++CY FI+QEENFP E +ILVRADISRLPFA+ SVDAVHAGAA+HCWPS
Sbjct  210  VVALDYSENMLKECYGFIQQEENFPKEXMILVRADISRLPFATGSVDAVHAGAAIHCWPS  269

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVA+TYI+DG +S  PF+R + +   QISG  +F  E ELED+
Sbjct  270  PSTAVAEISRVLRPGGVFVASTYILDGPFSLIPFLRNITQRTKQISGGQVFTSESELEDI  329

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV F  +RNR F+M++A KP+
Sbjct  330  CQACGLVXFTKVRNRLFVMISATKPT  355



>emb|CDX87473.1| BnaA07g34000D [Brassica napus]
Length=356

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 121/155 (78%), Gaps = 9/155 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENII-LVRADISRL--------PFASSSVDAVHA  573
            V A D+SE ML+QCYEF+KQE N  ++ I+ L RADI+RL        PF S  VDAVHA
Sbjct  201  VYALDYSENMLRQCYEFLKQEANLIDKKIVVLARADIARLQGHGPARLPFLSGVVDAVHA  260

Query  572  GAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIF  393
            GAALHCWPSPS+AVAEISRVLRPGGVFVATT+I DG++ F PF++ LR+   + SGSH+F
Sbjct  261  GAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGLFRFVPFLKKLRQEVMRYSGSHMF  320

Query  392  LDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            L E+ELEDLC +CGLVGF C+RN  FIML+A KP+
Sbjct  321  LSERELEDLCESCGLVGFTCVRNGLFIMLSATKPT  355



>ref|XP_010937469.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=345

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML QC EFIKQ+     EN+ILVRADISRLPF SSS+DAVHAGAALHCWPS
Sbjct  197  VVALDFSENMLLQCDEFIKQK-GISKENLILVRADISRLPFVSSSIDAVHAGAALHCWPS  255

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVATT+++D I    P  R +RE F++ SG H++L E ELED+
Sbjct  256  PSTAVAEISRVLRPGGVFVATTFVLDTIPPAVPIFRAIREFFSRNSGQHLYLSEGELEDI  315

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGL+GF CIRN  FIM++A KPS
Sbjct  316  CRACGLIGFTCIRNGFFIMISATKPS  341



>ref|XP_009394965.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=352

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE MLQQCY FI QE   P EN+ILVRADISRLPF SSSVDAVHAGAA+HCWPS
Sbjct  208  VIALDFSENMLQQCYNFINQE-GMPRENLILVRADISRLPFVSSSVDAVHAGAAIHCWPS  266

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSA VAEISRVLRPGGVFVATT+I+D +    P ++ +R+ + + S ++++L E ELEDL
Sbjct  267  PSAGVAEISRVLRPGGVFVATTFILDVLPPVIPILKTVRQYYIRASSNYLYLSEGELEDL  326

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGLV F C+RN  F+M++A KPS
Sbjct  327  CQTCGLVNFTCVRNGPFVMISATKPS  352



>ref|XP_009394964.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE MLQQCY FI QE   P EN+ILVRADISRLPF SSSVDAVHAGAA+HCWPS
Sbjct  211  VIALDFSENMLQQCYNFINQE-GMPRENLILVRADISRLPFVSSSVDAVHAGAAIHCWPS  269

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSA VAEISRVLRPGGVFVATT+I+D +    P ++ +R+ + + S ++++L E ELEDL
Sbjct  270  PSAGVAEISRVLRPGGVFVATTFILDVLPPVIPILKTVRQYYIRASSNYLYLSEGELEDL  329

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C TCGLV F C+RN  F+M++A KPS
Sbjct  330  CQTCGLVNFTCVRNGPFVMISATKPS  355



>ref|XP_008808068.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Phoenix dactylifera]
Length=339

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML QC EFIKQ+     EN+ILVRADISRLPF SSS+DAVHAGAALHCWPS
Sbjct  195  VVALDFSENMLLQCDEFIKQK-GISKENLILVRADISRLPFVSSSIDAVHAGAALHCWPS  253

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGVFVATT+++D I    P  R +RE + + SG H++L E ELED+
Sbjct  254  PSTAVAEISRVLRPGGVFVATTFVLDTIPPAVPIFRAIRELYTRTSGQHLYLSEGELEDI  313

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C+ CGL+GF  IRN  FIM++A KP
Sbjct  314  CSACGLIGFTRIRNGSFIMISATKP  338



>gb|AFK36862.1| unknown [Lotus japonicus]
Length=132

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  647  ENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVD  468
             N ILVRADI+RLPF +SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYI+D
Sbjct  13   RNFILVRADIARLPFVTSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYILD  72

Query  467  GIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            G ++F PF+  +R+N  Q SGS+IFL E+ELEDLC  CGLVGFKCIRN  F+M++A KP
Sbjct  73   GPFTFVPFLSTVRQNIRQASGSYIFLSERELEDLCRACGLVGFKCIRNGPFVMISAAKP  131



>ref|XP_010939635.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=313

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE MLQ C +FIKQE     +N+ILVRAD+SRLPF SSS+DAVHAGAALHCW S
Sbjct  169  VVALDFSENMLQHCNKFIKQE-GISKKNLILVRADVSRLPFVSSSIDAVHAGAALHCWSS  227

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISR+LRPGGVFVATT+I D I    P +R LR+ +   SG ++FL E EL+DL
Sbjct  228  PSAAVAEISRILRPGGVFVATTFIFDAIPIAVPVLRMLRKFYIGNSGKYMFLSEGELKDL  287

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV   CIRNR F+M+ A KPS
Sbjct  288  CQACGLVDVTCIRNRLFVMIAATKPS  313



>ref|XP_008790838.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=313

 Score =   192 bits (488),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 114/146 (78%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE MLQ C +FIKQE     +N+ILVRADI RLPF SSS+DAVHAGAALHCW S
Sbjct  169  VVALDFSENMLQHCNKFIKQE-GISKKNLILVRADICRLPFVSSSIDAVHAGAALHCWSS  227

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PSAAVAEISR+LRPGGVFVATT+I D I    P +R LR+ +   S ++IFL E EL+DL
Sbjct  228  PSAAVAEISRILRPGGVFVATTFIFDVIPIAVPVLRMLRKFYIGNSSNYIFLSEGELKDL  287

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLVG  CIR+R F+M++A+KP+
Sbjct  288  CEACGLVGVTCIRHRLFVMISAIKPN  313



>gb|KDO80930.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=334

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 105/146 (72%), Gaps = 17/146 (12%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++QE NFP +                 S+DAVHAGAA+HCW S
Sbjct  204  VVALDYSENMLKQCYEFVQQESNFPKD-----------------SIDAVHAGAAIHCWSS  246

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS  VAEISRVLRPGGVFV TTYIVDG ++  PF R LR+N  QISGS+ FL E+E+EDL
Sbjct  247  PSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQNMMQISGSYTFLSEREIEDL  306

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV FKC RNR F+M TA KPS
Sbjct  307  CRACGLVDFKCTRNRGFVMFTATKPS  332



>ref|XP_008790837.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=315

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 115/147 (78%), Gaps = 1/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEE-NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA DFSE MLQ C +FIKQE  +   EN+ILVRADI RLPF SSS+DAVHAGAALHCW 
Sbjct  169  VVALDFSENMLQHCNKFIKQEGISKKYENLILVRADICRLPFVSSSIDAVHAGAALHCWS  228

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPSAAVAEISR+LRPGGVFVATT+I D I    P +R LR+ +   S ++IFL E EL+D
Sbjct  229  SPSAAVAEISRILRPGGVFVATTFIFDVIPIAVPVLRMLRKFYIGNSSNYIFLSEGELKD  288

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            LC  CGLVG  CIR+R F+M++A+KP+
Sbjct  289  LCEACGLVGVTCIRHRLFVMISAIKPN  315



>ref|XP_009386973.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=353

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCYEFIKQ++     N+ LVRAD+SRLPFAS S+DAVHAGAALHCWPS
Sbjct  207  VVALDFSENMLRQCYEFIKQDDTLITTNLALVRADVSRLPFASGSIDAVHAGAALHCWPS  266

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF--VRPLRENFAQISGSHIFLDEKELE  372
            PS AVAEISRVLR GGVFVATT++V  + +  P    + LR++F Q++ S+ +  EKE+E
Sbjct  267  PSNAVAEISRVLRSGGVFVATTFLVSPLNTPLPLEAFQSLRQSFGQVTNSYNYFTEKEIE  326

Query  371  DLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            DLC +CGLV +     R FIM +A KP
Sbjct  327  DLCRSCGLVNYTSTVRRSFIMFSAQKP  353



>ref|XP_010928270.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=314

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QC+EFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAALHCWPS
Sbjct  168  VIALDFSENMLHQCFEFIKQDDTLSTMNLALVRADISRLPFASCSVDAIHAGAALHCWPS  227

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLR GGVFVATT++   + S  PF    +RPLR+ F Q + S+ +  EKE
Sbjct  228  PSNAVAEISRVLRSGGVFVATTFLSSPLNS--PFSSGALRPLRQFFGQENSSYNYFTEKE  285

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +EDLC +CGL+ +     R FIM +A KP
Sbjct  286  IEDLCKSCGLINYTSKVQRSFIMFSAQKP  314



>ref|XP_010928269.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=315

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QC+EFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAALHCWPS
Sbjct  169  VIALDFSENMLHQCFEFIKQDDTLSTMNLALVRADISRLPFASCSVDAIHAGAALHCWPS  228

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLR GGVFVATT++   + S  PF    +RPLR+ F Q + S+ +  EKE
Sbjct  229  PSNAVAEISRVLRSGGVFVATTFLSSPLNS--PFSSGALRPLRQFFGQENSSYNYFTEKE  286

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +EDLC +CGL+ +     R FIM +A KP
Sbjct  287  IEDLCKSCGLINYTSKVQRSFIMFSAQKP  315



>ref|XP_008788786.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Phoenix dactylifera]
Length=348

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QC+EFIKQ+E     N+ LVRADISRLPFAS SVDA+HAGAALHCWPS
Sbjct  202  VIALDFSENMLRQCFEFIKQDETLSTINLALVRADISRLPFASCSVDAIHAGAALHCWPS  261

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLR GGVFVATT++   + +  PF    +RPLR+ F Q + S+ +  EKE
Sbjct  262  PSNAVAEISRVLRSGGVFVATTFLSSPLNN--PFSSEALRPLRQFFGQENNSYNYFTEKE  319

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +EDLC +CGL+ +     R FIM +A KP
Sbjct  320  IEDLCKSCGLINYTSKVQRSFIMFSAQKP  348



>gb|AFW76188.1| hypothetical protein ZEAMMB73_680706 [Zea mays]
Length=206

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCYEFIKQ+++  N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPS
Sbjct  59   VIALDFSENMLRQCYEFIKQDDSLLNVNLALVRADISRLPFASCSVDAIHAGAAIHCWPS  118

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFV TT++        PF    +RPLR+    ++ S+ +  E E
Sbjct  119  PSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGE  176

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  177  LEDLCKSCGLVNYSSNVQRSFIMFSGQKP  205



>ref|XP_010928268.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=354

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QC+EFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAALHCWPS
Sbjct  208  VIALDFSENMLHQCFEFIKQDDTLSTMNLALVRADISRLPFASCSVDAIHAGAALHCWPS  267

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLR GGVFVATT++   + S  PF    +RPLR+ F Q + S+ +  EKE
Sbjct  268  PSNAVAEISRVLRSGGVFVATTFLSSPLNS--PFSSGALRPLRQFFGQENSSYNYFTEKE  325

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +EDLC +CGL+ +     R FIM +A KP
Sbjct  326  IEDLCKSCGLINYTSKVQRSFIMFSAQKP  354



>ref|XP_010928267.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=355

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QC+EFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAALHCWPS
Sbjct  209  VIALDFSENMLHQCFEFIKQDDTLSTMNLALVRADISRLPFASCSVDAIHAGAALHCWPS  268

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLR GGVFVATT++   + S  PF    +RPLR+ F Q + S+ +  EKE
Sbjct  269  PSNAVAEISRVLRSGGVFVATTFLSSPLNS--PFSSGALRPLRQFFGQENSSYNYFTEKE  326

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +EDLC +CGL+ +     R FIM +A KP
Sbjct  327  IEDLCKSCGLINYTSKVQRSFIMFSAQKP  355



>gb|KJB14720.1| hypothetical protein B456_002G140100, partial [Gossypium raimondii]
Length=386

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 111/150 (74%), Gaps = 11/150 (7%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYE  K      +  + LVRADISRLPF SSSVDA+HAGAALHCWPS
Sbjct  244  VVALDYSENMLRQCYEKRKT-----SPKMTLVRADISRLPFKSSSVDALHAGAALHCWPS  298

Query  545  PSAA----VAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKE  378
            PS A      ++ +VLRPGG+FVATTYI+DG   F PF+R   +N   I+GSH+FL E+E
Sbjct  299  PSTACLLYAGQLQQVLRPGGLFVATTYILDG--PFIPFLRTFHQNVMGIAGSHVFLSERE  356

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            LEDLC TCGL+GF CIRN  F+M++A K S
Sbjct  357  LEDLCRTCGLIGFTCIRNSCFVMISARKRS  386



>gb|EEE66113.1| hypothetical protein OsJ_22149 [Oryza sativa Japonica Group]
Length=237

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QCYEFI+Q++   N N+ LVRADISRLPFASSS+DA+HAGAA+HCWPS
Sbjct  91   VIALDFSENMLCQCYEFIQQDDTLVNTNLALVRADISRLPFASSSIDAIHAGAAIHCWPS  150

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFVATT++        PF    +RPLR+    ++ S+ +  E E
Sbjct  151  PSNAVAEISRVLRPGGVFVATTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGE  208

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  209  LEDLCKSCGLVNYSSKVQRSFIMFSGQKP  237



>gb|AAG52104.1|AC012680_15 hypothetical protein; 38642-36701 [Arabidopsis thaliana]
Length=317

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -1

Query  650  NENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIV  471
            +  ++LVRADI+RLPF S SVDAVHAGAALHCWPSPS+AVAEISRVLRPGGVFVATT+I 
Sbjct  197  SRKLVLVRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIY  256

Query  470  DGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            DG +SF PF++ LR+   + SGSHIFL+E+ELED+C  CGLV F  +RN  FIML+A KP
Sbjct  257  DGPFSFIPFLKNLRQEIMRYSGSHIFLNERELEDICKACGLVNFTRVRNGPFIMLSATKP  316

Query  290  S  288
            S
Sbjct  317  S  317



>ref|XP_003563313.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brachypodium distachyon]
Length=356

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCYE+IKQ++   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPS
Sbjct  209  VVALDFSENMLRQCYEYIKQDDTPLNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPS  268

Query  545  PSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFVATT++      G +S  P +RPLR+    ++ S+ F  E E
Sbjct  269  PSNAVAEISRVLRPGGVFVATTFLSTPTNSGPFSVGP-LRPLRQIVGPVNSSYNFFTEAE  327

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  328  LEDLCKSCGLVNYSSKVQRSFIMFSGQKP  356



>ref|XP_006659389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Oryza brachyantha]
Length=358

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 109/146 (75%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC EFIK EEN  +E + LVRADISRLPF S S+DAVHAGAA+HCWPS
Sbjct  214  VVALDFSENMLKQCNEFIK-EENISDEKLALVRADISRLPFVSGSIDAVHAGAAIHCWPS  272

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P+ AVAEISRVLRPGGVFVA+T++ D +    P +R  R   +Q +G++IFL E E EDL
Sbjct  273  PACAVAEISRVLRPGGVFVASTFVADILPPAVPVLRIGRPYISQFTGTNIFLSEVEFEDL  332

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV F  +RN  +IM +A K S
Sbjct  333  CRACGLVDFTFVRNGFYIMFSATKAS  358



>ref|XP_003574470.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
 ref|XP_010235114.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
Length=361

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC EFIKQE N  +E + LVRADISRLPF + S+D VHAGAALHCWPS
Sbjct  217  VVALDFSENMLKQCKEFIKQE-NISDERLALVRADISRLPFVNGSIDVVHAGAALHCWPS  275

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P+ AVAEISRVLRPGG+FVA+T++ D +    P +R  R    Q++G++ FL E ELEDL
Sbjct  276  PACAVAEISRVLRPGGIFVASTFVADVLPPVVPLLRIGRSYIGQLTGNNTFLSEAELEDL  335

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
            C  CGLV F  +RN  +I+ +A K
Sbjct  336  CKACGLVDFTFVRNGFYIIFSATK  359



>ref|XP_002445476.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
 gb|EES14971.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
Length=352

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 110/146 (75%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC E+IKQE N  +E + LVRADISRLPF S S+DAVHAGAA+HCWPS
Sbjct  208  VVALDFSENMLKQCNEYIKQE-NISDERLALVRADISRLPFVSGSIDAVHAGAAIHCWPS  266

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P+ AVA+ISRVLRPGGVFVA+T++ D I    P +R  R   +QI+G++ FL E E EDL
Sbjct  267  PACAVADISRVLRPGGVFVASTFVADVIPPVIPVLRIGRPYISQITGNNTFLSEVEFEDL  326

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV FK +R+  +IM +A K S
Sbjct  327  CKACGLVDFKFVRSGFYIMFSATKAS  352



>ref|NP_001150427.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 gb|ACG39054.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 tpg|DAA49108.1| TPA: S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=348

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC ++IKQE N  +E ++LVRADISRLPF S S+DA+HAGAA+HCWPS
Sbjct  204  VVALDFSENMLKQCNQYIKQE-NISDERLVLVRADISRLPFVSGSIDALHAGAAIHCWPS  262

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P+ AVA+ISRVLRPGG+FVA+T++ D I    P ++ +R   +QI+G++ FL E ELEDL
Sbjct  263  PACAVADISRVLRPGGIFVASTFVADVIPPAIPVLKIVRPYISQITGNNTFLSEVELEDL  322

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
            C  CGLV FK +R+  +IM +A K
Sbjct  323  CKACGLVDFKFVRSGFYIMFSATK  346



>ref|NP_001058196.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAD37452.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAD37605.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAF20110.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAG91023.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81074.1| hypothetical protein OsI_23892 [Oryza sativa Indica Group]
Length=345

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QCYEFI+Q++   N N+ LVRADISRLPFASSS+DA+HAGAA+HCWPS
Sbjct  199  VIALDFSENMLCQCYEFIQQDDTLVNTNLALVRADISRLPFASSSIDAIHAGAAIHCWPS  258

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFVATT++        PF    +RPLR+    ++ S+ +  E E
Sbjct  259  PSNAVAEISRVLRPGGVFVATTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGE  316

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  317  LEDLCKSCGLVNYSSKVQRSFIMFSGQKP  345



>dbj|BAJ94151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY++IKQEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPS
Sbjct  201  VIALDFSENMLRQCYDYIKQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPS  260

Query  545  PSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKE  378
            PS A+AEISRVL+PGGVFVATT++      G++S    ++PLR+    ++ S+ F  E E
Sbjct  261  PSNAIAEISRVLKPGGVFVATTFLSTPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFTEGE  319

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  320  LEDLCRSCGLVNYSSKVQRSFIMFSGQKP  348



>dbj|BAJ91607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY++IKQEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPS
Sbjct  201  VIALDFSENMLRQCYDYIKQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPS  260

Query  545  PSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKE  378
            PS A+AEISRVL+PGGVFVATT++      G++S    ++PLR+    ++ S+ F  E E
Sbjct  261  PSNAIAEISRVLKPGGVFVATTFLSTPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFTEGE  319

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  320  LEDLCRSCGLVNYSSKVQRSFIMFSGQKP  348



>ref|XP_002438745.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
 gb|EER90112.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
Length=352

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 107/149 (72%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCYEFIKQ++   N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPS
Sbjct  205  VIALDFSENMLRQCYEFIKQDDTLLNANLALVRADISRLPFASCSVDAIHAGAAIHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFV TT++        PF    +RPLR+    ++ S+ +  E E
Sbjct  265  PSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGE  322

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  323  LEDLCKSCGLVNYSSKVQRSFIMFSGQKP  351



>ref|XP_006657188.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Oryza brachyantha]
Length=353

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCYEFI+Q++   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPS
Sbjct  206  VIALDFSENMLRQCYEFIQQDDTLLNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPS  265

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFVATT++        PF    +RPLR+    ++ S+ +  E E
Sbjct  266  PSNAVAEISRVLRPGGVFVATTFLSSP--RNNPFSVEALRPLRQVVGPVNTSYNYFTEGE  323

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  324  LEDLCKSCGLVNYSSKVQRAFIMFSGQKP  352



>ref|NP_001061786.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAF23700.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAH00216.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 108/146 (74%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC E++KQE N  ++ + L RADISRLPF S S+DAVHA AA+HCWPS
Sbjct  214  VVALDFSENMLKQCNEYVKQE-NISDKTLALARADISRLPFVSGSIDAVHAAAAIHCWPS  272

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P+ AVAEISRVLRPGGVFVA+T++ D +    P +R  R   +Q +GS+IFL E E EDL
Sbjct  273  PACAVAEISRVLRPGGVFVASTFVADILPPAVPVLRIGRPYISQFTGSNIFLSEAEFEDL  332

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGL+ FK +RN  +IM +A K S
Sbjct  333  CRACGLIDFKFVRNGFYIMFSATKAS  358



>gb|ACG27569.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=344

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCYEFIKQ+++  N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPS
Sbjct  197  VIALDFSENMLRQCYEFIKQDDSLLNVNLALVRADISRLPFASCSVDAIHAGAAIHCWPS  256

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFV TT++        PF    +RPLR+    ++ S+ +  E E
Sbjct  257  PSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGE  314

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  315  LEDLCKSCGLVNYSSNVQRSFIMFSGQKP  343



>ref|XP_004973409.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Setaria italica]
Length=350

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 109/146 (75%), Gaps = 1/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC E++KQE N  +E + LVRADISRLPF + S+DAVHAGAA+HCWPS
Sbjct  206  VVALDFSENMLKQCNEYVKQE-NISDERLALVRADISRLPFVNGSIDAVHAGAAIHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            P+ AVAEISRVLR GG+FVA+T++ D I    P +R  R   +QI G++ FL E ELEDL
Sbjct  265  PACAVAEISRVLRSGGIFVASTFVADVIPPAIPILRIARPYISQIGGNNTFLSEVELEDL  324

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV FK +R+  +IM +A K S
Sbjct  325  CKACGLVDFKFVRSGFYIMFSATKAS  350



>gb|ACF85541.1| unknown [Zea mays]
 gb|ACF88073.1| unknown [Zea mays]
Length=346

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCYEFIKQ+++  N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPS
Sbjct  199  VIALDFSENMLRQCYEFIKQDDSLLNVNLALVRADISRLPFASCSVDAIHAGAAIHCWPS  258

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFV TT++        PF    +RPLR+    ++ S+ +  E E
Sbjct  259  PSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGE  316

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  317  LEDLCKSCGLVNYSSNVQRSFIMFSGQKP  345



>ref|XP_004965743.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Setaria italica]
Length=299

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 107/149 (72%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCYEFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAA+HCWPS
Sbjct  152  VIALDFSENMLRQCYEFIKQDDTLLKANLALVRADISRLPFASCSVDAIHAGAAIHCWPS  211

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFV TT++     +  PF    +RPLR+    ++ S+ +  E E
Sbjct  212  PSNAVAEISRVLRPGGVFVGTTFLSSPRNN--PFSVEALRPLRQIVGPVNTSYNYFTEGE  269

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  270  LEDLCKSCGLVNYSSKVQRSFIMFSGQKP  298



>ref|NP_001132053.1| uncharacterized LOC100193465 [Zea mays]
 gb|ACF80738.1| unknown [Zea mays]
 gb|AFW76186.1| LOW QUALITY PROTEIN: S-adenosylmethionine-dependent methyltransferase 
[Zea mays]
Length=356

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCYEFIKQ+++  N N+ LVRADISRLPFAS SVDA+HAGAA+HCWPS
Sbjct  209  VIALDFSENMLRQCYEFIKQDDSLLNVNLALVRADISRLPFASCSVDAIHAGAAIHCWPS  268

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFV TT++        PF    +RPLR+    ++ S+ +  E E
Sbjct  269  PSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGE  326

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  327  LEDLCKSCGLVNYSSNVQRSFIMFSGQKP  355



>gb|EMT30153.1| Putative methyltransferase [Aegilops tauschii]
Length=416

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 110/149 (74%), Gaps = 5/149 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY++IKQEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPS
Sbjct  269  VIALDFSENMLRQCYDYIKQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPS  328

Query  545  PSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKE  378
            PS A+AEISRVL+PGGVFVATT++      G++S    ++PLR+    ++ S+ F  E E
Sbjct  329  PSNAIAEISRVLKPGGVFVATTFLSTPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFTEGE  387

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  388  LEDLCRSCGLVNYSSKVQRSFIMFSGQKP  416



>gb|EMT07919.1| Putative methyltransferase [Aegilops tauschii]
Length=358

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY++I+QEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPS
Sbjct  211  VIALDFSENMLRQCYDYIRQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPS  270

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS A+AEISRVL+PGGVFVATT++     S  PF    +RPLR+    ++ S+ F  E E
Sbjct  271  PSNAIAEISRVLKPGGVFVATTFLSTPTNS-GPFSIDALRPLRQIVGPVNSSYNFFTEGE  329

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            L+DLC +CGLV +     R FIM +  KP
Sbjct  330  LKDLCISCGLVNYSSKVQRSFIMFSGQKP  358



>ref|XP_004488470.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cicer arietinum]
Length=346

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 108/146 (74%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC +FIK+++   + NI LVRAD+SRLPFAS SVDAVHAGAALHCWPS
Sbjct  206  VVALDFSENMLRQCNDFIKKDDTLSSTNIALVRADVSRLPFASGSVDAVHAGAALHCWPS  265

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+RVLR GGVFV TT++     S TP++ RP RE  +Q  G   FL E+E++D
Sbjct  266  PSNAVAEITRVLRSGGVFVGTTFLR--YTSSTPWILRPFRERTSQGYG---FLKEEEIKD  320

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  + C     FIM TA KP
Sbjct  321  LCTSCGLTNYSCKIQNSFIMFTAQKP  346



>ref|XP_004965742.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Setaria italica]
Length=354

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 106/149 (71%), Gaps = 6/149 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCYEFIKQ++     N+ LVRADISRLPFAS SVDA+HAGAA+HCWPS
Sbjct  207  VIALDFSENMLRQCYEFIKQDDTLLKANLALVRADISRLPFASCSVDAIHAGAAIHCWPS  266

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS AVAEISRVLRPGGVFV TT++        PF    +RPLR+    ++ S+ +  E E
Sbjct  267  PSNAVAEISRVLRPGGVFVGTTFLSSP--RNNPFSVEALRPLRQIVGPVNTSYNYFTEGE  324

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  325  LEDLCKSCGLVNYSSKVQRSFIMFSGQKP  353



>gb|EEE68668.1| hypothetical protein OsJ_27281 [Oryza sativa Japonica Group]
Length=369

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 108/156 (69%), Gaps = 10/156 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEE-------NFPNEN---IILVRADISRLPFASSSVDAVH  576
            VVA DFSE ML+QC E++KQE         FPN     + L RADISRLPF S S+DAVH
Sbjct  214  VVALDFSENMLKQCNEYVKQENISDKYGPQFPNHQHLTLALARADISRLPFVSGSIDAVH  273

Query  575  AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHI  396
            A AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D +    P +R  R   +Q +GS+I
Sbjct  274  AAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADILPPAVPVLRIGRPYISQFTGSNI  333

Query  395  FLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            FL E E EDLC  CGL+ FK +RN  +IM +A K S
Sbjct  334  FLSEAEFEDLCRACGLIDFKFVRNGFYIMFSATKAS  369



>ref|XP_004974685.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Setaria italica]
Length=323

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 109/146 (75%), Gaps = 2/146 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC E++ + EN  +E + LVRADISRLPF + S+DAVHAGAA+HCWPS
Sbjct  180  VVALDFSENMLKQCKEYV-EHENISDERLALVRADISRLPFVNGSIDAVHAGAAIHCWPS  238

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISRVLRPGGV VA+T++ D I    P +R  R   ++I+G +IFL E ELEDL
Sbjct  239  PSCAVAEISRVLRPGGVLVASTFVED-IPLAIPILRIGRPYISRITGMNIFLSEAELEDL  297

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV F+ +RN  +IM +A K S
Sbjct  298  CRACGLVDFEFVRNGFYIMFSATKAS  323



>ref|XP_003546595.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Glycine max]
 gb|KHN41316.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCYEFIK+++     NI LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  201  VIALDFSENMLRQCYEFIKKDDTLSTTNIALVRADVSRLPFPSGSVDAVHAGAALHCWPS  260

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+RVL+ GGVFV +T++     S TP F+RP RE   Q  G   +L E+E++D
Sbjct  261  PSNAVAEITRVLKSGGVFVGSTFLR--YSSLTPWFLRPFRERIPQGYG---YLTEEEIKD  315

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  +     + FIM TA KP
Sbjct  316  LCTSCGLTNYSSKIQQAFIMFTAQKP  341



>ref|XP_011470644.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=337

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 12/149 (8%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+F+K++      N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPS
Sbjct  197  VVALDFSENMLRQCYDFLKRDATLLATNLALVRADVSRLPFASGSVDAVHAGAALHCWPS  256

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKE  378
            PS AVAEI+RVLR GGVFV TT++      +TP    ++RP RE  AQ    + +L E+E
Sbjct  257  PSNAVAEITRVLRSGGVFVGTTFL-----RYTPTTPWYIRPFRERIAQ---GYSYLTEEE  308

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            ++DLCT+CGL  +     + FIM +A KP
Sbjct  309  IQDLCTSCGLTNYSSKVQQSFIMFSAQKP  337



>gb|EMT00494.1| Putative methyltransferase [Aegilops tauschii]
Length=493

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 109/149 (73%), Gaps = 5/149 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY++IKQEE   N N+ LVRADI RLPFAS S+DA+HAGAA+HCWPS
Sbjct  346  VIALDFSENMLRQCYDYIKQEETPMNTNLALVRADILRLPFASCSIDAIHAGAAIHCWPS  405

Query  545  PSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKE  378
            PS A+AEISRVL+PGGVFVATT++      G++S    ++PLR+    ++ S+ F  E E
Sbjct  406  PSNAIAEISRVLKPGGVFVATTFLSTPTNSGLFSIDA-LKPLRQIVGPVNSSYNFFIEGE  464

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  465  LEDLCRSCGLVNYSSKVQRSFIMFSRQKP  493



>ref|XP_011017926.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017927.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017928.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=336

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 107/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY++IKQ++     N+ LVRAD+SRLPFAS SVDAVHAGAA+HCWPS
Sbjct  196  VIALDFSENMLRQCYDYIKQDDTISTTNLGLVRADVSRLPFASGSVDAVHAGAAMHCWPS  255

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI RVLR GGVFV TT++     S TP + RP RE   +IS ++ F  E+E+ED
Sbjct  256  PSNAVAEICRVLRSGGVFVGTTFLR--YSSTTPRIERPFRE---RISRNYNFFTEEEIED  310

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LC+TCGL  +     R FIM +A KP
Sbjct  311  LCSTCGLTNYSKKVQRTFIMFSAQKP  336



>gb|KDP30197.1| hypothetical protein JCGZ_16979 [Jatropha curcas]
Length=345

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 8/148 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIKQ+    N N+ LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  203  VIALDFSENMLRQCYDFIKQDVTISNTNLALVRADVSRLPFPSGSVDAVHAGAALHCWPS  262

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP--FVRPLRENFAQISGSHIFLDEKELE  372
            PS A+AEI RVLR GGVFV TT++    YS T    +RP R+   +I  ++ +  E+E+E
Sbjct  263  PSNAIAEICRVLRSGGVFVGTTFLQ---YSATTSWILRPFRQ---RIQENYFYFTEEEIE  316

Query  371  DLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            DLCT+CGL  +K    + FIM +A KPS
Sbjct  317  DLCTSCGLTNYKSKVQQSFIMFSAEKPS  344



>ref|XP_010099510.1| putative methyltransferase [Morus notabilis]
 gb|EXB79361.1| putative methyltransferase [Morus notabilis]
Length=346

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 108/146 (74%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK++    N N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  206  VIALDFSENMLRQCYDFIKRDGALLNSNLALVRADVSRLPFSSGSVDAVHAGAALHCWPS  265

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELED  369
            P+ AVAEI+R+LR GG+FV TT++     S TP  VRPLR+   Q   ++ +L E+E+ED
Sbjct  266  PTNAVAEITRILRSGGIFVGTTFLR--YTSSTPLIVRPLRQRVLQ---NYNYLTEEEIED  320

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  +     + FIM +A KP
Sbjct  321  LCTSCGLTNYSSKVQQSFIMFSAQKP  346



>ref|XP_008348560.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=433

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML++CY FI+QEENFP EN+ILVRADISRLPFA+ SVDAVHAGAA+HCWPS
Sbjct  210  VVALDYSENMLKECYGFIQQEENFPKENMILVRADISRLPFATGSVDAVHAGAAIHCWPS  269

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSH  399
            PS AVAEISRVLRPGGVFVA+TYI+DG +S  PF+R + +   QI+GS 
Sbjct  270  PSTAVAEISRVLRPGGVFVASTYILDGPFSLIPFLRNITQRTKQIAGSE  318



>ref|XP_011470680.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=336

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 108/149 (72%), Gaps = 11/149 (7%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+F+K++      N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPS
Sbjct  195  VVALDFSENMLRQCYDFLKRDATLLATNLALVRADVSRLPFASGSVDAVHAGAALHCWPS  254

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKE  378
            PS AVAEI+RVLR GGVFV TT++      +TP    ++RP RE   +I+  + +L E+E
Sbjct  255  PSNAVAEITRVLRSGGVFVGTTFL-----RYTPTTPWYIRPFREQ--RIAQGYSYLTEEE  307

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            ++DLCT+CGL  +     + FIM +A KP
Sbjct  308  IQDLCTSCGLTNYSSKVQQSFIMFSAQKP  336



>ref|XP_004287240.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=338

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 108/149 (72%), Gaps = 11/149 (7%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+F+K++      N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPS
Sbjct  197  VVALDFSENMLRQCYDFLKRDATLLATNLALVRADVSRLPFASGSVDAVHAGAALHCWPS  256

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKE  378
            PS AVAEI+RVLR GGVFV TT++      +TP    ++RP RE   +I+  + +L E+E
Sbjct  257  PSNAVAEITRVLRSGGVFVGTTFL-----RYTPTTPWYIRPFREQ--RIAQGYSYLTEEE  309

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            ++DLCT+CGL  +     + FIM +A KP
Sbjct  310  IQDLCTSCGLTNYSSKVQQSFIMFSAQKP  338



>ref|XP_002531454.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
 gb|EEF30941.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
Length=290

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 105/146 (72%), Gaps = 4/146 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIKQ++N   +++ LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  148  VVALDFSENMLRQCYDFIKQDDNISEKDLALVRADVSRLPFSSGSVDAVHAGAALHCWPS  207

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEI R LR GGVFV TT++     S +   R  RE   +I   + +  E+E+EDL
Sbjct  208  PSNAIAEICRTLRSGGVFVGTTFLRYNATS-SWIERSFRE---RIMSGYNYYTEEEIEDL  263

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            CT+CGL  ++    R FIM TA KPS
Sbjct  264  CTSCGLTNYQSKVQRSFIMFTAEKPS  289



>ref|XP_006381066.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|ERP58863.1| methyltransferase-related family protein [Populus trichocarpa]
Length=308

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIKQ++     N+ LVRAD+SRLPFAS SVDA+HAGAALHCWPS
Sbjct  168  VIALDFSENMLRQCYDFIKQDDTISTRNLALVRADVSRLPFASGSVDAIHAGAALHCWPS  227

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
             S AVAEI R LR GGVFV TT++     S T ++ RP RE   Q   ++ +  E+E+ED
Sbjct  228  ASNAVAEICRALRSGGVFVGTTFL--QYSSTTSWIERPFRERIMQ---NYNYFTEEEIED  282

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCTTCGL  +  I  R FIM +A KP
Sbjct  283  LCTTCGLTNYTRIVQRSFIMFSAQKP  308



>emb|CDP10502.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 107/146 (73%), Gaps = 7/146 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML QCY+FIK +++  N N+ LVRADISRLPF S SVD VHAGAALHCWPS
Sbjct  196  VVALDFSENMLLQCYDFIKSDDSMLNSNLALVRADISRLPFPSGSVDGVHAGAALHCWPS  255

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+R+LR GGVFV TT++     S TP F+RPLR    Q   ++ +L E+E+ED
Sbjct  256  PSNAVAEINRILRSGGVFVGTTFLR--FSSSTPAFLRPLR----QAGRNYNYLTEEEIED  309

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +CT+CGL+ +     + FIM +A KP
Sbjct  310  VCTSCGLINYTSKVQQSFIMFSAQKP  335



>ref|XP_008374562.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Malus domestica]
Length=334

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML++CY FI+QEENFP EN ILVRADISRLPFA+SSVDAVHAGAALHCWPS
Sbjct  210  VVALDYSENMLKECYGFIQQEENFPKENXILVRADISRLPFATSSVDAVHAGAALHCWPS  269

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR  438
            PSAAVAEISRVLRPGGVFVA+TYI+DG +S  PF+R
Sbjct  270  PSAAVAEISRVLRPGGVFVASTYILDGRFSLIPFLR  305



>gb|KEH37884.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=277

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK+++     N+ LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  137  VIALDFSENMLRQCYDFIKKDDTLSTTNLALVRADVSRLPFESGSVDAVHAGAALHCWPS  196

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+RVLR GGVFV TT++     S T +V R  RE   + S  + +L E+E++D
Sbjct  197  PSNAVAEITRVLRSGGVFVGTTFLR--YTSSTSWVARLFRE---RSSLGYGYLTEEEIKD  251

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  + C   + FIM TA KP
Sbjct  252  LCTSCGLTNYSCKIQKSFIMFTAQKP  277



>ref|XP_011020252.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=338

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIKQ++     N+ LVRAD+SRLPFAS SVDA+HAGAALHCWPS
Sbjct  198  VIALDFSENMLRQCYDFIKQDDTISTRNLALVRADVSRLPFASGSVDAIHAGAALHCWPS  257

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
             S AVAEI R LR GGVFV TT++     S T ++ RP RE   Q   ++ +  E+E+ED
Sbjct  258  ASNAVAEICRALRSGGVFVGTTFL--QYSSTTSWIERPFRERIMQ---NYNYFTEEEIED  312

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCTTCGL  +  I  R FIM +A KP
Sbjct  313  LCTTCGLTNYTRIVQRSFIMFSAQKP  338



>ref|XP_011078555.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Sesamum indicum]
Length=338

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 109/146 (75%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK ++   + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  198  VIALDFSENMLRQCYDFIKNDDAILSSNLALVRADVSRLPFPSGSVDAVHAGAALHCWPS  257

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+R+LR GGVFV +T++   I S TP  +RP R+   +I+  + +L E+E+ED
Sbjct  258  PSNAVAEINRILRSGGVFVGSTFLR--ISSSTPILLRPFRQ---RITNDYNYLTEEEIED  312

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGLV +     + FIM +A KP
Sbjct  313  LCTSCGLVNYSKKVQQSFIMFSAEKP  338



>ref|XP_006586686.1| PREDICTED: uncharacterized protein LOC100798970 isoform X1 [Glycine 
max]
Length=336

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FI++++     NI LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  196  VIALDFSENMLRQCYDFIEKDDTLSTNNIALVRADVSRLPFSSGSVDAVHAGAALHCWPS  255

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+R L+ GGVFV +T++     S TP F+RP RE   Q  G   +L E+E++D
Sbjct  256  PSNAVAEITRTLKNGGVFVGSTFLR--YSSKTPWFLRPFRERTPQGYG---YLTEEEIKD  310

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  +     + FIM TA KP
Sbjct  311  LCTSCGLTNYSSKIQQAFIMFTAQKP  336



>gb|KHN28439.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FI++++     NI LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  201  VIALDFSENMLRQCYDFIEKDDTLSTNNIALVRADVSRLPFSSGSVDAVHAGAALHCWPS  260

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+R L+ GGVFV +T++     S TP F+RP RE   Q  G   +L E+E++D
Sbjct  261  PSNAVAEITRTLKNGGVFVGSTFLR--YSSKTPWFLRPFRERTPQGYG---YLTEEEIKD  315

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  +     + FIM TA KP
Sbjct  316  LCTSCGLTNYSSKIQQAFIMFTAQKP  341



>ref|XP_002324579.2| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEF03144.2| methyltransferase-related family protein [Populus trichocarpa]
Length=332

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY++IKQ++     N+ L+RAD+SRLPFAS SVDAVHAGAA+HCWPS
Sbjct  192  VIALDFSENMLRQCYDYIKQDDTISTTNLGLIRADVSRLPFASGSVDAVHAGAAMHCWPS  251

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI RVLR GGVFV TT++     S TP + RP RE   +IS +  F  E+E+ED
Sbjct  252  PSNAVAEICRVLRSGGVFVGTTFLR--YSSTTPRIERPFRE---RISRNSNFFTEEEIED  306

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LC+TCGL  +     + FIM +A KP
Sbjct  307  LCSTCGLTNYSKKVQQTFIMFSAQKP  332



>gb|EYU34934.1| hypothetical protein MIMGU_mgv1a009522mg [Erythranthe guttata]
Length=339

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 113/147 (77%), Gaps = 7/147 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC++FIK ++   N N+ LVRAD+SRLPFAS SVDAVHAGAALHCWPS
Sbjct  198  VVALDFSENMLRQCFDFIKNDDAILNSNLALVRADVSRLPFASGSVDAVHAGAALHCWPS  257

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPL-RENFAQISGSHIFLDEKELE  372
            PS A+AEI+R+LR GGVFV +T++   + S TP ++RPL RE   +I+ ++ +L E+E+E
Sbjct  258  PSNAIAEINRILRSGGVFVGSTFLR--VSSSTPTWLRPLIRE---RITSNYNYLTEEEIE  312

Query  371  DLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            ++C +CGLV +  I  + FIM +A KP
Sbjct  313  EVCKSCGLVNYTKIVQQSFIMFSAQKP  339



>ref|NP_001242875.1| uncharacterized protein LOC100798970 [Glycine max]
 gb|ACU18789.1| unknown [Glycine max]
Length=341

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FI++++     NI LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  201  VIALDFSENMLRQCYDFIEKDDALSTNNIALVRADVSRLPFSSGSVDAVHAGAALHCWPS  260

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+R L+ GGVFV +T++     S TP F+RP RE   Q  G   +L E+E++D
Sbjct  261  PSNAVAEITRTLKNGGVFVGSTFLR--YSSKTPWFLRPFRERTPQGYG---YLTEEEIKD  315

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  +     + FIM TA KP
Sbjct  316  LCTSCGLTNYSSKIQQAFIMFTAQKP  341



>gb|ACJ84583.1| unknown [Medicago truncatula]
 gb|KEH37883.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK+++     N+ LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  202  VIALDFSENMLRQCYDFIKKDDTLSTTNLALVRADVSRLPFESGSVDAVHAGAALHCWPS  261

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+RVLR GGVFV TT++     S T +V R  RE   + S  + +L E+E++D
Sbjct  262  PSNAVAEITRVLRSGGVFVGTTFLR--YTSSTSWVARLFRE---RSSLGYGYLTEEEIKD  316

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  + C   + FIM TA KP
Sbjct  317  LCTSCGLTNYSCKIQKSFIMFTAQKP  342



>ref|XP_008456635.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Cucumis melo]
Length=338

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QCY+FIK++    N N+ LVRADISRLPF+S SVDAVHAGAALHCWPS
Sbjct  198  VIALDFSENMLLQCYDFIKKDATLLNSNLALVRADISRLPFSSGSVDAVHAGAALHCWPS  257

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            PS A+AEI+R++R GGVFV TT++     S TP ++R LRE   Q  G   +L E+E+E+
Sbjct  258  PSNAIAEITRIMRSGGVFVGTTFLR--YTSSTPWYLRFLRERGFQPYG---YLTEEEIEE  312

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LC +CGL+ +     R FIM +A KP
Sbjct  313  LCKSCGLINYSSKVQRSFIMFSAQKP  338



>gb|EMT14235.1| Putative methyltransferase [Aegilops tauschii]
Length=465

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 102/133 (77%), Gaps = 5/133 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY++IKQEE   N N+ LVRADISRLPFAS S+DA+HAGAA+HCWPS
Sbjct  184  VIALDFSENMLRQCYDYIKQEETPMNTNLALVRADISRLPFASCSIDAIHAGAAIHCWPS  243

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF----VRPLRENFAQISGSHIFLDEKE  378
            PS A+AEISRVL+PGGVFVATT++     S  PF    +RPLR+    ++ S+ F  E E
Sbjct  244  PSNAIAEISRVLKPGGVFVATTFLSTPTNS-GPFSIDALRPLRQIVGPVNSSYNFFTEGE  302

Query  377  LEDLCTTCGLVGF  339
            LEDLC +CGLV +
Sbjct  303  LEDLCRSCGLVNY  315



>ref|XP_008242913.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic, 
partial [Prunus mume]
Length=263

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 105/146 (72%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+F+K++      N+ LVRAD+SRLPF S S+ AVHAGAALHCWPS
Sbjct  123  VVALDFSENMLRQCYDFLKKDPTLLATNLALVRADVSRLPFPSGSIGAVHAGAALHCWPS  182

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
            PS A+AEISR+LR GG+FV TT++     S TP++ RPLRE   Q    + +L E+E+ED
Sbjct  183  PSNAIAEISRILRSGGIFVGTTFLR--YTSSTPWILRPLRERALQ---DYSYLTEEEIED  237

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+ GL+ +     + FIM +A KP
Sbjct  238  LCTSSGLINYSSKVQQSFIMFSAQKP  263



>gb|AFK46366.1| unknown [Medicago truncatula]
Length=342

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 105/146 (72%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK+++     N+ LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  202  VIALDFSENMLRQCYDFIKKDDTLSTTNLALVRADVSRLPFESGSVDAVHAGAALHCWPS  261

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
            PS AVAEI+RVLR GGVFV TT+      S T +V R  RE   + S  + +L E+E++D
Sbjct  262  PSNAVAEITRVLRSGGVFVGTTFFR--YTSSTSWVARLFRE---RSSLGYGYLTEEEIKD  316

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  + C   + FIM TA KP
Sbjct  317  LCTSCGLTNYSCKIQKSFIMFTAQKP  342



>ref|XP_010050326.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=350

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 12/149 (8%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML QCY+FIKQ++     N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  210  VIALDYSENMLCQCYDFIKQDDAVLKANLALVRADVSRLPFSSGSVDAVHAGAALHCWPS  269

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKE  378
            PS A+AEISRVLR GGVFV TT++      +TP     ++P R+  +Q   ++ FL  +E
Sbjct  270  PSNAIAEISRVLRSGGVFVGTTFL-----RYTPSTPWIIQPFRQRASQ---NYSFLTAEE  321

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +EDLCT+CGL  +     + FIM +A KP
Sbjct  322  IEDLCTSCGLTNYTSKTQQSFIMFSAQKP  350



>gb|KDO80933.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=362

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW S
Sbjct  204  VVALDYSENMLKQCYEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSS  263

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRE  426
            PS  VAEISRVLRPGGVFV TTYIVDG ++  PF R LR+
Sbjct  264  PSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQ  303



>gb|KJB53960.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=300

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 105/146 (72%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QC +FIKQ+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPS
Sbjct  160  VIALDFSENMLRQCNDFIKQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPS  219

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELED  369
            PS A+AEISR+LR GGVFV +T++     S TP+ +RP RE   Q   S+ +L E+E+E+
Sbjct  220  PSNAIAEISRILRSGGVFVGSTFLR--YTSSTPWIIRPFRERVMQ---SYNYLTEEEIEE  274

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +CT  GL  F     R FIM +A KP
Sbjct  275  VCTNSGLTNFSKKVQRSFIMFSAQKP  300



>ref|XP_002268107.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Vitis vinifera]
 emb|CBI25579.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 107/147 (73%), Gaps = 4/147 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEE-NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA DFSE ML+QCY+FIK+E       N+ LVRAD+SRLPF++ SVDAVHAGAALHCWP
Sbjct  197  VVALDFSENMLRQCYDFIKKENPALATTNLALVRADVSRLPFSTGSVDAVHAGAALHCWP  256

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVD--GIYSFTPFVRPLRENFAQISGSHIFLDEKEL  375
            SPS AVAEI+R+LR GG+FV TT++    G  S T  +RP R+ + +   ++  L EKE+
Sbjct  257  SPSNAVAEITRILRSGGIFVGTTFLRPSFGNSSITSILRPFRQ-WERSLQNYNNLTEKEI  315

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMK  294
            EDLCT+CGL+ ++    R FIM +A K
Sbjct  316  EDLCTSCGLINYRSKVQRSFIMFSAQK  342



>ref|XP_004139262.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cucumis sativus]
Length=338

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QCY+FIK++    N N+ LVRADISRLPF+S SVDAVHAGAALHCWPS
Sbjct  198  VIALDFSENMLLQCYDFIKKDATLLNSNLALVRADISRLPFSSGSVDAVHAGAALHCWPS  257

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEI+R++R GGVFV TT++     S   ++R LRE   Q  G   +L E+E+E+L
Sbjct  258  PSNAIAEITRIMRSGGVFVGTTFL-RYTSSTLWYLRFLRERGFQPYG---YLTEEEIEEL  313

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            C +CGL+ +     R FIM +A KP
Sbjct  314  CKSCGLINYSSKVQRSFIMFSAQKP  338



>ref|XP_002988667.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
 gb|EFJ10178.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
Length=269

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 103/144 (72%), Gaps = 9/144 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE+ML+QC EF+KQ+++    +I LVRAD+ RLPFAS +V A+HAGAALHCWPS
Sbjct  135  VIALDFSESMLRQCAEFVKQDKSLRTADIALVRADVIRLPFASGTVSAIHAGAALHCWPS  194

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS+AVAEI RVL+PGGVFVATT++ + I+ F P  R         S S  +  EKELE+L
Sbjct  195  PSSAVAEICRVLKPGGVFVATTFLSNSIFPFLPQRR---------SSSLRYWTEKELEEL  245

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
            C  CGLV ++      FIMLTA K
Sbjct  246  CKLCGLVDYQKKIKGNFIMLTARK  269



>ref|XP_004167998.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At2g41040, chloroplastic-like [Cucumis sativus]
Length=338

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QCY+FIK++    N N+ LVRADISRLPF+S SVD VHAGAALHCWPS
Sbjct  198  VIALDFSENMLLQCYDFIKKDATLLNSNLALVRADISRLPFSSGSVDGVHAGAALHCWPS  257

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            PS A+AEI+R++R GGVFV TT+      S TP ++R LRE   Q  G   +L E+E+E+
Sbjct  258  PSNAIAEITRIMRSGGVFVGTTFXR--YTSSTPWYLRFLRERGFQPYG---YLTEEEIEE  312

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LC +CGL+ +     R FIM +A KP
Sbjct  313  LCKSCGLINYSSKVQRSFIMFSAQKP  338



>gb|KJB53958.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=343

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 105/146 (72%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QC +FIKQ+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPS
Sbjct  203  VIALDFSENMLRQCNDFIKQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPS  262

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELED  369
            PS A+AEISR+LR GGVFV +T++     S TP+ +RP RE   Q   S+ +L E+E+E+
Sbjct  263  PSNAIAEISRILRSGGVFVGSTFLR--YTSSTPWIIRPFRERVMQ---SYNYLTEEEIEE  317

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +CT  GL  F     R FIM +A KP
Sbjct  318  VCTNSGLTNFSKKVQRSFIMFSAQKP  343



>ref|XP_008456627.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Cucumis melo]
Length=339

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 7/147 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QCY+FIK++    N N+ LVRADISRLPF+S SVDAVHAGAALHCWPS
Sbjct  198  VIALDFSENMLLQCYDFIKKDATLLNSNLALVRADISRLPFSSGSVDAVHAGAALHCWPS  257

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFA-QISGSHIFLDEKELE  372
            PS A+AEI+R++R GGVFV TT++     S TP ++R LRE    Q  G   +L E+E+E
Sbjct  258  PSNAIAEITRIMRSGGVFVGTTFLR--YTSSTPWYLRFLREQRGFQPYG---YLTEEEIE  312

Query  371  DLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +LC +CGL+ +     R FIM +A KP
Sbjct  313  ELCKSCGLINYSSKVQRSFIMFSAQKP  339



>emb|CBI25578.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 103/147 (70%), Gaps = 7/147 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML QCY+FIK++      N+ LVRADISRLPF+S SVDAVHAGAALHCWPS
Sbjct  195  VVALDFSENMLHQCYDFIKKDNPSLTTNLALVRADISRLPFSSGSVDAVHAGAALHCWPS  254

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIY---SFTPFVRPLRENFAQISGSHIFLDEKEL  375
            PS AVAEI+R+LR GG+FV TT++   IY   S    +RP R++  Q S    +L EKE+
Sbjct  255  PSNAVAEITRILRSGGIFVGTTFLRP-IYTNSSIPAILRPFRQSILQTSN---YLTEKEI  310

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMK  294
            EDLC +C L+ +     + FIM +A K
Sbjct  311  EDLCRSCALINYTSTIQQSFIMFSAQK  337



>ref|XP_002268200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=340

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 103/147 (70%), Gaps = 7/147 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML QCY+FIK++      N+ LVRADISRLPF+S SVDAVHAGAALHCWPS
Sbjct  197  VVALDFSENMLHQCYDFIKKDNPSLTTNLALVRADISRLPFSSGSVDAVHAGAALHCWPS  256

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIY---SFTPFVRPLRENFAQISGSHIFLDEKEL  375
            PS AVAEI+R+LR GG+FV TT++   IY   S    +RP R++  Q S    +L EKE+
Sbjct  257  PSNAVAEITRILRSGGIFVGTTFLRP-IYTNSSIPAILRPFRQSILQTSN---YLTEKEI  312

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMK  294
            EDLC +C L+ +     + FIM +A K
Sbjct  313  EDLCRSCALINYTSTIQQSFIMFSAQK  339



>gb|KDO59313.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
 gb|KDO59314.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=333

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 101/145 (70%), Gaps = 4/145 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPS
Sbjct  193  VVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPS  252

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISR+LR GGVFV TT++     S +   R LRE   Q   ++ +L E+E+EDL
Sbjct  253  PSNAVAEISRILRSGGVFVGTTFL-RYTSSTSLTGRVLRERILQ---NYNYLTEEEIEDL  308

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            CT+CGL  +     + FIM  A KP
Sbjct  309  CTSCGLTNYTSKVQQSFIMFAAQKP  333



>ref|XP_006453728.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
 gb|ESR66968.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
Length=333

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 101/145 (70%), Gaps = 4/145 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPS
Sbjct  193  VVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPS  252

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISR+LR GGVFV TT++     S +   R LRE   Q   ++ +L E+E+EDL
Sbjct  253  PSNAVAEISRILRSGGVFVGTTFL-RYTSSTSLTGRVLRERILQ---NYNYLTEEEIEDL  308

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            CT+CGL  +     + FIM  A KP
Sbjct  309  CTSCGLTNYTSKVQQSFIMFAAQKP  333



>ref|XP_002986403.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
 gb|EFJ12612.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
Length=340

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 103/144 (72%), Gaps = 9/144 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE+ML+QC EF+KQ+++    +I LVRAD+ RLPFAS +V A+HAGAALHCWPS
Sbjct  205  VIALDFSESMLRQCAEFVKQDKSLRTADIALVRADVIRLPFASGTVSAIHAGAALHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS+AVAEI RVL+PGGVFVATT++ + I+ F P  R         S S  +  EKELE+L
Sbjct  265  PSSAVAEICRVLKPGGVFVATTFLSNSIFPFLPQRR---------SSSLRYWTEKELEEL  315

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
            C  CGLV ++      FIMLTA K
Sbjct  316  CKLCGLVDYQKKIKGNFIMLTARK  339



>gb|KDO59312.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=328

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 101/145 (70%), Gaps = 4/145 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPS
Sbjct  188  VVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPS  247

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS AVAEISR+LR GGVFV TT++     S +   R LRE   Q   ++ +L E+E+EDL
Sbjct  248  PSNAVAEISRILRSGGVFVGTTFL-RYTSSTSLTGRVLRERILQ---NYNYLTEEEIEDL  303

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
            CT+CGL  +     + FIM  A KP
Sbjct  304  CTSCGLTNYTSKVQQSFIMFAAQKP  328



>ref|XP_007202300.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
 gb|EMJ03499.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
Length=352

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+F+K++      N+ LVRAD+SRLPF S SV AVHAGAALHCWPS
Sbjct  212  VVALDFSENMLRQCYDFLKKDPTLLATNLALVRADVSRLPFPSGSVGAVHAGAALHCWPS  271

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
            PS A+AEISR+LR GG+FV TT++     S TP++ RPLRE   Q   ++ +L E+E+ED
Sbjct  272  PSNAIAEISRILRTGGIFVGTTFLR--YTSSTPWILRPLRERALQ---NYSYLTEEEIED  326

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+ GL+ +     + FIM +A KP
Sbjct  327  LCTSSGLINYSSKVQQSFIMFSAQKP  352



>ref|XP_009602551.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Nicotiana tomentosiformis]
Length=181

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 103/145 (71%), Gaps = 4/145 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK +E+  + N+ LVRAD+SRLPF S S+DAVHAGAALHCWPS
Sbjct  41   VIALDFSENMLRQCYDFIKNDESILSSNLALVRADVSRLPFFSGSIDAVHAGAALHCWPS  100

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEI+RVLR GGVFV TT++     + T F R L ++  +   ++ +   +E+EDL
Sbjct  101  PSNAIAEINRVLRSGGVFVGTTFLRVNPSAPTIF-RALEQSAGR---TYSYFTREEIEDL  156

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
             TTCGL+ +       FIM +A KP
Sbjct  157  VTTCGLINYTSKVQNSFIMFSAQKP  181



>gb|KHG21340.1| hypothetical protein F383_03824 [Gossypium arboreum]
Length=394

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 105/146 (72%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QC +FIKQ+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPS
Sbjct  254  VIALDFSENMLRQCNDFIKQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPS  313

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELED  369
            PS A+AEISR+LR GGVFV +T++     S TP+ +RP RE   Q   S+ +L E+E+E+
Sbjct  314  PSNAIAEISRILRSGGVFVGSTFL--RYTSSTPWIIRPFRERVMQ---SYNYLTEEEIEE  368

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +CT  GL  F     R FIM +A KP
Sbjct  369  VCTNSGLTNFSKKVQRSFIMFSAQKP  394



>ref|XP_007013645.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY31264.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=340

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 106/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QC +FI+Q+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPS
Sbjct  200  VIALDFSENMLRQCNDFIEQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPS  259

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPF-VRPLRENFAQISGSHIFLDEKELED  369
             S AVAEISR+LR GGVFV +T++     S TP+ VRP RE   Q   ++ +L E+E+ED
Sbjct  260  TSNAVAEISRILRSGGVFVGSTFLR--YSSTTPWIVRPFRERILQ---NYNYLTEEEIED  314

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +CT+CGL  F     + FIM +A KP
Sbjct  315  VCTSCGLTNFTKKVQQSFIMFSAQKP  340



>ref|XP_008336947.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336948.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336949.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
Length=325

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 107/148 (72%), Gaps = 6/148 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQE-ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA DFSE+ML+QCY F+K +  +    N+ LVRAD+SRLPFAS SVDAVHAGAALHCWP
Sbjct  181  VVALDFSESMLRQCYNFLKADPASLFATNLGLVRADVSRLPFASGSVDAVHAGAALHCWP  240

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELE  372
            SPS AVAEI+R+LR G +FV TT++    Y  TP++ +P RE  ++ S S  +L E+E+E
Sbjct  241  SPSNAVAEITRILRSGAIFVGTTFLRSSPY--TPWIFKPFREKMSRSSNS--YLTEREIE  296

Query  371  DLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            DLC +CGL  +     + FIM +A KP+
Sbjct  297  DLCRSCGLTNYSSKVQQSFIMFSARKPA  324



>ref|XP_006473930.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=333

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 102/146 (70%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPS
Sbjct  193  VVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPS  252

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELED  369
            PS AVAEISR+L+ GGVFV TT++     S T  + R LRE   Q   ++ +L E+E+ED
Sbjct  253  PSNAVAEISRILQSGGVFVGTTFLR--YTSSTSLIGRVLRERILQ---NYNYLTEEEIED  307

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  +     + FIM  A KP
Sbjct  308  LCTSCGLTNYTSKVQQSFIMFAAQKP  333



>gb|KGN60753.1| hypothetical protein Csa_2G009410 [Cucumis sativus]
Length=339

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 5/146 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML QCY+FIK++    N N+ LVRADISRLPF+S SVDAVHAGAALHCWPS
Sbjct  198  VIALDFSENMLLQCYDFIKKDATLLNSNLALVRADISRLPFSSGSVDAVHAGAALHCWPS  257

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFA-QISGSHIFLDEKELED  369
            PS A+AEI+R++R GGVFV TT++     S   ++R LRE    Q  G   +L E+E+E+
Sbjct  258  PSNAIAEITRIMRSGGVFVGTTFL-RYTSSTLWYLRFLREQRGFQPYG---YLTEEEIEE  313

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LC +CGL+ +     R FIM +A KP
Sbjct  314  LCKSCGLINYSSKVQRSFIMFSAQKP  339



>ref|XP_009802104.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Nicotiana sylvestris]
Length=345

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIK +E+  + N+ LVRAD+SRLPF S S+DAVHAGAALHCWPS
Sbjct  205  VVALDFSENMLRQCYDFIKNDESILSSNLALVRADVSRLPFFSGSIDAVHAGAALHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEI+R+LR GGVFV TT++     + T F R L +N  +   ++ +  ++E+EDL
Sbjct  265  PSNAIAEINRILRSGGVFVGTTFLRVNPSAPTIF-RALEQNVGR---TYSYFTQEEIEDL  320

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKP  291
             TTCGL+ +       FIM +A KP
Sbjct  321  VTTCGLINYTSKVQNSFIMFSAQKP  345



>ref|XP_010047200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79025.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=336

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 12/149 (8%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+  D+SE ML+QCY+FIKQ++     N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  196  VIPLDYSENMLRQCYDFIKQDDAVLKANLALVRADVSRLPFSSCSVDAVHAGAALHCWPS  255

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKE  378
            PS A+AEI+RVLR GGVFV TT++      +TP     + P R+  AQ   ++ +L  +E
Sbjct  256  PSNAIAEITRVLRSGGVFVGTTFL-----RYTPSTPWIILPFRQRTAQ---NYSYLTAEE  307

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +EDLCT+CGL  +     + FIM +A KP
Sbjct  308  IEDLCTSCGLTNYTRKIQQSFIMFSAQKP  336



>ref|XP_010533098.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Tarenaya hassleriana]
Length=345

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 102/146 (70%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QC +FIKQ+    + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  205  VVALDFSENMLRQCNDFIKQDNTLSSTNLALVRADVSRLPFPSGSVDAVHAGAALHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            P+ A+AEISRVLR GGVFV TT++     + TP F+RP RE   Q   ++ +L   E++D
Sbjct  265  PTNAIAEISRVLRSGGVFVGTTFL--RYNASTPWFIRPFRERILQ---NYNYLLRDEIKD  319

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +CT+CGL  +       FIM  A KP
Sbjct  320  VCTSCGLTNYSDDVRSSFIMFAAQKP  345



>ref|XP_010687777.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=339

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 107/146 (73%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+F K+E    + N+ LVRAD++RLPF S+S+DAVHAGAALHCWPS
Sbjct  199  VIALDFSENMLRQCYDFTKKEGPALSNNLALVRADVARLPFPSASIDAVHAGAALHCWPS  258

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            PS+A+A+I+RVLR GGVFV TT++     + TP  +RPLRE   Q   ++ +L E+E+E 
Sbjct  259  PSSAIADITRVLRSGGVFVGTTFLR--YTASTPSLLRPLRERILQ---TYSYLIEEEIEA  313

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LC +CGLV +     + FIM +A KP
Sbjct  314  LCKSCGLVDYSSKVQQSFIMFSARKP  339



>ref|XP_008344066.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=327

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 102/149 (68%), Gaps = 12/149 (8%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+Q YEF K++    + N+ LVRAD++RLPF S SVDAVHAGAALHCWPS
Sbjct  187  VVALDFSENMLRQSYEFFKRDPTJLDTNLALVRADVARLPFPSGSVDAVHAGAALHCWPS  246

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKE  378
            PS A+AEI+R+LR GGVFV TT++      +TP      R LRE+  Q    + +L E+E
Sbjct  247  PSNAIAEITRILRSGGVFVGTTFL-----RYTPSTPWITRQLRESALQ---GYNYLTEEE  298

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +EDLC +CGL  +     + FIM +A KP
Sbjct  299  IEDLCASCGLTNYTSNVQQAFIMFSAQKP  327



>ref|XP_008336950.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Malus domestica]
Length=324

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 7/148 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQE-ENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA DFSE+ML+QCY F+K +  +    N+ LVRAD+SRLPFAS SVDAVHAGAALHCWP
Sbjct  181  VVALDFSESMLRQCYNFLKADPASLFATNLGLVRADVSRLPFASGSVDAVHAGAALHCWP  240

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV-RPLRENFAQISGSHIFLDEKELE  372
            SPS AVAEI+R+LR G +FV TT++    Y  TP++ +P RE       S+ +L E+E+E
Sbjct  241  SPSNAVAEITRILRSGAIFVGTTFLRSSPY--TPWIFKPFRE---MSRSSNSYLTEREIE  295

Query  371  DLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            DLC +CGL  +     + FIM +A KP+
Sbjct  296  DLCRSCGLTNYSSKVQQSFIMFSARKPA  323



>ref|XP_010656529.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=343

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 105/152 (69%), Gaps = 14/152 (9%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN-----ENIILVRADISRLPFASSSVDAVHAGAAL  561
            VVA DFSE ML QCY+FIK++   P+      N+ LVRADISRLPF+S SVDAVHAGAAL
Sbjct  197  VVALDFSENMLHQCYDFIKKDN--PSLTTMCSNLALVRADISRLPFSSGSVDAVHAGAAL  254

Query  560  HCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIY---SFTPFVRPLRENFAQISGSHIFL  390
            HCWPSPS AVAEI+R+LR GG+FV TT++   IY   S    +RP R++  Q S    +L
Sbjct  255  HCWPSPSNAVAEITRILRSGGIFVGTTFLRP-IYTNSSIPAILRPFRQSILQTSN---YL  310

Query  389  DEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  294
             EKE+EDLC +C L+ +     + FIM +A K
Sbjct  311  TEKEIEDLCRSCALINYTSTIQQSFIMFSAQK  342



>ref|XP_009338403.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=345

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+Q YEF K++    + N+ LVRAD++RLPF+S SVDAVHAGAALHCWPS
Sbjct  205  VVALDFSENMLRQSYEFFKRDPTLLDTNLALVRADVARLPFSSGSVDAVHAGAALHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV----RPLRENFAQISGSHIFLDEKE  378
            PS A+AEI+R+LR GGVFV TT++      +TP      R LRE   Q   S+ +L E+E
Sbjct  265  PSNAIAEITRILRSGGVFVGTTFL-----RYTPSTSWIPRQLRERARQ---SYNYLTEEE  316

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            + DLCT+CGL  +     + FIM +A KP
Sbjct  317  IADLCTSCGLTNYTSNVQQSFIMFSAQKP  345



>ref|XP_006852799.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
 gb|ERN14266.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
Length=343

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK ++   N N+ LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  179  VIALDFSENMLRQCYDFIKNDDTLLNANLALVRADVSRLPFPSCSVDAVHAGAALHCWPS  238

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP--FVRPLRENFAQISGSHIFLDEKELE  372
            PS AVAEI R+LRPGGVFVATT++      + P   +RPLR+    ++ ++ +L EKE+E
Sbjct  239  PSNAVAEICRILRPGGVFVATTFLSSVFSDYLPSDVLRPLRQAVQPLANTYSYLTEKEIE  298

Query  371  DLCTTCG  351
            DLC   G
Sbjct  299  DLCLEPG  305



>ref|XP_009358530.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=345

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+Q YEF K++    + N+ LVRAD++RLPF+S SVDAVHAGAALHCWPS
Sbjct  205  VVALDFSENMLRQSYEFFKRDPTLLDTNLALVRADVARLPFSSGSVDAVHAGAALHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV----RPLRENFAQISGSHIFLDEKE  378
            PS A+AEI+R+LR GGVFV TT++      +TP      R LRE   Q   S+ +L E+E
Sbjct  265  PSNAIAEITRILRSGGVFVGTTFL-----RYTPSTSWIPRQLRERARQ---SYNYLTEEE  316

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            + DLCT+CGL  +     + FIM +A KP
Sbjct  317  IADLCTSCGLTNYTSNVQQSFIMFSAQKP  345



>gb|KJB27062.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=337

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QC +FI+Q+ +    NI LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  197  VIALDFSENMLRQCNDFIEQDASILASNIALVRADVSRLPFSSGSVDAVHAGAALHCWPS  256

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            P  AVAEISR+LR GGVFV +T++     S TP  +RP RE   Q   ++ +L E+E+E 
Sbjct  257  PLNAVAEISRILRSGGVFVGSTFLR--YTSSTPRIIRPFRERILQ---NYSYLTEEEIEA  311

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  +     + FIM +A KP
Sbjct  312  LCTSCGLTNYTRNIQQSFIMFSAQKP  337



>ref|XP_006411367.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
 gb|ESQ52820.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
Length=363

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 107/148 (72%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK++  F +  NI +VRAD+SRLPF SSSVDAVHAGAALHCWP
Sbjct  222  VIALDYSENMLRQCNEFIKKDNTFDSSTNIAVVRADVSRLPFPSSSVDAVHAGAALHCWP  281

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +E   Q   S+ +L + E+
Sbjct  282  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQERILQ---SYNYLMQDEI  335

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CT+CGL  +  +    FIM TA KP
Sbjct  336  KDVCTSCGLTDYADVVQDSFIMFTARKP  363



>gb|KHG26587.1| hypothetical protein F383_01046 [Gossypium arboreum]
Length=337

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 104/146 (71%), Gaps = 6/146 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QC +FI+Q+ +    N+ LVRAD+SRLPF+S S+DAVHAGAALHCWPS
Sbjct  197  VIALDFSENMLRQCNDFIEQDASILASNMALVRADVSRLPFSSGSIDAVHAGAALHCWPS  256

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRENFAQISGSHIFLDEKELED  369
            P  AVAEISR+LR GGVFV +T++     S TP  +RP RE   Q   ++ +L E+E+E 
Sbjct  257  PLNAVAEISRILRSGGVFVGSTFLR--YTSSTPRIIRPFRERVLQ---NYSYLTEEEIEA  311

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  +     + FIM +A KP
Sbjct  312  LCTSCGLANYTRKIQQSFIMFSAQKP  337



>ref|XP_009141962.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brassica rapa]
Length=355

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 107/148 (72%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK++  F +  NI +VRAD+SRLPFAS SVDAVHAGAALHCWP
Sbjct  214  VIALDYSENMLRQCNEFIKKDTTFDSSTNIAVVRADVSRLPFASGSVDAVHAGAALHCWP  273

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +    Q   ++ +L + E+
Sbjct  274  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---NYNYLMQDEI  327

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CTTCGL  ++ I    FIM TA KP
Sbjct  328  KDVCTTCGLTDYEDIVQDSFIMFTARKP  355



>ref|XP_009338401.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=350

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 11/151 (7%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+Q YEF K++    + N+ LVRAD++RLPF+S SVDAVHAGAALHCWPS
Sbjct  205  VVALDFSENMLRQSYEFFKRDPTLLDTNLALVRADVARLPFSSGSVDAVHAGAALHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV----RPLRE--NFAQISGSHIFLDE  384
            PS A+AEI+R+LR GGVFV TT++      +TP      R LRE   + +   S+ +L E
Sbjct  265  PSNAIAEITRILRSGGVFVGTTFL-----RYTPSTSWIPRQLREVLMWQRARQSYNYLTE  319

Query  383  KELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +E+ DLCT+CGL  +     + FIM +A KP
Sbjct  320  EEIADLCTSCGLTNYTSNVQQSFIMFSAQKP  350



>ref|XP_006359517.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=345

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 104/144 (72%), Gaps = 4/144 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK +E+  + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  205  VIALDFSENMLRQCYDFIKTDESILSSNLALVRADVSRLPFFSGSVDAVHAGAALHCWPS  264

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEI+R+LR GG+FV TT++     S  P +R L+++  +   ++ F  ++E+EDL
Sbjct  265  PSNAIAEINRILRSGGIFVGTTFLRVNP-SAPPILRALQQSATR---TYSFFTQEEIEDL  320

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
             TTCGL+ +       FIM +A K
Sbjct  321  VTTCGLINYTSKVQGGFIMFSAQK  344



>emb|CDY57579.1| BnaC04g56820D [Brassica napus]
Length=353

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK++  F +  NI +VRAD+SRLPF S SVDAVHAGAALHCWP
Sbjct  212  VIALDYSENMLRQCNEFIKKDATFDSSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWP  271

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +    Q   ++ +L + E+
Sbjct  272  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---NYNYLMQDEI  325

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CTTCGL  ++ I    FIM TA KP
Sbjct  326  KDVCTTCGLTDYEDIVQDSFIMFTARKP  353



>ref|XP_010517586.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Camelina sativa]
Length=355

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK ++ F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWP
Sbjct  214  VIALDYSENMLRQCKEFIKNDDTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWP  273

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E+
Sbjct  274  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEI  327

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CT+CGL  ++      FIM TA KP
Sbjct  328  KDVCTSCGLTDYEDYIQDSFIMFTARKP  355



>ref|XP_010508773.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=356

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK ++ F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWP
Sbjct  215  VIALDYSENMLRQCKEFIKNDDTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWP  274

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E+
Sbjct  275  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEI  328

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CT+CGL  ++      FIM TA KP
Sbjct  329  KDVCTSCGLTDYEDYIQDSFIMFTARKP  356



>ref|XP_002879904.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56163.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK +  F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWP
Sbjct  209  VIALDYSENMLRQCKEFIKNDNTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWP  268

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E+
Sbjct  269  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEI  322

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CT+CGL  ++      FIM TA KP
Sbjct  323  KDVCTSCGLTDYEDYIQDSFIMFTARKP  350



>ref|NP_181637.2| uncharacterized methyltransferase [Arabidopsis thaliana]
 sp|Q0WPT7.1|Y2104_ARATH RecName: Full=Uncharacterized methyltransferase At2g41040, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF00862.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09918.1| uncharacterized methyltransferase [Arabidopsis thaliana]
Length=352

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK +  F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWP
Sbjct  211  VIALDYSENMLRQCKEFIKNDNTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWP  270

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E+
Sbjct  271  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEI  324

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CT+CGL  ++      FIM TA KP
Sbjct  325  KDVCTSCGLTDYEDYIQDSFIMFTARKP  352



>ref|XP_004242719.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Solanum lycopersicum]
Length=341

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 102/144 (71%), Gaps = 4/144 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK +E+  + N+ LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  201  VIALDFSENMLRQCYDFIKTDESILSSNLALVRADVSRLPFFSGSVDAVHAGAALHCWPS  260

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEI+R+LR GGVFV TT++     S  P  R L+++  +   ++ F   +E+EDL
Sbjct  261  PSNAIAEINRILRSGGVFVGTTFLRVNP-STPPIFRALQQSATR---TYSFFTREEIEDL  316

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
             TTCGL+ +       FI+ +A K
Sbjct  317  VTTCGLINYTSKVQGGFIIFSAQK  340



>ref|XP_004242718.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum lycopersicum]
Length=339

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 102/144 (71%), Gaps = 4/144 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIK +E+    N+ LVRAD+SRLPF S S+DAVHAGAALHCWPS
Sbjct  199  VVALDFSENMLRQCYDFIKNDESIIGSNLALVRADVSRLPFPSGSIDAVHAGAALHCWPS  258

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEI+R+LR GGVFV TT++     + T F R L ++  +   ++ +  ++E+EDL
Sbjct  259  PSNAIAEINRILRSGGVFVGTTFLRVNPSAPTIF-RALEQSALR---TYSYFTQEEIEDL  314

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
             T+CGL+ +       FIM +A K
Sbjct  315  VTSCGLINYTSKVQSSFIMFSAQK  338



>ref|XP_009394966.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=312

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE MLQQCY FI QE   P EN+ILVRADISRLPF SSSVDAVHAGAA+HCWPS
Sbjct  211  VIALDFSENMLQQCYNFINQE-GMPRENLILVRADISRLPFVSSSVDAVHAGAAIHCWPS  269

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRE  426
            PSA VAEISRVLRPGGVFVATT+I+D +    P ++ +R+
Sbjct  270  PSAGVAEISRVLRPGGVFVATTFILDVLPPVIPILKTVRQ  309



>ref|XP_001778776.1| predicted protein [Physcomitrella patens]
 gb|EDQ56362.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 105/145 (72%), Gaps = 3/145 (2%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+Q  EFI+Q+ +  N NI LVRAD++RLPFA+ S+DAVHAGAALHCWPS
Sbjct  164  VIALDFSENMLRQSNEFIRQDPSLANSNIALVRADVARLPFATGSIDAVHAGAALHCWPS  223

Query  545  PSAAVAEISRVLRPGGVFVATTYIVD-GIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            P+A +AEI+R+L+PGGVFVATT++    I  F    + +R+  A  S +  + DE ELE+
Sbjct  224  PAAGMAEIARILKPGGVFVATTFLTPLPIIDFGN--KDIRKVGAISSSTLRYWDEAELEE  281

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMK  294
            L   CGLV +  +R  +FIM++A +
Sbjct  282  LMGVCGLVEYTRVRLNQFIMVSAKR  306



>ref|XP_010505866.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=355

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 105/148 (71%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFI+ ++ F N  NI +VRAD+SRLPF S S+DAVHAGAALHCWP
Sbjct  214  VIALDYSENMLRQCKEFIQNDDTFDNSTNIAVVRADVSRLPFPSGSIDAVHAGAALHCWP  273

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E+
Sbjct  274  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEI  327

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CT+CGL  ++      FIM TA KP
Sbjct  328  KDVCTSCGLTDYEDYVQDSFIMFTARKP  355



>ref|XP_006293382.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
 gb|EOA26280.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
Length=356

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK +  F N  NI +VRAD++RLPF S SVDAVHAGAALHCWP
Sbjct  215  VIALDYSENMLRQCKEFIKNDNTFDNSTNIAVVRADVARLPFPSGSVDAVHAGAALHCWP  274

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +    Q   S+ +L + E+
Sbjct  275  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---SYNYLMQDEI  328

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CT+CGL  ++      FIM TA KP
Sbjct  329  KDVCTSCGLTDYEEYIKDSFIMFTARKP  356



>emb|CDY06948.1| BnaA04g23670D [Brassica napus]
Length=800

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 107/148 (72%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK++  F +  NI +VRAD+SRLPFAS SVDAVHAGAALHCWP
Sbjct  659  VIALDYSENMLRQCNEFIKKDTTFDSSTNIAVVRADVSRLPFASGSVDAVHAGAALHCWP  718

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ +RP +    Q   ++ +L + E+
Sbjct  719  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPSTPWIIRPFQSRILQ---NYNYLMQDEI  772

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CTTCGL  ++ I    FIM TA KP
Sbjct  773  KDVCTTCGLTDYEDIVQDSFIMFTARKP  800



>ref|XP_008336951.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
 ref|XP_008336952.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=348

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 100/149 (67%), Gaps = 12/149 (8%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+Q YEF K++    + N+ LVRAD++RLPF S SVDAVHAGAALHCWPS
Sbjct  208  VVALDFSENMLRQSYEFFKRDPTLLDTNLALVRADVARLPFPSGSVDAVHAGAALHCWPS  267

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV----RPLRENFAQISGSHIFLDEKE  378
            PS A+AEI+R+LR G VFV TT++      +TP      R L E   Q   S+ +L E+E
Sbjct  268  PSNAIAEITRILRSGAVFVGTTFL-----RYTPSTSWIPRQLXERARQ---SYNYLTEEE  319

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            + DLCT+CGL  +     + FIM +A KP
Sbjct  320  IADLCTSCGLTNYTSNVQQSFIMFSAQKP  348



>ref|XP_009363912.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=344

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 99/149 (66%), Gaps = 12/149 (8%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+Q YEF K++    + N+ LVRAD++RLPF S SVDAVHAGAALHCWPS
Sbjct  204  VVALDFSENMLRQSYEFFKRDPTLLDTNLALVRADVARLPFPSGSVDAVHAGAALHCWPS  263

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKE  378
            PS A+AEI+R+LR GGV V TT++      +TP      R LR    Q    + +L E+E
Sbjct  264  PSNAIAEITRILRSGGVLVGTTFL-----RYTPSTPWITRQLRGRALQ---GYNYLTEEE  315

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +EDLC +CGL  +     + FIM +A KP
Sbjct  316  IEDLCASCGLTNYTSNVQQAFIMFSAQKP  344



>gb|ABR16838.1| unknown [Picea sitchensis]
Length=326

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 83/100 (83%), Gaps = 1/100 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML QCYEFIKQ++     N+ LVRADISRLPF + SVDAVHAGAALHCWPS
Sbjct  213  VVALDFSENMLHQCYEFIKQDKTLSTANLALVRADISRLPFTAGSVDAVHAGAALHCWPS  272

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRE  426
            PS+AVAEISRVLRPGGVFVATT+++ GI   +  V+PLR+
Sbjct  273  PSSAVAEISRVLRPGGVFVATTFVLSGILD-SDIVKPLRQ  311



>ref|XP_004287239.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=289

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 7/146 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFP-NENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA DFSE ML QCY+++ ++ + P   +++LVRAD SRLPF S SVDAVHAGAALHCWP
Sbjct  150  VVALDFSENMLLQCYDYLMRDPDTPLATDLVLVRADASRLPFTSCSVDAVHAGAALHCWP  209

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS AVAEI+RVLR GG+FV TT++     S +   +PL E   +I  S  +  E+E+ED
Sbjct  210  SPSNAVAEITRVLRSGGIFVGTTFLRS---SPSWIFKPLNE---RILPSGNYFTEEEIED  263

Query  368  LCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LCT+CGL  +     + FI+ +A KP
Sbjct  264  LCTSCGLTNYTSKVEQSFIIFSAKKP  289



>gb|KFK36957.1| hypothetical protein AALP_AA4G194500 [Arabis alpina]
Length=343

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 9/148 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC +FIK +  F +  NI +VRAD+SRLPF S SVDAVHAGAALHCWP
Sbjct  202  VIALDYSENMLRQCNDFIKNDNTFDSSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWP  261

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYS-FTPF-VRPLRENFAQISGSHIFLDEKEL  375
            SP+ A+AEI RVLR GGVFV TT++    YS  TP+ ++P +    Q   ++ +L + E+
Sbjct  262  SPTNAIAEICRVLRSGGVFVGTTFLR---YSPTTPWIIKPFQSRILQ---NYNYLMQDEI  315

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +D+CT CGL  +  I    FIM TA KP
Sbjct  316  KDVCTACGLTDYADIVKDSFIMFTARKP  343



>gb|EEC83568.1| hypothetical protein OsI_29220 [Oryza sativa Indica Group]
Length=352

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 92/130 (71%), Gaps = 10/130 (8%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEE-------NFPNEN---IILVRADISRLPFASSSVDAVH  576
            VVA DFSE ML+QC E++KQE         FPN     + LVRADISRLPF S S+DAVH
Sbjct  216  VVALDFSENMLKQCNEYVKQENISDKYGPQFPNHQHLTLALVRADISRLPFVSGSIDAVH  275

Query  575  AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHI  396
            A AA+HCWPSP+ AVAEISRVLRPGGVFVA+T++ D +    P +R  R   +Q +GS+I
Sbjct  276  AAAAIHCWPSPACAVAEISRVLRPGGVFVASTFVADILPPAVPVLRIGRPYISQFTGSNI  335

Query  395  FLDEKELEDL  366
            FL E E EDL
Sbjct  336  FLSEAEFEDL  345



>ref|XP_006359516.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=343

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 102/144 (71%), Gaps = 4/144 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FIK +E+  + N+ LVRAD+SRLPF S S+DAVHAGAALHCWPS
Sbjct  203  VIALDFSENMLRQCYDFIKNDESIISSNLALVRADVSRLPFPSGSIDAVHAGAALHCWPS  262

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEI+R+L  GGVFV TT++     + T F R L ++  +   ++ +  ++E+EDL
Sbjct  263  PSNAIAEINRILCSGGVFVGTTFLRVNPSAPTIF-RALEQSALR---TYSYFTQEEIEDL  318

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
             T+CGL+ +       FIM +A K
Sbjct  319  VTSCGLINYTSKVQSSFIMFSAQK  342



>ref|XP_009337420.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009337422.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=89

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 4/87 (5%)
 Frame = -1

Query  668  QEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  489
            +    P ENIILV+ADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV
Sbjct  6    RRRTSPKENIILVKADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  65

Query  488  ATTYIVDGIYSFTPFVRPLRENFAQIS  408
            A+TYI+DG +S  PF+R    N  Q++
Sbjct  66   ASTYILDGRFSHIPFLR----NITQVT  88



>ref|XP_009337419.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009337421.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=110

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 79/108 (73%), Gaps = 6/108 (6%)
 Frame = -1

Query  668  QEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  489
            +    P ENIILV+ADISRLPFA+SSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV
Sbjct  6    RRRTSPKENIILVKADISRLPFATSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFV  65

Query  488  ATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL--CTTCG  351
            A+TYI+DG +S  PF+R    N  Q+  S+  L   +  D   C  C 
Sbjct  66   ASTYILDGRFSHIPFLR----NITQVHLSYSKLSLLQFWDSAECAPCS  109



>ref|XP_002968407.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
 gb|EFJ30661.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
Length=315

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML QC+  + ++++  NE ++LVRAD SRLPFAS S+ AV++GAALHCW S
Sbjct  165  VVAADFSEAMLIQCHALLNEKQSPWNEKVVLVRADASRLPFASGSISAVYSGAALHCWES  224

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
            PS A+AEI RVLRPGGV VATT++           + +R  F    G+ IF  E EL++L
Sbjct  225  PSIAIAEICRVLRPGGVLVATTFLPRWKSKLQTTQKFMRLIF----GTKIFFFEDELDEL  280

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
              T GLV ++ I+   +IM+ A K
Sbjct  281  FETSGLVSYQKIKIDSYIMVCARK  304



>ref|XP_002954755.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
 gb|EFJ44161.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
Length=369

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 98/157 (62%), Gaps = 11/157 (7%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNEN--IILVRADISRLPFASSSVDAVHAGAALHCW  552
            VVA DFSE+MLQQ  E+   E    N +  I+L+RAD+ RLPFA+ SV AVHAGAA+HCW
Sbjct  210  VVAADFSESMLQQTREYCMAEGGTLNGSTPIMLLRADVGRLPFATGSVAAVHAGAAIHCW  269

Query  551  PSPSAAVAEISRVLRPGGVFVATTYIVD----GIYSFTPFVRPLRENFAQISGSHI----  396
            P+P  A+AEISRVL PGGVFVA+T++      G       VRPL +     +G  +    
Sbjct  270  PNPQVALAEISRVLAPGGVFVASTFLTATAPLGQVLGDDAVRPLSQLDPTTAGGIVGTPY  329

Query  395  -FLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
             + +E+EL DLCT  GL  ++  R  RFIM    KP+
Sbjct  330  RWWEEQELLDLCTAVGLQDWRRERTWRFIMFAVTKPN  366



>ref|XP_007510827.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18360.1| predicted protein [Bathycoccus prasinos]
Length=390

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 94/152 (62%), Gaps = 7/152 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML +  +F + EEN     I  VRAD+ RLPF + SVD VHAGAALHCWPS
Sbjct  217  VVASDFSENMLIEASQFAR-EENIDANVITFVRADVGRLPFETGSVDVVHAGAALHCWPS  275

Query  545  PSAAVAEISRVLRPGGVFVATTYI-----VDGIYSFTPFVRPLRENFAQISGS-HIFLDE  384
            P+ AVAEISRVL+PGG FVA+T++     ++      PF    R+      G+ + F  E
Sbjct  276  PTQAVAEISRVLKPGGTFVASTFLDPSANLNNDDLTKPFSDFFRDAKLGTGGAFNRFWTE  335

Query  383  KELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            +EL+DLC   GL  FK  R R++I+    K S
Sbjct  336  QELKDLCQMVGLEDFKRERERQYILFAVKKNS  367



>gb|KDO59316.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=314

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPS
Sbjct  193  VVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPS  252

Query  545  PSAAVAEISRVLRPGGVFVATTYI  474
            PS AVAEISR+LR GGVFV TT++
Sbjct  253  PSNAVAEISRILRSGGVFVGTTFL  276



>gb|KDO59315.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=304

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPS
Sbjct  193  VVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPS  252

Query  545  PSAAVAEISRVLRPGGVFVATTYI  474
            PS AVAEISR+LR GGVFV TT++
Sbjct  253  PSNAVAEISRILRSGGVFVGTTFL  276



>ref|XP_001418638.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96931.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=227

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 89/151 (59%), Gaps = 7/151 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+S+ ML+Q  ++++ E    + ++  VRADI+RLPF   S+D VHAGAA+HCWP 
Sbjct  77   VVALDYSDAMLRQAKQYMEDENLLGDADVCFVRADIARLPFPEGSLDGVHAGAAIHCWPD  136

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-----FVRPLRENFAQISGSHIF--LD  387
                VAEI+RVL+PG  F  TT++   +  F       F   +RE    ++    F    
Sbjct  137  AKTGVAEIARVLKPGATFCGTTFMNPQVPFFDEDQQAIFDNAVREFSGTVNAERGFRWWS  196

Query  386  EKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  294
            +KEL DLCT CGLV FKC    +FI  +A K
Sbjct  197  KKELRDLCTECGLVDFKCEIRNQFIFYSAKK  227



>gb|KCW79027.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=304

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+  D+SE ML+QCY+FIKQ++     N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  196  VIPLDYSENMLRQCYDFIKQDDAVLKANLALVRADVSRLPFSSCSVDAVHAGAALHCWPS  255

Query  545  PSAAVAEISRVLRPGGVFVATTYI  474
            PS A+AEI+RVLR GGVFV TT++
Sbjct  256  PSNAIAEITRVLRSGGVFVGTTFL  279



>gb|KCW79026.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=305

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+  D+SE ML+QCY+FIKQ++     N+ LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  196  VIPLDYSENMLRQCYDFIKQDDAVLKANLALVRADVSRLPFSSCSVDAVHAGAALHCWPS  255

Query  545  PSAAVAEISRVLRPGGVFVATTYI  474
            PS A+AEI+RVLR GGVFV TT++
Sbjct  256  PSNAIAEITRVLRSGGVFVGTTFL  279



>emb|CAN77779.1| hypothetical protein VITISV_004172 [Vitis vinifera]
Length=714

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIK++      N+ LVRADISRLPF+S SVDAVHAGAALHCWPS
Sbjct  371  VVALDFSENMLRQCYDFIKKDNPSLTTNLALVRADISRLPFSSGSVDAVHAGAALHCWPS  430

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIY---SFTPFVRPLRENFAQ  414
            PS AVAEI+R+LR GG+FV TT++   IY   S    +RP R+   +
Sbjct  431  PSNAVAEITRILRSGGIFVGTTFL-RPIYTNSSIPAILRPFRQGIQK  476


 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 81/131 (62%), Gaps = 20/131 (15%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEE-NFPNENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            VVA DFSE ML+QCY+FIK+E       N+ LVRAD+SRLPF++ SVDAVHAGAALHCWP
Sbjct  106  VVALDFSENMLRQCYDFIKKENPALATTNLALVRADVSRLPFSTGSVDAVHAGAALHCWP  165

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
            SPS AV       R      +   +   I     + R L +N+         L EKE+ED
Sbjct  166  SPSNAV-------RINSFMTSDMVLAKSI----EWERSL-QNYNN-------LTEKEIED  206

Query  368  LCTTCGLVGFK  336
            LCT+CGL+ ++
Sbjct  207  LCTSCGLINYR  217



>gb|KJB27061.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=332

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 3/101 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QC +FI+Q+ +    NI LVRAD+SRLPF+S SVDAVHAGAALHCWPS
Sbjct  197  VIALDFSENMLRQCNDFIEQDASILASNIALVRADVSRLPFSSGSVDAVHAGAALHCWPS  256

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP-FVRPLRE  426
            P  AVAEISR+LR GGVFV +T++     S TP  +RP RE
Sbjct  257  PLNAVAEISRILRSGGVFVGSTFL--RYTSSTPRIIRPFRE  295



>ref|XP_001694737.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02321.1| predicted protein [Chlamydomonas reinhardtii]
Length=275

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 105/149 (70%), Gaps = 7/149 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNEN--IILVRADISRLPFASSSVDAVHAGAALHCW  552
            V+A DFSE+MLQQ  E+  QE    N +  I+L+RAD++RLPFA+ SV A+HAGAA+HCW
Sbjct  119  VIAADFSESMLQQTREYCMQEGEGLNGSTPIMLLRADVARLPFATGSVAAIHAGAAIHCW  178

Query  551  PSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQ-ISGSHIFLDEKEL  375
            P+P AA+AEISRVL PGGVFVA+T++     +  P  + L ++  + +S S  + +E+EL
Sbjct  179  PNPQAALAEISRVLAPGGVFVASTFLT----ASAPLGQVLGDDLVRPLSQSMKYWEEQEL  234

Query  374  EDLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
             DLC   GL GF+  R+ +FIM +A KP+
Sbjct  235  RDLCEAVGLQGFQRERSWQFIMFSARKPA  263



>ref|XP_003080221.1| methyltransferase-related (ISS) [Ostreococcus tauri]
 emb|CAL54388.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=389

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 94/151 (62%), Gaps = 7/151 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+S+ ML+Q  ++++ E+   N ++  VRADI+RLPF  SS+D VHAGAA+HCWP 
Sbjct  234  VVALDYSDAMLRQAKQYMEDEKLLGNADVCFVRADIARLPFPESSLDGVHAGAAIHCWPD  293

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFA-QISGSH------IFLD  387
             + AVAEI+RVL+PG  F  TT++   +  F    + + +    Q SG+        +  
Sbjct  294  STTAVAEIARVLKPGATFCGTTFMNPQVPFFDEDQQEVFDGVVRQFSGTENAARGFRWWS  353

Query  386  EKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  294
            +KEL DL T CGLV FKC   ++FI  +A K
Sbjct  354  KKELRDLFTECGLVDFKCETRQQFIFYSAKK  384



>dbj|BAC99645.1| hypothetical protein [Oryza sativa Japonica Group]
Length=323

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 10/102 (10%)
 Frame = -1

Query  713  DFSETMLQQCYEFIKQEE-------NFPNEN---IILVRADISRLPFASSSVDAVHAGAA  564
            DFSE ML+QC E++KQE         FPN     + L RADISRLPF S S+DAVHA AA
Sbjct  210  DFSENMLKQCNEYVKQENISDKYGPQFPNHQHLTLALARADISRLPFVSGSIDAVHAAAA  269

Query  563  LHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR  438
            +HCWPSP+ AVAEISRVLRPGGVFVA+T++ D +    P +R
Sbjct  270  IHCWPSPACAVAEISRVLRPGGVFVASTFVADILPPAVPVLR  311



>ref|XP_003056709.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58354.1| predicted protein [Micromonas pusilla CCMP1545]
Length=384

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 97/190 (51%), Gaps = 44/190 (23%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN---------------------------------E  645
            VVA DFS +M++Q   + + +    N                                  
Sbjct  191  VVASDFSASMMRQTKAYCEADARLSNALRRKPVWEAGWEEEDAAARASASTSTSTSTTST  250

Query  644  NIILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTY----  477
             +  VRAD+ RLPFA+ S DAVHAGAA+HCWPSPSAAVAEISRVLRPGGVF+A+T+    
Sbjct  251  RLSFVRADVGRLPFATGSFDAVHAGAAMHCWPSPSAAVAEISRVLRPGGVFIASTFLDPT  310

Query  476  --IVDGIYS---FTPFVRPLRENFAQISGS-HIFLDEKELEDLCTT-CGLVGFKCIRNRR  318
              + D + S     P     RE+     G+ + F  EKEL DL T  CGL  F+  R R+
Sbjct  311  SMLGDALGSDEMVQPLSAAFRESGLGTGGAFNQFWSEKELRDLTTGMCGLERFERKRERQ  370

Query  317  FIMLTAMKPS  288
            FI  +  KP 
Sbjct  371  FIFFSVRKPG  380



>gb|KJB59930.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=258

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE MLQQCYEFI+QEENFP E + LVRADISRLPF SSS+DAVHAGAALHCWPS
Sbjct  193  VIALDYSENMLQQCYEFIEQEENFPKEKVTLVRADISRLPFESSSIDAVHAGAALHCWPS  252

Query  545  PSAAV  531
            PS A+
Sbjct  253  PSTAL  257



>ref|XP_002506188.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67446.1| predicted protein [Micromonas sp. RCC299]
Length=359

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 93/161 (58%), Gaps = 16/161 (10%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEEN----FPNENIILVRADISRLPFASSSVDAVHAGAALH  558
            VVA D+S +M++Q   +   ++       +  +  VRAD+ RLPFA+ SVD VHAGAA+H
Sbjct  198  VVASDYSASMMRQTVTYCDADDATCSAVKDGALSFVRADVGRLPFATGSVDVVHAGAAMH  257

Query  557  CWPSPSAAVAEISRVLRPGGVFVATTY-----IVDGIYSFTPFVRP-------LRENFAQ  414
            CWPSPSAA+ E++RVLRPGGVFVA+T+     +++ ++               +      
Sbjct  258  CWPSPSAAMVEVARVLRPGGVFVASTFMDPTSMLEDVFGAGAEAAAAPLAEAFVNSGVGT  317

Query  413  ISGSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
                + F  EK+L DL   CGL GF+  R+R+FI+    KP
Sbjct  318  GGAFNQFWREKDLRDLTGMCGLEGFERRRSRQFILFRVNKP  358



>gb|KIY98469.1| putative methyltransferase [Monoraphidium neglectum]
Length=249

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 82/131 (63%), Gaps = 18/131 (14%)
 Frame = -1

Query  641  IILVRADISRLPFASSSVDAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGI  462
            I+ VRADI+RLPFA+ SVDA+HAGAA+HCWP+P AA+AEISRVLRPGGVFVA+T++    
Sbjct  53   IVCVRADIARLPFATGSVDAIHAGAAIHCWPNPQAALAEISRVLRPGGVFVASTFLT---  109

Query  461  YSFTPF--------VRPLRENFAQI------SGSHIFLDEKELEDLCTTCGLVGFKCIRN  324
              F P         VRP+ +   +       + ++   ++ EL +L    GL    C+R 
Sbjct  110  -PFAPIGELLGDDTVRPISQALERTPWARGRAATYRQWEQAELRELAGQVGLAWRGCVRA  168

Query  323  RRFIMLTAMKP  291
             RFI+  A KP
Sbjct  169  NRFILFAADKP  179



>ref|XP_002500021.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61279.1| predicted protein [Micromonas sp. RCC299]
Length=385

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 92/170 (54%), Gaps = 28/170 (16%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFI--------KQEENFPN-ENIILVRADISRLPFASSSVDAVHA  573
            VVA DFS+ ML+Q   F         K E    N E+++ VRADI+R+P  S SV  VHA
Sbjct  217  VVALDFSDAMLRQARTFATEEGLVDGKNEATLTNQEDLLFVRADIARIPMTSDSVGGVHA  276

Query  572  GAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR---------PLRENF  420
            GAA+HCWP P  AVAEI RVL PGG F  TT++   +    PF            +RE  
Sbjct  277  GAAIHCWPQPREAVAEICRVLEPGGSFCGTTFLTPQL----PFADDETQQRVDAAMRELQ  332

Query  419  AQI----SGSHIF--LDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
            A +     G+  F   ++K+L DLC  CGLV F+C     FI  +A KP+
Sbjct  333  AAVVGRAGGARGFRQWNKKDLRDLCVECGLVDFECDIRGGFIFFSARKPA  382



>ref|XP_006434006.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47246.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|KDO80934.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
 gb|KDO80935.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=288

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 63/85 (74%), Gaps = 10/85 (12%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+QCYEF++QE NFP EN +LVRADISRLPFASSS+DAVHAGAA+HCW S
Sbjct  204  VVALDYSENMLKQCYEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSS  263

Query  545  PSAAVAEISRVLRPGGVFVATTYIV  471
            PS  V          GVF   T I+
Sbjct  264  PSTGV----------GVFFQVTLII  278



>ref|XP_005643537.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE18993.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=357

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 93/151 (62%), Gaps = 6/151 (4%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE+ML Q  +F  ++ +      +L+RAD+ RLPF + SV A+HAGAA+HCWP+
Sbjct  205  VIAADFSESMLTQAKQFFDEDRSLDTRQYVLLRADVGRLPFPTGSVAAIHAGAAIHCWPN  264

Query  545  PSAAVAEISRVLRPGGVFVATTYI-----VDGIYSFTPFVRPLRENFAQISGSHI-FLDE  384
            P+ AVAEISRVLRPGGVFV +T++     +  + +    VRPL        GS+  + +E
Sbjct  265  PTMAVAEISRVLRPGGVFVGSTFLKASAPLGQLLNNDDLVRPLNSLDPMSGGSNYQWWEE  324

Query  383  KELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
             EL +L    GL  F+  R  RFIM    KP
Sbjct  325  AELRELTAAMGLQDFQRHRTNRFIMFAVQKP  355



>ref|XP_007227385.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
 gb|EMJ28584.1| hypothetical protein PRUPE_ppb016862mg [Prunus persica]
Length=205

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 81/146 (55%), Gaps = 38/146 (26%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE MLQQ              NI+LVRADISR PFA+SS DAVHA  ++    +
Sbjct  98   VVALDYSENMLQQ--------------NIVLVRADISRPPFATSSADAVHAVYSVSNLAA  143

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
                VA+ISRVLRPGG                        N + I+GS  F+ + +LEDL
Sbjct  144  MVLKVADISRVLRPGG------------------------NISHITGSQQFVSDGKLEDL  179

Query  365  CTTCGLVGFKCIRNRRFIMLTAMKPS  288
            C  CGLV F  +RNR F+M++A KP+
Sbjct  180  CNVCGLVSFTSVRNRAFVMISATKPN  205



>ref|XP_002967385.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
 gb|EFJ31984.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
Length=776

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 13/133 (10%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+S+ ML+QC  F++ +        +L+RAD  RLP A+SSV AVH+GAA+HCWP 
Sbjct  51   VIAADYSQEMLEQCRGFLESDSFLDMSECVLLRADAGRLPLANSSVAAVHSGAAIHCWPE  110

Query  545  PSAAVAEISRVLRPGGVFVATTYI-------VDGIYSFTPFVRPLRENFAQISGSHIFLD  387
            P  AVAEISRVLRP G+FV +T++       +DGI      + P+RE   Q+        
Sbjct  111  PIIAVAEISRVLRPQGLFVGSTFVFPEPPPPIDGI------INPVREAIMQLQVPFKAWT  164

Query  386  EKELEDLCTTCGL  348
            +KEL+ L    G+
Sbjct  165  QKELQQLVEAGGM  177


 Score = 95.9 bits (237),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML + +  +  + +     ++LV+AD  RLPF SSS+ AVH  AA+HCWP 
Sbjct  366  VIASDYSEAMLNESFHLLAGDPDINVSKVVLVKADAGRLPFTSSSLAAVHTSAAIHCWPQ  425

Query  545  PSAAVAEISRVLRPGGVFVATT  480
            P  AVAEI+R+L+PGG+FVA+T
Sbjct  426  PLHAVAEIARLLQPGGIFVAST  447



>ref|XP_010040339.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=269

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML+QCY+FIKQ++     N+ LVRAD+SRLPF+SSSVDAVHAGAALHCWPS
Sbjct  196  VIALDYSENMLRQCYDFIKQDDAVLKANLALVRADVSRLPFSSSSVDAVHAGAALHCWPS  255

Query  545  PSAAV  531
            PS AV
Sbjct  256  PSNAV  260



>ref|XP_008356589.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At1g78140, chloroplastic-like [Malus domestica]
Length=259

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VV  D+SE ML +CY FI QEENFP EN+ILVRADIS+LPFA+  VD VHAG A+HCWPS
Sbjct  180  VVDLDYSENMLNECYGFIXQEENFPKENMILVRADISQLPFATGFVDTVHAGXAIHCWPS  239

Query  545  PSAA  534
            PS A
Sbjct  240  PSXA  243



>gb|KDO59317.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=319

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+QCY+FIKQ+      N+ LVRAD+ RLPFAS  VDAVHAGAALHCWPS
Sbjct  193  VVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPS  252

Query  545  PSAAVAEIS  519
            PS A +  S
Sbjct  253  PSNAASVFS  261



>gb|AEJ88263.1| putative S-adenosylmethionine-dependent methyltransferase [Wolffia 
arrhiza]
Length=274

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY+FI +++   N  I LVRAD+SRLPF S SVDAVHAGAALHCWPS
Sbjct  211  VIALDFSENMLRQCYDFISKDDTLLNAKIALVRADVSRLPFESGSVDAVHAGAALHCWPS  270

Query  545  PSAA  534
            PS A
Sbjct  271  PSNA  274



>gb|EMS47735.1| hypothetical protein TRIUR3_02804 [Triticum urartu]
Length=241

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 78/149 (52%), Gaps = 38/149 (26%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QCY++IKQEE   N N+ L+                            
Sbjct  127  VIALDFSENMLRQCYDYIKQEETPMNTNLALI----------------------------  158

Query  545  PSAAVAEISRVLRPGGVFVATTYIV----DGIYSFTPFVRPLRENFAQISGSHIFLDEKE  378
                 AEISRVL+PGGVFVATT++       ++S    ++PLR+    ++ S+ F  E E
Sbjct  159  -----AEISRVLKPGGVFVATTFLSTPTNSSLFSIDA-LKPLRQIVGPVNSSYNFFTEGE  212

Query  377  LEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            LEDLC +CGLV +     R FIM +  KP
Sbjct  213  LEDLCRSCGLVNYSSKVQRSFIMFSGQKP  241



>gb|KJB53959.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=269

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A DFSE ML+QC +FIKQ+ +    NI LVRAD+SRLPF+S S+DAVHAGAALHCWPS
Sbjct  203  VIALDFSENMLRQCNDFIKQDASLLASNIALVRADVSRLPFSSGSIDAVHAGAALHCWPS  262

Query  545  PSAA  534
            PS A
Sbjct  263  PSNA  266



>gb|AAD12007.1| hypothetical protein [Arabidopsis thaliana]
Length=262

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNE-NIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A D+SE ML+QC EFIK +  F N  NI +VRAD+SRLPF S SVDAVHAGAALHCWP
Sbjct  195  VIALDYSENMLRQCKEFIKNDNTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCWP  254

Query  548  SPSAAVA  528
            SP+ AV+
Sbjct  255  SPTNAVS  261



>ref|XP_008389527.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=304

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA DFSE ML+Q YEF K++    + N+ LVRAD++RLPF S SVDAVHAGAALHCWPS
Sbjct  204  VVALDFSENMLRQSYEFFKRDPTJLDTNLALVRADVARLPFPSGSVDAVHAGAALHCWPS  263

Query  545  PSAAVAEISRV  513
            PS AV+ +S V
Sbjct  264  PSNAVSCVSCV  274



>ref|XP_007514982.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15222.1| predicted protein [Bathycoccus prasinos]
Length=383

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 9/153 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            +VA DFSE+M+++  E  +++ + P + I  VRAD+ RLPFA+ S+  V A AA+HCWP 
Sbjct  232  IVALDFSESMIKEAMERAQKDTSVPADKIAFVRADVGRLPFANDSIGGVSASAAIHCWPD  291

Query  545  PSAAVAEISRVLRPGGVFVATTYIV--------DGIYSFTPFVRPLRENFAQISGSHIFL  390
              +A AEI RVL+PG +F  TT+          D     +   R L  +    +G   F 
Sbjct  292  VQSACAEIFRVLKPGRIFTGTTFATPNVPFLDDDQNRLLSTLSRDLSASRPGTNGLR-FW  350

Query  389  DEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
            +  +L D   + G      +R + ++   A KP
Sbjct  351  NSADLRDQLQSIGFSDVTILREKDYLFWKARKP  383



>ref|XP_003057905.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57856.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=235

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 83/168 (49%), Gaps = 27/168 (16%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQE--------ENFPNENIILVRADISRLPFASSSVDAVHAG  570
            VVA D+S  ML Q  +F   E            N +I  VRADI+R+PF   SV  VHAG
Sbjct  72   VVALDYSAAMLTQARQFAIDEGLLDASGAAKDDNTDITFVRADIARMPFPEGSVGGVHAG  131

Query  569  AALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR---------PLRENFA  417
            AA+HCWP P AA AEI+R L  GG F  TT++   +    PF+           +RE   
Sbjct  132  AAIHCWPDPRAAAAEIARALERGGSFCGTTFLTPRV----PFLDDAGQQQLDAAMREVQD  187

Query  416  QISG------SHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMKP  291
             ISG           +  +L+DLC  CGLV F+      FI  +A KP
Sbjct  188  AISGRAGGARGFRMWNRADLKDLCEECGLVDFESDVRDGFIFFSAKKP  235



>ref|XP_002960327.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
 gb|EFJ37866.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
Length=604

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML + +  +  + +     ++LV+AD  RLPF SSS+ AVH  AA+HCWP 
Sbjct  194  VIASDYSEAMLNESFHLLAGDPDINVSKVVLVKADAGRLPFTSSSLAAVHTSAAIHCWPQ  253

Query  545  PSAAVAEISRVLRPGGVFVATT  480
            P  AVAEI+R+L+PGG+FVA+T
Sbjct  254  PLHAVAEIARLLQPGGIFVAST  275



>ref|XP_005824779.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
 gb|EKX37799.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
Length=365

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 78/144 (54%), Gaps = 7/144 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+A D+SE ML +  +  K+EEN P+ +II  RAD++ LPF   S+DA+H+GAALHCWP 
Sbjct  224  VIAVDYSENMLGEVIQR-KKEENCPDFDII--RADVASLPFVDGSLDAIHSGAALHCWPY  280

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
                + E+ RVL+PGG F A+T+    ++     V  L+ N       + F   +ELE L
Sbjct  281  VQDGLKEVHRVLKPGGRFFASTF----LWGVPDEVISLQANLGPRQRQYRFFSVEELEWL  336

Query  365  CTTCGLVGFKCIRNRRFIMLTAMK  294
                G       R  R  ++   K
Sbjct  337  MRGAGFKDVNVERRDRCALIRCRK  360



>ref|XP_006826926.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
 gb|ERM94163.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
Length=215

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = -1

Query  722  VAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPSP  543
            VA DF+E ML++CY F+KQE +    N++LVRADISRLPF +SSVDAVHAGAA+HC  SP
Sbjct  148  VALDFTENMLKECYGFVKQE-SITTRNLVLVRADISRLPFVTSSVDAVHAGAAIHCCLSP  206

Query  542  SAAV  531
            S AV
Sbjct  207  STAV  210



>ref|XP_005536724.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80688.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=441

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 18/140 (13%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEE-------NFPNENII-LVRADISRLPFASSSVDAVHAG  570
            V+A D+SE ML++  E  ++E         F ++ I  ++RAD+ RLPFA+ S+D +HAG
Sbjct  281  VIAVDYSEAMLRELVERAEREPLPERIGGGFVSDRITGIIRADVERLPFANESIDCIHAG  340

Query  569  AALHCWPSPSAAVAEISRVLRP-----GGVFVATTYIVDGIYSFTPFVRPLREN-FAQIS  408
            AALHCWP     + E+ R+LRP      G F+ATT+    ++S +PF   +RE      S
Sbjct  341  AALHCWPCVQDGLHEVYRILRPSKGPGSGRFLATTF----LWSTSPFGLAVREGRLLSPS  396

Query  407  GSHIFLDEKELEDLCTTCGL  348
              + F D KELE L  + G 
Sbjct  397  AGYRFFDAKELEWLVKSAGF  416



>ref|XP_005713645.1| unnamed protein product [Chondrus crispus]
 emb|CDF33826.1| unnamed protein product [Chondrus crispus]
Length=298

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+S+ ML+Q  E+  ++   P  ++  VRAD++RLPF   +  AVH+GAALHCWP+
Sbjct  145  VVAADYSDAMLRQTVEYKNKDATAPEFDV--VRADVARLPFVEGAFGAVHSGAALHCWPN  202

Query  545  PSAAVAEISRVLRPGGVFVATTY  477
                +AEI RVL+PGG F ATT+
Sbjct  203  VQDGLAEIQRVLQPGGRFFATTF  225



>ref|XP_002502147.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63405.1| predicted protein [Micromonas sp. RCC299]
Length=373

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 79/170 (46%), Gaps = 34/170 (20%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYE---------FIKQEENF-PNENIILVRADISRLPFASSSVDAVH  576
            +VA D SE M ++  E          I+ E    P  N   VRAD++ +PF  SSVDAVH
Sbjct  213  LVASDVSEAMTRRAAEQLDAVSARSTIRPEPGAAPLPNFAAVRADVASMPFGDSSVDAVH  272

Query  575  AGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISG---  405
              A  HCWP P   + E+ R+L+PGGVFV +T +            P+RE +A+      
Sbjct  273  CSAGAHCWPDPMDGLREVERILKPGGVFVTSTVV---------LAPPIREKYAKGGDCTD  323

Query  404  -----------SHIFLDEKELEDLCTTCGLVGFKCIRNRR-FIMLTAMKP  291
                       +  F D   +  +    GL G + ++  + F+ML A KP
Sbjct  324  AQSYDDKVRTMNTPFWDTASVVAMLQKAGLKGVEIVKEDKCFVMLAARKP  373



>gb|EJK66010.1| hypothetical protein THAOC_13088 [Thalassiosira oceanica]
Length=446

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 57/86 (66%), Gaps = 2/86 (2%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPN--ENIILVRADISRLPFASSSVDAVHAGAALHCW  552
            V+A D+SE+ML +    I+++ +  N    + LVR D+ R+P  S SVDA HAGAA+HCW
Sbjct  295  VIACDYSESMLNEARRRIREDADIANAPTKLDLVRCDVGRIPMKSDSVDAFHAGAAMHCW  354

Query  551  PSPSAAVAEISRVLRPGGVFVATTYI  474
            P    ++ EI RVL PGG + ATT++
Sbjct  355  PEIEKSLQEIHRVLVPGGRYFATTFL  380



>ref|XP_005855405.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
 ref|XP_005855816.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20544.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20954.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
Length=387

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYE-FIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A DFSE+ML++    F++++   P     LVRAD SR PF +SSVDA+HAGAALHCWP
Sbjct  253  VIAADFSESMLRETRRRFLEEKLPVPE----LVRADASRQPFQTSSVDAIHAGAALHCWP  308

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVD  468
                ++ E  RVL+PGG   A+T+ V+
Sbjct  309  RLEESLRECLRVLKPGGRMYASTFEVN  335



>gb|EWM24600.1| phosphatidylethanolamine n [Nannochloropsis gaditana]
Length=387

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYE-FIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWP  549
            V+A DFSE+ML++    F++++   P     LVRAD SR PF +SSVDA+HAGAALHCWP
Sbjct  253  VIAADFSESMLRETRRRFLEEKLPVPE----LVRADASRQPFQTSSVDAIHAGAALHCWP  308

Query  548  SPSAAVAEISRVLRPGGVFVATTYIVD  468
                ++ E  RVL+PGG   A+T+ V+
Sbjct  309  RLEESLRECLRVLKPGGRMYASTFEVN  335



>ref|XP_002503324.1| chloroplast envelope protein translocase family [Micromonas sp. 
RCC299]
 gb|ACO64582.1| chloroplast envelope protein translocase family [Micromonas sp. 
RCC299]
Length=903

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            +VA D++E M  +  E I    N   ++  +VRAD+  LPF   +  AVH+ A +HCWP 
Sbjct  210  IVATDYAEAMCARTLERIASSPNARAKDTAVVRADVGNLPFDDDAFAAVHSAAGIHCWPE  269

Query  545  PSAAVAEISRVLRPGGVFVATTYIV  471
            P+  + E+SRVL+PGG FVA+T ++
Sbjct  270  PARGLEEVSRVLKPGGTFVASTVVL  294



>ref|WP_033335056.1| hypothetical protein, partial [Scytonema hofmanni]
Length=79

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            ++A D+SETML +  + ++ E   P+E II++RAD+  LP A  S+DA++AGAA+HCW  
Sbjct  2    ILALDYSETMLTELQQQMQLEGISPSE-IIIIRADVEALPLAPDSIDAIYAGAAMHCWND  60

Query  545  PSAAVAEISRVLRPGG  498
             +  +  I + LRPGG
Sbjct  61   ATEGIRNIYQALRPGG  76



>ref|XP_002185698.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65168.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=412

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFP---NENIILVRADISRLPFASSSVDAVHAGAALHC  555
            V+  D+S +ML + +  I+         N  + L+R D+ ++P  ++SVD +HAGAA+HC
Sbjct  262  VLGCDYSASMLNEAHTRIQANPRLNGNRNTQLDLIRLDVGQIPMKNASVDCLHAGAAMHC  321

Query  554  WPSPSAAVAEISRVLRPGGVFVATTYI  474
            WP   AA AEI RVL+PGG + ATT++
Sbjct  322  WPDLPAAAAEIYRVLKPGGRYFATTFL  348



>gb|KIE07218.1| hypothetical protein DA73_0239355 [Tolypothrix bouteillei VB521301]
Length=263

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            ++A D+SETML +  + ++ E   P+E I + RAD+  LP A +S+DA++AGAA+HCW  
Sbjct  136  ILALDYSETMLSELQQQMQLEGISPSE-IAIARADVEALPLAPNSIDAIYAGAAMHCWND  194

Query  545  PSAAVAEISRVLRPGGVFVATTYI  474
             +  +  I + LRPGG  +ATT++
Sbjct  195  ATEGIRNIYQALRPGGKLLATTFL  218



>emb|CBJ26935.1| S-adenosyl-L-methionine-dependent methyltransferases-like [Ectocarpus 
siliculosus]
Length=471

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 69/140 (49%), Gaps = 14/140 (10%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            V+  D S TML +     ++E+    E   L+R D+SRLP  + S+D VHAGAALHCW  
Sbjct  330  VIGGDLSPTMLAETARRFREEDLGAPE---LIRCDVSRLPLKTESLDGVHAGAALHCWSK  386

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTP----FVRPLRENFAQISGSHIFLDEKE  378
               +++E+ RVL+PG  F ATT++   +   T          R+ F        F +  E
Sbjct  387  LEESLSEVHRVLKPGRGFFATTFLNSAVLGNTAGNTVGNSRRRDGFK-------FFELAE  439

Query  377  LEDLCTTCGLVGFKCIRNRR  318
            LE L    G    K ++  R
Sbjct  440  LEQLMRNAGFEDVKVVKEGR  459



>ref|XP_002992310.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
 gb|EFJ06586.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
Length=212

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 79/158 (50%), Gaps = 24/158 (15%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEE--------NFPNENIILVRADIS------RLPFASSSV  588
            V+A DFSE+MLQQC EF+KQ++        N     ++  + +IS         F     
Sbjct  64   VIALDFSESMLQQCAEFVKQDKSLRTAYDSNHLWSVVLFGQNEISPWFERMLFVFLLRPE  123

Query  587  DAVHAGAALHCWPSPSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQIS  408
              +     LHC         ++ + L+PGGVFVATT++ + I+SF P  R         S
Sbjct  124  PFLLFMLVLHCIAGHLFHPQDM-QSLKPGGVFVATTFLSNSIFSFLPKRR---------S  173

Query  407  GSHIFLDEKELEDLCTTCGLVGFKCIRNRRFIMLTAMK  294
             S  +  EKELE+LC  CGLV ++      +IML+A K
Sbjct  174  SSLRYWTEKELEELCKLCGLVDYQKKMKGNYIMLSARK  211



>ref|XP_005705444.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
 gb|EME28924.1| phosphatidylethanolamine n-methyltransferase, putative [Galdieria 
sulphuraria]
Length=331

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 69/126 (55%), Gaps = 14/126 (11%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            +V  D SE+ML++ Y  +  EE    +   L+RA++  LP   + VD ++ GAALHCWP 
Sbjct  194  IVGIDLSESMLKEAYRRMLLEEGC--DPFTLIRANVDSLPLRDNVVDLIYCGAALHCWPK  251

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELEDL  366
                +AE+ R+L+P  +  ATT+I +    ++P +   R N      ++ F  +KELE L
Sbjct  252  VQDGLAEMYRILKPDALVFATTFISN----YSPLIS--RWN------AYRFFTKKELEWL  299

Query  365  CTTCGL  348
              + G 
Sbjct  300  LKSRGF  305



>ref|WP_009647626.1| SAM-dependent methyltransferase [Actinomyces sp. ICM47]
 gb|EJG15792.1| methionine biosynthesis protein MetW-like protein [Actinomyces 
sp. ICM47]
Length=200

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+Q     K+   FP+  +++ +ADI+ L +A  S DAV AG  +H  P 
Sbjct  60   VVATDYSEGMLKQAR---KKLARFPH--VVVEQADITDLHYADDSFDAVVAGNVIHLLPE  114

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR  438
            P  A+ EI RV+RPGG  +  TY++    + T F+R
Sbjct  115  PGDALKEIKRVVRPGGTIIVPTYVIPKKRAHTMFLR  150



>ref|WP_005984449.1| SAM-dependent methyltransferase [Actinomyces graevenitzii]
 gb|EHM89424.1| hypothetical protein HMPREF0045_00089 [Actinomyces graevenitzii 
C83]
Length=200

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+Q     K+   +PN  +++ +ADI+ L +A  S DAV AG  +H  P 
Sbjct  60   VVATDYSEGMLKQAG---KKLARYPN--VVVEQADITDLHYADDSFDAVVAGNVIHLLPE  114

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR  438
            P  A+ E+ RV+RPGG  +  TY++    + T F+R
Sbjct  115  PGEALKELKRVVRPGGTIIVPTYVIPKKRAHTMFLR  150



>ref|XP_005781281.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
 gb|EOD28852.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
Length=459

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 67/127 (53%), Gaps = 4/127 (3%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
             +A D+SE ML++       E+      + L+R D+++LP    +VDA+HAGAALH WP+
Sbjct  182  TLACDYSEVMLKETRRRA-LEQGLAPAALELLRCDVAQLPMRDGAVDAMHAGAALHSWPN  240

Query  545  PSAAVAEISRVLRP-GGVFVATTYIVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELED  369
                ++EI RVLRP GG F ATT++  G Y  T    P +      S    F  E+EL  
Sbjct  241  LEKGLSEIRRVLRPDGGRFFATTFL-RGAYPGTTSATPGQSGGGGGS-FRFFESEEELRQ  298

Query  368  LCTTCGL  348
            L    G 
Sbjct  299  LLIAAGF  305



>ref|WP_003790083.1| SAM-dependent methyltransferase [Actinomyces odontolyticus]
 gb|EDN79671.1| methyltransferase domain protein [Actinomyces odontolyticus ATCC 
17982]
Length=200

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+Q  + + +     + N+ + +ADI+ L +A+ S DAV AG  +H  P 
Sbjct  60   VVATDYSEGMLKQARKKLAK-----HSNVTVEQADITDLRYANDSFDAVVAGNVIHLLPE  114

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFVR  438
            P  A+ E+ RV+RPGG  +  TY++    + T F+R
Sbjct  115  PGDALKELKRVVRPGGTIIVPTYVIPKKRAHTMFLR  150



>ref|WP_003794338.1| SAM-dependent methyltransferase [Actinomyces odontolyticus]
 gb|EFF80695.1| methyltransferase domain protein [Actinomyces odontolyticus F0309]
Length=200

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+Q  + + +  N   E     +ADI+ L +A+ S DAV AG  +H  P 
Sbjct  60   VVATDYSEGMLKQARKKLAKHSNVTVE-----QADITDLRYANDSFDAVVAGNVIHLLPE  114

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV  441
            P  A+ E+ RV+RPGG  +  TY++    ++T F+
Sbjct  115  PGDALKELKRVVRPGGTIIVPTYVIPKKRAYTMFL  149



>ref|WP_034501983.1| SAM-dependent methyltransferase [Actinomyces sp. S6-Spd3]
 gb|KGF00296.1| SAM-dependent methyltransferase [Actinomyces sp. S6-Spd3]
Length=203

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 5/84 (6%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            +VA DFSE ML+Q  + + +       N+ + RADI++L +A  S D V AG  +H  P 
Sbjct  60   LVATDFSEGMLKQARKKLAK-----YRNVTVERADITKLHYADDSFDIVIAGNVIHLLPD  114

Query  545  PSAAVAEISRVLRPGGVFVATTYI  474
            P AA+ E+ RV+RPGG  V  TY+
Sbjct  115  PGAAMQELERVVRPGGTIVVPTYV  138



>ref|WP_034465932.1| SAM-dependent methyltransferase [Actinomyces sp. ICM54]
 gb|EWC96527.1| methionine biosynthesis protein MetW-like protein [Actinomyces 
sp. ICM54]
Length=200

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+Q  + + +  N   E     +ADI+ L +A+ S DAV AG  +H  P 
Sbjct  60   VVATDYSEGMLKQARKKLAKHSNVTVE-----QADITDLRYANDSFDAVVAGNVIHLLPE  114

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV  441
            P  A+ E+ RV+RPGG  +  TY++    ++T F+
Sbjct  115  PGDALKELKRVVRPGGTIIVPTYVIPKKRAYTMFL  149



>ref|WP_037584032.1| hypothetical protein, partial [Stigmatella aurantiaca]
Length=252

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 72/148 (49%), Gaps = 17/148 (11%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            ++A D S  ML+   E +         N+  VR +  +LP + +S+ AV    +L   P+
Sbjct  119  LIALDLSRAMLEAAKEVLP--------NVFFVRGNAQQLPLSDASLGAVSCWNSLQLLPN  170

Query  545  PSAAVAEISRVLRPGGVFVATTY--IVDGIYSFTPFVRPLRENFAQISGSHIFLDEKELE  372
            PS A+ E+SR L+PGGVF   TY    + +Y +       +  FA+  G   F DE+EL 
Sbjct  171  PSEAIREVSRCLKPGGVFTCFTYRRAREPLYGY------FQSTFARNGGVRPF-DEEELR  223

Query  371  DLCTTCGLVGFKCIRNRRFIMLTAMKPS  288
               T  GLV          ++LTA KP+
Sbjct  224  QWLTQAGLVVEDLGGPNLALLLTARKPT  251



>ref|WP_007588477.1| SAM-dependent methyltransferase [Actinomyces sp. ICM39]
 gb|EJN46417.1| methionine biosynthesis protein MetW-like protein [Actinomyces 
sp. ICM39]
Length=200

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = -1

Query  725  VVAXDFSETMLQQCYEFIKQEENFPNENIILVRADISRLPFASSSVDAVHAGAALHCWPS  546
            VVA D+SE ML+Q  + + +     + N+ + +ADI+ L +A  S DAV AG  +H  P 
Sbjct  60   VVATDYSEGMLKQARKKLAK-----HSNVTVAQADITDLRYADDSFDAVVAGNVIHLLPE  114

Query  545  PSAAVAEISRVLRPGGVFVATTYIVDGIYSFTPFV  441
            P  A+ E+ RV+RPGG  +  TY++    + T F+
Sbjct  115  PRDALKELKRVVRPGGTIIVPTYVIPKKRAHTMFL  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440