BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF021E11

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002281741.1|  PREDICTED: BTB/POZ domain-containing protein...    356   5e-117   Vitis vinifera
ref|XP_010092990.1|  hypothetical protein L484_007171                   348   1e-116   
ref|XP_009610322.1|  PREDICTED: BTB/POZ domain-containing protein...    345   9e-113   Nicotiana tomentosiformis
emb|CDP08962.1|  unnamed protein product                                345   2e-112   Coffea canephora [robusta coffee]
ref|XP_010685873.1|  PREDICTED: BTB/POZ domain-containing protein...    340   1e-110   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP44149.1|  hypothetical protein JCGZ_05616                         340   2e-110   Jatropha curcas
ref|XP_009774422.1|  PREDICTED: BTB/POZ domain-containing protein...    337   1e-109   Nicotiana sylvestris
ref|XP_006424700.1|  hypothetical protein CICLE_v10028213mg             335   1e-108   Citrus clementina [clementine]
gb|KDO73042.1|  hypothetical protein CISIN_1g010024mg                   334   4e-108   Citrus sinensis [apfelsine]
ref|XP_011089383.1|  PREDICTED: BTB/POZ domain-containing protein...    330   7e-107   
ref|XP_004251284.1|  PREDICTED: BTB/POZ domain-containing protein...    330   8e-107   Solanum lycopersicum
ref|XP_006365150.1|  PREDICTED: BTB/POZ domain-containing protein...    329   1e-106   Solanum tuberosum [potatoes]
ref|XP_007132142.1|  hypothetical protein PHAVU_011G070200g             328   4e-106   Phaseolus vulgaris [French bean]
gb|KHN22018.1|  BTB/POZ domain-containing protein                       319   4e-106   Glycine soja [wild soybean]
ref|XP_008222552.1|  PREDICTED: BTB/POZ domain-containing protein...    328   5e-106   Prunus mume [ume]
ref|XP_007016614.1|  BTB/POZ domain-containing protein                  328   8e-106   
gb|KHG07032.1|  hypothetical protein F383_02815                         327   1e-105   Gossypium arboreum [tree cotton]
ref|XP_010260115.1|  PREDICTED: BTB/POZ domain-containing protein...    328   2e-105   Nelumbo nucifera [Indian lotus]
ref|XP_004294641.1|  PREDICTED: BTB/POZ domain-containing protein...    325   9e-105   Fragaria vesca subsp. vesca
ref|XP_007205061.1|  hypothetical protein PRUPE_ppa004481mg             325   1e-104   
gb|KHG05277.1|  hypothetical protein F383_30980                         323   4e-104   Gossypium arboreum [tree cotton]
gb|KJB20225.1|  hypothetical protein B456_003G139200                    322   2e-103   Gossypium raimondii
ref|XP_010043649.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    322   3e-103   
ref|XP_006591005.1|  PREDICTED: BTB/POZ domain-containing protein...    320   3e-103   Glycine max [soybeans]
gb|KCW85653.1|  hypothetical protein EUGRSUZ_B02440                     322   4e-103   Eucalyptus grandis [rose gum]
ref|XP_002531830.1|  protein binding protein, putative                  321   6e-103   Ricinus communis
gb|KHN05697.1|  BTB/POZ domain-containing protein                       318   1e-102   Glycine soja [wild soybean]
ref|XP_003540755.1|  PREDICTED: BTB/POZ domain-containing protein...    319   1e-102   Glycine max [soybeans]
ref|XP_011005022.1|  PREDICTED: BTB/POZ domain-containing protein...    319   2e-102   Populus euphratica
gb|KJB08821.1|  hypothetical protein B456_001G105900                    317   1e-101   Gossypium raimondii
ref|XP_002298385.2|  hypothetical protein POPTR_0001s24050g             317   1e-101   Populus trichocarpa [western balsam poplar]
ref|XP_008349723.1|  PREDICTED: BTB/POZ domain-containing protein...    317   1e-101   Malus domestica [apple tree]
ref|XP_009354521.1|  PREDICTED: BTB/POZ domain-containing protein...    314   2e-100   Pyrus x bretschneideri [bai li]
ref|XP_010313540.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    303   5e-100   
ref|XP_008358075.1|  PREDICTED: BTB/POZ domain-containing protein...    313   5e-100   
gb|AES88747.2|  BTB/POZ domain plant protein                            301   2e-96    Medicago truncatula
ref|XP_004505925.1|  PREDICTED: BTB/POZ domain-containing protein...    302   4e-96    Cicer arietinum [garbanzo]
ref|XP_010520319.1|  PREDICTED: BTB/POZ domain-containing protein...    295   2e-93    Tarenaya hassleriana [spider flower]
emb|CDY09229.1|  BnaA02g06550D                                          295   2e-93    Brassica napus [oilseed rape]
ref|XP_010483651.1|  PREDICTED: BTB/POZ domain-containing protein...    295   4e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010455877.1|  PREDICTED: BTB/POZ domain-containing protein...    295   4e-93    Camelina sativa [gold-of-pleasure]
gb|KFK27540.1|  hypothetical protein AALP_AA8G396600                    290   6e-93    Arabis alpina [alpine rockcress]
ref|XP_006281633.1|  hypothetical protein CARUB_v10027763mg             294   7e-93    Capsella rubella
ref|XP_006828235.1|  hypothetical protein AMTR_s00023p00185370          293   1e-92    Amborella trichopoda
ref|XP_009126626.1|  PREDICTED: BTB/POZ domain-containing protein...    293   1e-92    Brassica rapa
ref|XP_006400887.1|  hypothetical protein EUTSA_v10013333mg             293   2e-92    Eutrema salsugineum [saltwater cress]
ref|XP_003606550.1|  hypothetical protein MTR_4g061670                  293   7e-92    
ref|XP_010443796.1|  PREDICTED: BTB/POZ domain-containing protein...    291   1e-91    Camelina sativa [gold-of-pleasure]
ref|NP_200813.1|  BTB/POZ domain-containing protein                     288   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010922477.1|  PREDICTED: BTB/POZ domain-containing protein...    288   3e-90    
ref|XP_002866364.1|  hypothetical protein ARALYDRAFT_358221             286   1e-89    Arabidopsis lyrata subsp. lyrata
ref|XP_008783774.1|  PREDICTED: BTB/POZ domain-containing protein...    285   3e-89    Phoenix dactylifera
ref|XP_008776113.1|  PREDICTED: BTB/POZ domain-containing protein...    283   1e-88    
ref|XP_008776124.1|  PREDICTED: BTB/POZ domain-containing protein...    281   7e-88    
gb|EYU18898.1|  hypothetical protein MIMGU_mgv1a005394mg                276   6e-86    Erythranthe guttata [common monkey flower]
ref|XP_009397488.1|  PREDICTED: BTB/POZ domain-containing protein...    273   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419272.1|  PREDICTED: BTB/POZ domain-containing protein...    259   2e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006829095.1|  hypothetical protein AMTR_s00001p00262820          244   9e-73    
ref|XP_007036221.1|  BTB/POZ domain-containing protein                  218   2e-67    
gb|EPS62176.1|  hypothetical protein M569_12618                         229   2e-67    Genlisea aurea
ref|XP_001751363.1|  predicted protein                                  224   1e-66    
ref|XP_001762013.1|  predicted protein                                  216   3e-63    
ref|NP_001169621.1|  uncharacterized protein LOC100383502               214   9e-62    Zea mays [maize]
dbj|BAJ96039.1|  predicted protein                                      214   9e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006343947.1|  PREDICTED: BTB/POZ domain-containing protein...    216   1e-61    Solanum tuberosum [potatoes]
ref|XP_004976580.1|  PREDICTED: BTB/POZ domain-containing protein...    214   1e-61    
ref|XP_004143891.1|  PREDICTED: BTB/POZ domain-containing protein...    213   2e-61    
gb|EMT26347.1|  hypothetical protein F775_16772                         211   2e-61    
ref|XP_002446981.1|  hypothetical protein SORBIDRAFT_06g026230          213   2e-61    
gb|AIB05883.1|  TRAF transcription factor                               214   2e-61    Zea mays [maize]
ref|XP_009800799.1|  PREDICTED: BTB/POZ domain-containing protein...    214   3e-61    Nicotiana sylvestris
gb|AFW59116.1|  hypothetical protein ZEAMMB73_743291                    214   3e-61    
ref|XP_008437316.1|  PREDICTED: BTB/POZ domain-containing protein...    215   4e-61    Cucumis melo [Oriental melon]
ref|XP_004245578.1|  PREDICTED: BTB/POZ domain-containing protein...    214   6e-61    Solanum lycopersicum
ref|XP_006355468.1|  PREDICTED: BTB/POZ domain-containing protein...    214   6e-61    Solanum tuberosum [potatoes]
emb|CBI34370.3|  unnamed protein product                                211   7e-61    Vitis vinifera
gb|KGN50074.1|  hypothetical protein Csa_5G152890                       213   2e-60    Cucumis sativus [cucumbers]
ref|XP_004300808.1|  PREDICTED: BTB/POZ domain-containing protein...    211   3e-60    Fragaria vesca subsp. vesca
ref|XP_002279382.2|  PREDICTED: BTB/POZ domain-containing protein...    212   4e-60    Vitis vinifera
ref|XP_009400477.1|  PREDICTED: BTB/POZ domain-containing protein...    211   5e-60    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006652685.1|  PREDICTED: BTB/POZ domain-containing protein...    209   6e-60    
ref|XP_002531214.1|  protein binding protein, putative                  207   6e-60    Ricinus communis
ref|XP_010233737.1|  PREDICTED: BTB/POZ domain-containing protein...    209   7e-60    Brachypodium distachyon [annual false brome]
ref|XP_010089067.1|  BTB/POZ domain-containing protein                  207   7e-60    
ref|XP_011015247.1|  PREDICTED: BTB/POZ domain-containing protein...    210   9e-60    Populus euphratica
ref|XP_011080923.1|  PREDICTED: BTB/POZ domain-containing protein...    209   9e-60    
ref|XP_011022633.1|  PREDICTED: BTB/POZ domain-containing protein...    211   9e-60    Populus euphratica
ref|XP_011015245.1|  PREDICTED: BTB/POZ domain-containing protein...    211   1e-59    Populus euphratica
ref|XP_009628159.1|  PREDICTED: BTB/POZ domain-containing protein...    211   1e-59    Nicotiana tomentosiformis
emb|CDP12055.1|  unnamed protein product                                210   2e-59    Coffea canephora [robusta coffee]
ref|XP_010919095.1|  PREDICTED: BTB/POZ domain-containing protein...    209   2e-59    Elaeis guineensis
ref|XP_009389780.1|  PREDICTED: BTB/POZ domain-containing protein...    209   3e-59    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073126.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    209   3e-59    Sesamum indicum [beniseed]
gb|KCW72192.1|  hypothetical protein EUGRSUZ_E00642                     204   4e-59    Eucalyptus grandis [rose gum]
ref|XP_006439497.1|  hypothetical protein CICLE_v10019226mg             209   6e-59    Citrus clementina [clementine]
ref|NP_001053645.1|  Os04g0579700                                       206   7e-59    
ref|XP_010676445.1|  PREDICTED: BTB/POZ domain-containing protein...    207   8e-59    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002299517.2|  hypothetical protein POPTR_0001s09710g             208   1e-58    Populus trichocarpa [western balsam poplar]
ref|XP_008807229.1|  PREDICTED: BTB/POZ domain-containing protein...    207   1e-58    Phoenix dactylifera
gb|KHG01374.1|  hypothetical protein F383_23678                         207   2e-58    Gossypium arboreum [tree cotton]
ref|XP_011029330.1|  PREDICTED: BTB/POZ domain-containing protein...    207   2e-58    Populus euphratica
ref|XP_007040315.1|  BTB/POZ domain-containing protein isoform 1        207   2e-58    
gb|KJB20610.1|  hypothetical protein B456_003G156100                    206   4e-58    Gossypium raimondii
ref|XP_010058250.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    204   4e-58    
gb|KDO76298.1|  hypothetical protein CISIN_1g006210mg                   206   5e-58    Citrus sinensis [apfelsine]
ref|XP_010255266.1|  PREDICTED: BTB/POZ domain-containing protein...    206   7e-58    Nelumbo nucifera [Indian lotus]
ref|XP_009363413.1|  PREDICTED: BTB/POZ domain-containing protein...    206   8e-58    Pyrus x bretschneideri [bai li]
ref|XP_006425769.1|  hypothetical protein CICLE_v10026330mg             196   1e-57    
ref|XP_006476518.1|  PREDICTED: BTB/POZ domain-containing protein...    205   1e-57    Citrus sinensis [apfelsine]
gb|AAR14275.1|  predicted protein                                       202   1e-57    Populus tremula x Populus alba [gray poplar]
gb|KJB24321.1|  hypothetical protein B456_004G139400                    202   2e-57    Gossypium raimondii
gb|KHN16799.1|  BTB/POZ domain-containing protein                       200   2e-57    Glycine soja [wild soybean]
ref|XP_007210316.1|  hypothetical protein PRUPE_ppa002210mg             204   3e-57    
gb|KHG15549.1|  hypothetical protein F383_06896                         203   4e-57    Gossypium arboreum [tree cotton]
gb|KDP25402.1|  hypothetical protein JCGZ_20558                         204   4e-57    Jatropha curcas
ref|XP_008238939.1|  PREDICTED: BTB/POZ domain-containing protein...    204   4e-57    Prunus mume [ume]
ref|XP_009341340.1|  PREDICTED: BTB/POZ domain-containing protein...    204   4e-57    Pyrus x bretschneideri [bai li]
ref|XP_002963321.1|  hypothetical protein SELMODRAFT_270367             199   5e-57    
ref|XP_002974611.1|  hypothetical protein SELMODRAFT_271097             199   5e-57    
ref|XP_010933990.1|  PREDICTED: BTB/POZ domain-containing protein...    203   5e-57    Elaeis guineensis
gb|KDO79429.1|  hypothetical protein CISIN_1g014635mg                   197   6e-57    Citrus sinensis [apfelsine]
ref|XP_003532421.1|  PREDICTED: BTB/POZ domain-containing protein...    200   1e-56    Glycine max [soybeans]
gb|KJB37507.1|  hypothetical protein B456_006G208800                    201   2e-56    Gossypium raimondii
gb|KDO79424.1|  hypothetical protein CISIN_1g014635mg                   196   5e-56    Citrus sinensis [apfelsine]
gb|KHG02986.1|  hypothetical protein F383_23864                         200   6e-56    Gossypium arboreum [tree cotton]
gb|KHN00573.1|  BTB/POZ domain-containing protein                       195   7e-56    Glycine soja [wild soybean]
gb|EYU40075.1|  hypothetical protein MIMGU_mgv1a002655mg                199   1e-55    Erythranthe guttata [common monkey flower]
ref|XP_008783441.1|  PREDICTED: BTB/POZ domain-containing protein...    199   1e-55    Phoenix dactylifera
ref|XP_010243288.1|  PREDICTED: BTB/POZ domain-containing protein...    197   1e-55    Nelumbo nucifera [Indian lotus]
ref|XP_002887934.1|  hypothetical protein ARALYDRAFT_315042             197   2e-55    Arabidopsis lyrata subsp. lyrata
ref|NP_176570.1|  BTB/POZ domain-containing protein                     197   2e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010254985.1|  PREDICTED: BTB/POZ domain-containing protein...    197   2e-55    Nelumbo nucifera [Indian lotus]
ref|XP_006466699.1|  PREDICTED: BTB/POZ domain-containing protein...    197   3e-55    Citrus sinensis [apfelsine]
gb|KEH21112.1|  BTB/POZ domain plant protein                            198   3e-55    Medicago truncatula
ref|XP_003629532.1|  hypothetical protein MTR_8g078590                  191   4e-55    
ref|XP_010418426.1|  PREDICTED: BTB/POZ domain-containing protein...    196   4e-55    Camelina sativa [gold-of-pleasure]
gb|EPS69450.1|  hypothetical protein M569_05314                         196   5e-55    Genlisea aurea
ref|XP_007160095.1|  hypothetical protein PHAVU_002G291900g             197   6e-55    Phaseolus vulgaris [French bean]
ref|XP_003524451.1|  PREDICTED: BTB/POZ domain-containing protein...    196   7e-55    Glycine max [soybeans]
ref|XP_006302105.1|  hypothetical protein CARUB_v10020096mg             196   7e-55    Capsella rubella
ref|XP_010473631.1|  PREDICTED: BTB/POZ domain-containing protein...    196   8e-55    Camelina sativa [gold-of-pleasure]
ref|XP_010430498.1|  PREDICTED: BTB/POZ domain-containing protein...    196   9e-55    Camelina sativa [gold-of-pleasure]
gb|KHN44517.1|  BTB/POZ domain-containing protein                       192   2e-54    Glycine soja [wild soybean]
gb|KFK38021.1|  hypothetical protein AALP_AA3G059800                    194   3e-54    Arabis alpina [alpine rockcress]
gb|KJB52168.1|  hypothetical protein B456_008G248700                    196   4e-54    Gossypium raimondii
ref|XP_002303602.2|  hypothetical protein POPTR_0003s13090g             195   7e-54    
ref|XP_003548003.1|  PREDICTED: BTB/POZ domain-containing protein...    192   1e-53    Glycine max [soybeans]
ref|XP_002275454.1|  PREDICTED: BTB/POZ domain-containing protein...    192   1e-53    Vitis vinifera
ref|XP_006404002.1|  hypothetical protein EUTSA_v10010286mg             192   2e-53    Eutrema salsugineum [saltwater cress]
ref|NP_001067187.1|  Os12g0596600                                       184   2e-53    
ref|XP_009376454.1|  PREDICTED: BTB/POZ domain-containing protein...    191   3e-53    Pyrus x bretschneideri [bai li]
gb|KEH20448.1|  BTB/POZ domain plant protein                            191   3e-53    Medicago truncatula
ref|XP_004509225.1|  PREDICTED: BTB/POZ domain-containing protein...    191   3e-53    Cicer arietinum [garbanzo]
ref|XP_006391703.1|  hypothetical protein EUTSA_v10023392mg             191   4e-53    Eutrema salsugineum [saltwater cress]
ref|XP_010555851.1|  PREDICTED: BTB/POZ domain-containing protein...    191   5e-53    Tarenaya hassleriana [spider flower]
ref|XP_006419001.1|  hypothetical protein EUTSA_v10002519mg             189   7e-53    
ref|XP_010941924.1|  PREDICTED: BTB/POZ domain-containing protein...    190   9e-53    Elaeis guineensis
ref|XP_002310195.1|  hypothetical protein POPTR_0007s12160g             190   1e-52    Populus trichocarpa [western balsam poplar]
ref|XP_010069058.1|  PREDICTED: BTB/POZ domain-containing protein...    190   1e-52    Eucalyptus grandis [rose gum]
ref|XP_008241873.1|  PREDICTED: BTB/POZ domain-containing protein...    190   1e-52    Prunus mume [ume]
ref|XP_007203630.1|  hypothetical protein PRUPE_ppa003965mg             189   1e-52    Prunus persica
ref|XP_011025688.1|  PREDICTED: BTB/POZ domain-containing protein...    189   1e-52    Populus euphratica
ref|XP_010069057.1|  PREDICTED: BTB/POZ domain-containing protein...    189   2e-52    Eucalyptus grandis [rose gum]
ref|XP_011085536.1|  PREDICTED: BTB/POZ domain-containing protein...    189   2e-52    Sesamum indicum [beniseed]
ref|XP_008338182.1|  PREDICTED: BTB/POZ domain-containing protein...    189   3e-52    
ref|XP_011009912.1|  PREDICTED: BTB/POZ domain-containing protein...    188   3e-52    Populus euphratica
ref|XP_008808898.1|  PREDICTED: BTB/POZ domain-containing protein...    188   4e-52    Phoenix dactylifera
ref|XP_002307226.1|  hypothetical protein POPTR_0005s13800g             188   5e-52    Populus trichocarpa [western balsam poplar]
ref|XP_009398931.1|  PREDICTED: BTB/POZ domain-containing protein...    188   7e-52    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB17837.1|  hypothetical protein B456_003G018200                    187   8e-52    Gossypium raimondii
emb|CDY08328.1|  BnaC09g12680D                                          187   9e-52    Brassica napus [oilseed rape]
ref|XP_010941741.1|  PREDICTED: BTB/POZ domain-containing protein...    187   9e-52    Elaeis guineensis
ref|XP_009388509.1|  PREDICTED: BTB/POZ domain-containing protein...    187   1e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009776607.1|  PREDICTED: BTB/POZ domain-containing protein...    187   1e-51    Nicotiana sylvestris
ref|XP_009112778.1|  PREDICTED: BTB/POZ domain-containing protein...    187   1e-51    Brassica rapa
ref|XP_010029862.1|  PREDICTED: BTB/POZ domain-containing protein...    187   1e-51    
ref|XP_009379165.1|  PREDICTED: BTB/POZ domain-containing protein...    187   2e-51    Pyrus x bretschneideri [bai li]
gb|KHG25971.1|  hypothetical protein F383_06642                         187   2e-51    Gossypium arboreum [tree cotton]
emb|CDY38217.1|  BnaA09g11720D                                          186   3e-51    Brassica napus [oilseed rape]
gb|EMT31851.1|  hypothetical protein F775_21356                         186   4e-51    
ref|XP_008797004.1|  PREDICTED: BTB/POZ domain-containing protein...    186   4e-51    Phoenix dactylifera
ref|XP_002522395.1|  protein binding protein, putative                  186   4e-51    Ricinus communis
dbj|BAJ95813.1|  predicted protein                                      184   8e-51    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006338266.1|  PREDICTED: BTB/POZ domain-containing protein...    185   8e-51    Solanum tuberosum [potatoes]
gb|ABG22069.1|  expressed protein                                       184   8e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407677.1|  PREDICTED: BTB/POZ domain-containing protein...    184   9e-51    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA99196.2|  expressed protein                                       184   1e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007156002.1|  hypothetical protein PHAVU_003G250400g             185   1e-50    Phaseolus vulgaris [French bean]
ref|XP_004963062.1|  PREDICTED: BTB/POZ domain-containing protein...    184   1e-50    Setaria italica
ref|XP_004503685.1|  PREDICTED: BTB/POZ domain-containing protein...    186   1e-50    Cicer arietinum [garbanzo]
ref|XP_004232086.1|  PREDICTED: BTB/POZ domain-containing protein...    184   1e-50    Solanum lycopersicum
gb|KDP31825.1|  hypothetical protein JCGZ_12286                         184   1e-50    Jatropha curcas
ref|XP_007047072.1|  Cell division protease ftsH isoform 1              184   2e-50    
ref|XP_009629328.1|  PREDICTED: BTB/POZ domain-containing protein...    184   2e-50    Nicotiana tomentosiformis
ref|XP_004141951.1|  PREDICTED: BTB/POZ domain-containing protein...    184   2e-50    
gb|EMT14102.1|  hypothetical protein F775_07870                         183   2e-50    
ref|XP_004160488.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    184   2e-50    
dbj|BAK06120.1|  predicted protein                                      183   2e-50    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010680938.1|  PREDICTED: BTB/POZ domain-containing protein...    183   3e-50    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006664162.1|  PREDICTED: BTB/POZ domain-containing protein...    182   4e-50    Oryza brachyantha
emb|CDP02424.1|  unnamed protein product                                182   5e-50    Coffea canephora [robusta coffee]
ref|XP_010930640.1|  PREDICTED: BTB/POZ domain-containing protein...    181   6e-50    
ref|XP_008338977.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    182   8e-50    
ref|XP_011099262.1|  PREDICTED: BTB/POZ domain-containing protein...    182   8e-50    
ref|XP_008440171.1|  PREDICTED: BTB/POZ domain-containing protein...    182   8e-50    Cucumis melo [Oriental melon]
gb|EMS65337.1|  hypothetical protein TRIUR3_32744                       181   2e-49    Triticum urartu
gb|EAY91984.1|  hypothetical protein OsI_13674                          180   3e-49    Oryza sativa Indica Group [Indian rice]
ref|NP_001051395.1|  Os03g0769400                                       180   5e-49    
gb|EEE53535.1|  hypothetical protein OsJ_36742                          184   6e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010097900.1|  BTB/POZ domain-containing protein                  179   6e-49    Morus notabilis
ref|XP_004300583.1|  PREDICTED: BTB/POZ domain-containing protein...    179   7e-49    Fragaria vesca subsp. vesca
ref|XP_010558026.1|  PREDICTED: BTB/POZ domain-containing protein...    179   1e-48    Tarenaya hassleriana [spider flower]
ref|XP_003558813.1|  PREDICTED: BTB/POZ domain-containing protein...    177   3e-48    Brachypodium distachyon [annual false brome]
ref|XP_008665486.1|  PREDICTED: BTB/POZ domain-containing protein...    178   3e-48    Zea mays [maize]
gb|KHN36167.1|  BTB/POZ domain-containing protein                       177   6e-48    Glycine soja [wild soybean]
ref|XP_003517262.1|  PREDICTED: BTB/POZ domain-containing protein...    177   7e-48    
ref|XP_007156873.1|  hypothetical protein PHAVU_002G024700g             176   7e-48    Phaseolus vulgaris [French bean]
ref|XP_004981619.1|  PREDICTED: BTB/POZ domain-containing protein...    176   1e-47    
ref|XP_010547478.1|  PREDICTED: BTB/POZ domain-containing protein...    175   2e-47    
ref|XP_008808496.1|  PREDICTED: BTB/POZ domain-containing protein...    171   2e-47    
ref|XP_009419041.1|  PREDICTED: BTB/POZ domain-containing protein...    175   4e-47    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397738.1|  PREDICTED: BTB/POZ domain-containing protein...    174   4e-47    
ref|XP_002461387.1|  hypothetical protein SORBIDRAFT_02g001910          174   6e-47    Sorghum bicolor [broomcorn]
gb|KHN42029.1|  BTB/POZ domain-containing protein                       174   7e-47    Glycine soja [wild soybean]
ref|XP_009407431.1|  PREDICTED: BTB/POZ domain-containing protein...    174   9e-47    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003537445.1|  PREDICTED: BTB/POZ domain-containing protein...    173   1e-46    Glycine max [soybeans]
ref|XP_006657417.1|  PREDICTED: BTB/POZ domain-containing protein...    172   2e-46    Oryza brachyantha
ref|NP_190647.1|  uncharacterized protein                               172   2e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877770.1|  hypothetical protein ARALYDRAFT_323639             172   2e-46    Arabidopsis lyrata subsp. lyrata
ref|NP_001058798.2|  Os07g0123500                                       172   3e-46    
ref|XP_002968764.1|  hypothetical protein SELMODRAFT_90136              171   3e-46    
ref|XP_006419030.1|  hypothetical protein EUTSA_v10003115mg             169   5e-46    
ref|XP_006856144.1|  hypothetical protein AMTR_s00059p00166010          172   1e-45    Amborella trichopoda
gb|KFK34324.1|  hypothetical protein AALP_AA5G130100                    171   1e-45    Arabis alpina [alpine rockcress]
ref|XP_006650658.1|  PREDICTED: BTB/POZ domain-containing protein...    170   2e-45    Oryza brachyantha
ref|XP_003557600.1|  PREDICTED: BTB/POZ domain-containing protein...    170   2e-45    Brachypodium distachyon [annual false brome]
ref|XP_006290909.1|  hypothetical protein CARUB_v10017022mg             170   3e-45    Capsella rubella
ref|XP_010515449.1|  PREDICTED: BTB/POZ domain-containing protein...    169   3e-45    Camelina sativa [gold-of-pleasure]
ref|XP_010426621.1|  PREDICTED: BTB/POZ domain-containing protein...    169   3e-45    Camelina sativa [gold-of-pleasure]
ref|XP_010503746.1|  PREDICTED: BTB/POZ domain-containing protein...    169   4e-45    Camelina sativa [gold-of-pleasure]
ref|XP_009123089.1|  PREDICTED: BTB/POZ domain-containing protein...    164   7e-45    Brassica rapa
ref|XP_002990647.1|  hypothetical protein SELMODRAFT_185507             168   1e-44    
ref|XP_003578818.1|  PREDICTED: BTB/POZ domain-containing protein...    167   2e-44    Brachypodium distachyon [annual false brome]
emb|CDX77944.1|  BnaA09g31390D                                          165   1e-43    
ref|XP_004955396.1|  PREDICTED: BTB/POZ domain-containing protein...    164   5e-43    Setaria italica
gb|ACR38622.1|  unknown                                                 160   2e-42    Zea mays [maize]
ref|NP_001168062.1|  hypothetical protein                               161   4e-42    Zea mays [maize]
gb|EEC68972.1|  hypothetical protein OsI_37717                          161   4e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_008661718.1|  PREDICTED: BTB/POZ domain-containing protein...    160   7e-42    
ref|XP_004977185.1|  PREDICTED: BTB/POZ domain-containing protein...    160   7e-42    Setaria italica
ref|XP_002441940.1|  hypothetical protein SORBIDRAFT_08g005240          159   2e-41    Sorghum bicolor [broomcorn]
gb|KDP42606.1|  hypothetical protein JCGZ_24380                         158   5e-41    Jatropha curcas
tpg|DAA55480.1|  TPA: hypothetical protein ZEAMMB73_593940              157   7e-41    
ref|XP_008674412.1|  PREDICTED: BTB/POZ domain-containing protein...    157   7e-41    Zea mays [maize]
ref|XP_002463555.1|  hypothetical protein SORBIDRAFT_01g001870          157   1e-40    Sorghum bicolor [broomcorn]
ref|XP_006652006.1|  PREDICTED: BTB/POZ domain-containing protein...    156   2e-40    Oryza brachyantha
emb|CDP04696.1|  unnamed protein product                                156   2e-40    Coffea canephora [robusta coffee]
ref|XP_009408313.1|  PREDICTED: BTB/POZ domain-containing protein...    156   3e-40    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001052356.1|  Os04g0278000                                       155   4e-40    
gb|EEE60654.1|  hypothetical protein OsJ_14104                          155   4e-40    Oryza sativa Japonica Group [Japonica rice]
emb|CAE05100.3|  OSJNBa0009K15.20                                       155   4e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002526636.1|  transcription regulator, putative                  155   7e-40    Ricinus communis
gb|EEC76923.1|  hypothetical protein OsI_15177                          154   2e-39    Oryza sativa Indica Group [Indian rice]
ref|XP_010270422.1|  PREDICTED: BTB/POZ domain-containing protein...    152   5e-39    Nelumbo nucifera [Indian lotus]
gb|ABR25351.1|  f13j11 prli-interacting factor g                        147   9e-39    Oryza sativa Indica Group [Indian rice]
ref|XP_009371391.1|  PREDICTED: BTB/POZ domain-containing protein...    152   9e-39    Pyrus x bretschneideri [bai li]
ref|XP_004288347.1|  PREDICTED: BTB/POZ domain-containing protein...    150   2e-38    Fragaria vesca subsp. vesca
ref|XP_006382844.1|  PRLI-interacting factor family protein             150   3e-38    Populus trichocarpa [western balsam poplar]
ref|XP_009420181.1|  PREDICTED: BTB/POZ domain-containing protein...    150   3e-38    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003522489.1|  PREDICTED: BTB/POZ domain-containing protein...    150   4e-38    Glycine max [soybeans]
ref|XP_002310504.1|  PRLI-interacting factor family protein             150   4e-38    Populus trichocarpa [western balsam poplar]
ref|XP_010090851.1|  hypothetical protein L484_020711                   150   6e-38    
ref|XP_004981110.1|  PREDICTED: BTB/POZ domain-containing protein...    149   9e-38    Setaria italica
gb|AER41644.1|  H-BTB6+-+Bric-a-Brac+Tramtrack+Broad+Complex            148   2e-37    Oryza punctata
ref|XP_002274417.2|  PREDICTED: BTB/POZ domain-containing protein...    148   2e-37    Vitis vinifera
ref|XP_011032338.1|  PREDICTED: BTB/POZ domain-containing protein...    148   2e-37    Populus euphratica
gb|EYU23772.1|  hypothetical protein MIMGU_mgv1a004643mg                147   3e-37    Erythranthe guttata [common monkey flower]
ref|XP_011022992.1|  PREDICTED: BTB/POZ domain-containing protein...    147   4e-37    Populus euphratica
ref|XP_011022991.1|  PREDICTED: BTB/POZ domain-containing protein...    147   5e-37    Populus euphratica
ref|XP_011022990.1|  PREDICTED: BTB/POZ domain-containing protein...    147   5e-37    
ref|XP_010911628.1|  PREDICTED: BTB/POZ domain-containing protein...    147   5e-37    
ref|XP_006658455.1|  PREDICTED: BTB/POZ domain-containing protein...    147   5e-37    
ref|XP_011022989.1|  PREDICTED: BTB/POZ domain-containing protein...    147   5e-37    
gb|EYU39382.1|  hypothetical protein MIMGU_mgv1a003833mg                147   6e-37    
ref|XP_010674448.1|  PREDICTED: BTB/POZ domain-containing protein...    147   6e-37    
ref|XP_008391261.1|  PREDICTED: BTB/POZ domain-containing protein...    146   7e-37    
gb|AER41577.1|  H-BTB6+-+Bric-a-Brac+Tramtrack+Broad+Complex            147   7e-37    
ref|XP_010260492.1|  PREDICTED: BTB/POZ domain-containing protein...    146   8e-37    
ref|NP_001059321.1|  Os07g0259700                                       146   1e-36    
gb|AER41599.1|  H-BTB6+-+Bric-a-Brac+Tramtrack+Broad+Complex            146   1e-36    
gb|EEC81823.1|  hypothetical protein OsI_25568                          146   1e-36    
ref|XP_011099746.1|  PREDICTED: BTB/POZ domain-containing protein...    145   2e-36    
ref|NP_001066330.2|  Os12g0188500                                       145   2e-36    
ref|XP_008810890.1|  PREDICTED: BTB/POZ domain-containing protein...    145   3e-36    
ref|XP_003602605.1|  PRLI-interacting factor G                          144   4e-36    
gb|KHN09608.1|  BTB/POZ domain-containing protein                       143   4e-36    
ref|XP_004502936.1|  PREDICTED: BTB/POZ domain-containing protein...    144   4e-36    
ref|XP_010530603.1|  PREDICTED: BTB/POZ domain-containing protein...    144   6e-36    
gb|AER41618.1|  H-BTB6+-+Bric-a-Brac+Tramtrack+Broad+Complex            144   6e-36    
ref|XP_010921714.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    144   6e-36    
gb|AER41562.1|  H-BTB6+-+Bric-a-Brac+Tramtrack+Broad+Complex+BTB+...    143   8e-36    
ref|XP_007137719.1|  hypothetical protein PHAVU_009G150200g             142   1e-35    
gb|KHN34076.1|  BTB/POZ domain-containing protein                       141   1e-35    
ref|XP_008813050.1|  PREDICTED: transcriptional corepressor SEUSS...    145   2e-35    
ref|XP_010236706.1|  PREDICTED: BTB/POZ domain-containing protein...    142   2e-35    
gb|KCW54229.1|  hypothetical protein EUGRSUZ_I00209                     141   5e-35    
ref|XP_003525121.1|  PREDICTED: BTB/POZ domain-containing protein...    141   5e-35    
ref|XP_004249906.1|  PREDICTED: BTB/POZ domain-containing protein...    141   5e-35    
ref|XP_010027662.1|  PREDICTED: BTB/POZ domain-containing protein...    141   5e-35    
emb|CDX77942.1|  BnaA09g31370D                                          137   5e-35    
ref|XP_003528047.1|  PREDICTED: BTB/POZ domain-containing protein...    140   1e-34    
gb|AAM62951.1|  unknown                                                 140   1e-34    
ref|XP_006409677.1|  hypothetical protein EUTSA_v10022633mg             140   1e-34    
ref|NP_001168236.1|  uncharacterized protein LOC100381996               140   1e-34    
gb|AAG31650.1|  PRLI-interacting factor G                               134   2e-34    
ref|XP_009621021.1|  PREDICTED: BTB/POZ domain-containing protein...    139   2e-34    
ref|XP_010518373.1|  PREDICTED: BTB/POZ domain-containing protein...    139   4e-34    
ref|XP_008441052.1|  PREDICTED: BTB/POZ domain-containing protein...    138   5e-34    
gb|KJB75244.1|  hypothetical protein B456_012G034300                    138   5e-34    
ref|XP_007048381.1|  BTB/POZ domain-containing protein                  138   5e-34    
ref|XP_009761422.1|  PREDICTED: BTB/POZ domain-containing protein...    138   5e-34    
ref|XP_010467198.1|  PREDICTED: BTB/POZ domain-containing protein...    138   7e-34    
gb|EAZ19878.1|  hypothetical protein OsJ_35462                          135   8e-34    
ref|XP_002461792.1|  hypothetical protein SORBIDRAFT_02g008100          137   2e-33    
gb|KFK39948.1|  hypothetical protein AALP_AA3G310200                    137   2e-33    
ref|XP_004955926.1|  PREDICTED: BTB/POZ domain-containing protein...    137   2e-33    
gb|KDO58322.1|  hypothetical protein CISIN_1g041685mg                   136   2e-33    
gb|EMS54561.1|  hypothetical protein TRIUR3_19355                       134   2e-33    
gb|KHG17707.1|  BTB/POZ domain-containing -like protein                 136   3e-33    
dbj|BAJ92340.1|  predicted protein                                      136   3e-33    
ref|XP_006432236.1|  hypothetical protein CICLE_v10000740mg             135   4e-33    
gb|KJB31299.1|  hypothetical protein B456_005G184700                    130   5e-33    
emb|CDX77940.1|  BnaA09g31350D                                          131   7e-33    
ref|XP_006297356.1|  hypothetical protein CARUB_v10013376mg             134   1e-32    
ref|NP_565358.1|  putative PRLI-interacting factor                      134   1e-32    
ref|XP_002885891.1|  predicted protein                                  134   1e-32    
dbj|BAC42262.2|  putative f13j11 PRLI-interacting factor G              134   1e-32    
ref|XP_007159837.1|  hypothetical protein PHAVU_002G271800g             134   2e-32    
ref|NP_001131215.1|  uncharacterized protein LOC100192523               132   2e-32    
ref|XP_008667091.1|  PREDICTED: uncharacterized protein LOC100192...    132   5e-32    
tpg|DAA39782.1|  TPA: hypothetical protein ZEAMMB73_443114              132   1e-31    
ref|NP_001146083.1|  hypothetical protein                               132   1e-31    
gb|EEE66912.1|  hypothetical protein OsJ_23760                          130   2e-31    
ref|XP_004165785.1|  PREDICTED: BTB/POZ domain-containing protein...    130   4e-31    
ref|XP_004148656.1|  PREDICTED: BTB/POZ domain-containing protein...    130   5e-31    
ref|XP_003557322.1|  PREDICTED: BTB/POZ domain-containing protein...    128   2e-30    
gb|EPS71598.1|  hypothetical protein M569_03162                         128   2e-30    
gb|EMT16879.1|  hypothetical protein F775_15389                         122   9e-29    
ref|XP_006858409.1|  hypothetical protein AMTR_s00071p00043690          112   3e-25    
ref|XP_007040317.1|  BTB/POZ domain-containing protein isoform 3        114   4e-25    
ref|XP_009124801.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    111   1e-24    
emb|CDX71164.1|  BnaC07g04430D                                        98.2    6e-20    
ref|XP_010490213.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    5e-19    
ref|XP_002442447.1|  hypothetical protein SORBIDRAFT_08g020150        92.0    1e-17    
emb|CDY31013.1|  BnaC04g24110D                                        79.0    3e-13    
emb|CDY31012.1|  BnaC04g24120D                                        70.9    8e-12    
ref|XP_004979604.1|  PREDICTED: stress response protein NST1-like...  69.3    4e-10    
ref|XP_004979605.1|  PREDICTED: stress response protein NST1-like...  68.9    4e-10    
ref|XP_004979606.1|  PREDICTED: stress response protein NST1-like...  68.6    6e-10    
emb|CDX73793.1|  BnaC08g22100D                                        60.5    1e-08    
tpg|DAA61073.1|  TPA: hypothetical protein ZEAMMB73_238708            53.9    4e-05    
ref|XP_003560455.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    2e-04    
ref|XP_009793569.1|  PREDICTED: uncharacterized protein LOC104240425  51.6    3e-04    
dbj|BAJ99609.1|  predicted protein                                    50.8    6e-04    
ref|XP_008668796.1|  PREDICTED: uncharacterized protein LOC103645868  48.5    8e-04    



>ref|XP_002281741.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Vitis 
vinifera]
 ref|XP_010651088.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Vitis 
vinifera]
 emb|CBI16228.3| unnamed protein product [Vitis vinifera]
Length=499

 Score =   356 bits (913),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 205/229 (90%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLR++ PDN+    +S+D LY+LCH CL+SL+LC SEATC DES +DRG +M EIARE
Sbjct  271  SRLLRDEAPDNSDRHDVSKDTLYHLCHRCLSSLVLCLSEATCTDESIRDRGAIMSEIARE  330

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIV+ILI++KMG++FV LWADQKELA LHSKIPTMYRHEIS+ITAQLC+AIGRGH
Sbjct  331  ADNMQWIVNILIDKKMGEDFVKLWADQKELAVLHSKIPTMYRHEISKITAQLCIAIGRGH  390

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            LLVPKD RFSLLSTWLEALYEDF WMRRACRS+DK LVEDGLSQTILTLPLPQQQAI+L 
Sbjct  391  LLVPKDTRFSLLSTWLEALYEDFAWMRRACRSVDKKLVEDGLSQTILTLPLPQQQAILLT  450

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFLNKGDDCPNIQ+AF+VWWRRAFI+QYV E   SQLQI +CDY N
Sbjct  451  WFDRFLNKGDDCPNIQRAFEVWWRRAFIRQYVSEHDNSQLQITVCDYPN  499



>ref|XP_010092990.1| hypothetical protein L484_007171 [Morus notabilis]
 gb|EXB53228.1| hypothetical protein L484_007171 [Morus notabilis]
Length=312

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 202/229 (88%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRED P N     IS+D LY+LCH C++SL+LC SEAT  DE+ +DRGV+MGEIARE
Sbjct  84   SRLLREDEPSNNNRIDISKDTLYHLCHRCISSLVLCLSEATSADETCRDRGVLMGEIARE  143

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDIL+E+KM DEFV LWADQKELA +HSKIPTMYRHEISRITAQLC+AIGRGH
Sbjct  144  ADNMQWIVDILVEKKMADEFVKLWADQKELAIMHSKIPTMYRHEISRITAQLCIAIGRGH  203

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVP+DARFSLLSTWLEALYEDFGWMRRA RS+DK LVED L QTILTLPLPQQQ I+LN
Sbjct  204  ILVPQDARFSLLSTWLEALYEDFGWMRRASRSVDKKLVEDALGQTILTLPLPQQQTILLN  263

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFLNKGDDCPN Q+AF++WWRRAFI++Y+ E   SQLQI +CDY+N
Sbjct  264  WFDRFLNKGDDCPNFQRAFEIWWRRAFIREYMSERDNSQLQITICDYSN  312



>ref|XP_009610322.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nicotiana 
tomentosiformis]
Length=503

 Score =   345 bits (886),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 203/229 (89%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT-------ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEI  601
            SRLLRE+  +++       ISRD LY+ CH CL SL+LC SEAT  D++ +DRGV+MGEI
Sbjct  275  SRLLRENASNSSSRESNLDISRDSLYHFCHRCLTSLILCLSEATSADDNRQDRGVLMGEI  334

Query  600  AREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIG  421
            AREADN+QW+VDILI+RKMGDEFV+LWA+QKEL+ LHSKIPTMYRHEIS+ITAQLCVAIG
Sbjct  335  AREADNLQWLVDILIDRKMGDEFVNLWAEQKELSVLHSKIPTMYRHEISKITAQLCVAIG  394

Query  420  RGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAI  241
            RG+LLVPK+ R+SLLSTWLE+LYEDFGWM+RA RSIDK LVE+GL QTILTLPL QQQ I
Sbjct  395  RGNLLVPKEVRYSLLSTWLESLYEDFGWMKRAGRSIDKKLVEEGLGQTILTLPLAQQQTI  454

Query  240  MLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYTN  94
            +LNWFDRFLNKGDDCPNIQ+AF++WWRR+F+KQY  +SQLQIALCDYT+
Sbjct  455  LLNWFDRFLNKGDDCPNIQRAFEIWWRRSFVKQYTVDSQLQIALCDYTD  503



>emb|CDP08962.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 203/229 (89%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT-------ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEI  601
            SRLL+E+  D+        ISRD LY+LCH CL+SL+LC SEATCV+E  +DRG +M EI
Sbjct  311  SRLLKEESSDHRSLNNSLDISRDTLYHLCHRCLSSLILCLSEATCVEEGRQDRGFLMSEI  370

Query  600  AREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIG  421
            AREADN+QW+VDIL++RK+GDEFV LWA+QKELA LHSKIPTMYRHEISRITAQLCVAIG
Sbjct  371  AREADNMQWVVDILVDRKLGDEFVKLWAEQKELAVLHSKIPTMYRHEISRITAQLCVAIG  430

Query  420  RGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAI  241
            RGH+LVP+D R+SLLSTWLEALYEDFGWMRRA RS+DK LVEDGLSQTILTLPLPQQQAI
Sbjct  431  RGHILVPRDTRYSLLSTWLEALYEDFGWMRRASRSVDKKLVEDGLSQTILTLPLPQQQAI  490

Query  240  MLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYTN  94
            +LNWFDRFLNKGDDCPN+Q+AF+VWWRR+FIKQYV ESQLQ+ + D +N
Sbjct  491  LLNWFDRFLNKGDDCPNLQRAFEVWWRRSFIKQYVVESQLQLTVYDNSN  539



>ref|XP_010685873.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Beta 
vulgaris subsp. vulgaris]
Length=508

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 201/231 (87%), Gaps = 9/231 (4%)
 Frame = -2

Query  759  SRLLREDVPDNT-------ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEI  601
            SRLLREDV D +       +SRD LY+LCH CL++L+LC SEATC+DES ++RG +M EI
Sbjct  278  SRLLREDVADFSTYGPKIDVSRDTLYSLCHRCLSALILCLSEATCMDESRQERGAIMAEI  337

Query  600  AREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIG  421
            AREADN+QWIVDILI++KMGDEFV LWADQKELA LHSKIPTMYRHEISR+TAQLC+AIG
Sbjct  338  AREADNMQWIVDILIDKKMGDEFVKLWADQKELAILHSKIPTMYRHEISRVTAQLCIAIG  397

Query  420  RGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAI  241
            RGH+LVPK+ R+SLLSTWLE LYEDFGWM+RA R +DK +VEDGLSQTILTLP+ QQQ+I
Sbjct  398  RGHILVPKETRYSLLSTWLEPLYEDFGWMKRANRFVDKKVVEDGLSQTILTLPISQQQSI  457

Query  240  MLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVP--ESQLQIALCDYTN  94
            ++NWFDRFL KGDDCPNIQKAF++WWRRAFI+QYVP  +  +QI +CDY +
Sbjct  458  LMNWFDRFLTKGDDCPNIQKAFEIWWRRAFIRQYVPDQDQHMQITVCDYND  508



>gb|KDP44149.1| hypothetical protein JCGZ_05616 [Jatropha curcas]
Length=510

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 198/229 (86%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRL RED  DN     +S+  LY+LCHGCL+SL+ C SEATC+D++ +DRG +M EIARE
Sbjct  282  SRLFREDSSDNDSRLDVSKSTLYSLCHGCLSSLVFCLSEATCMDDAKRDRGGLMNEIARE  341

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            A+N+QWI DILI++K  DEFV LWADQKELASLH K+PT+YRHEIS+ITAQLC+AIGRG 
Sbjct  342  AENLQWIADILIDKKAADEFVKLWADQKELASLHPKVPTIYRHEISKITAQLCIAIGRGQ  401

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ RFSLLSTWLEALYEDFGW+RRAC+S+DK LVEDGL +TILTLPL QQQAI+LN
Sbjct  402  ILVPKETRFSLLSTWLEALYEDFGWIRRACKSVDKKLVEDGLGRTILTLPLLQQQAILLN  461

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFLNKGDDCPNIQ+AF+VWWRRAFI+QYV E   SQLQI +CDY N
Sbjct  462  WFDRFLNKGDDCPNIQRAFEVWWRRAFIRQYVGEQNNSQLQITVCDYPN  510



>ref|XP_009774422.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nicotiana 
sylvestris]
Length=502

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 193/210 (92%), Gaps = 0/210 (0%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            ISRD LY+LCH CL SL+LC SEAT  D++ +DRGV+MGEIAREADN+QW+VDILI+RKM
Sbjct  293  ISRDSLYHLCHRCLTSLILCLSEATSADDNRQDRGVLMGEIAREADNLQWLVDILIDRKM  352

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
            GDEFV+LWA+QKEL+ LHSKIPTMYRHEIS+ITAQLCVAIGRG+LLVPK+ R+SLLSTWL
Sbjct  353  GDEFVNLWAEQKELSVLHSKIPTMYRHEISKITAQLCVAIGRGNLLVPKEVRYSLLSTWL  412

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            E+LYEDFGWM+RA RSIDK LVE+GL QTILTLPL QQQ I+L WFDRFLNKGDDCPNIQ
Sbjct  413  ESLYEDFGWMKRAGRSIDKKLVEEGLGQTILTLPLAQQQTILLKWFDRFLNKGDDCPNIQ  472

Query  183  KAFQVWWRRAFIKQYVPESQLQIALCDYTN  94
            +AF++WWRR+F+KQY  +SQLQ+ALCDYT+
Sbjct  473  RAFEIWWRRSFVKQYTVDSQLQLALCDYTD  502



>ref|XP_006424700.1| hypothetical protein CICLE_v10028213mg [Citrus clementina]
 ref|XP_006488215.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Citrus 
sinensis]
 gb|ESR37940.1| hypothetical protein CICLE_v10028213mg [Citrus clementina]
Length=520

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 195/227 (86%), Gaps = 7/227 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRL+RED  +      +S+D LY+LCH CL SL+LC SEATC+D+S  DRG +M EIARE
Sbjct  292  SRLIREDASNYENRLDVSKDTLYSLCHRCLGSLILCLSEATCIDDSKGDRGALMAEIARE  351

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QW+VDILI+++M DEFV LWADQKELA LH KIPTMYRHEISRITAQLC+AIGRGH
Sbjct  352  ADNMQWLVDILIDKRMCDEFVKLWADQKELAILHCKIPTMYRHEISRITAQLCIAIGRGH  411

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPKD RFSLLSTWLEALYEDFGWMRRA RS+D+ LVEDGLSQTILTLP+ QQQAI+LN
Sbjct  412  ILVPKDTRFSLLSTWLEALYEDFGWMRRASRSVDRKLVEDGLSQTILTLPMLQQQAILLN  471

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDY  100
            WFDRFLNKG DCPNIQKAF++WWRRAFI+QY  +   S LQI +CDY
Sbjct  472  WFDRFLNKGGDCPNIQKAFEIWWRRAFIRQYSADQDSSHLQITVCDY  518



>gb|KDO73042.1| hypothetical protein CISIN_1g010024mg [Citrus sinensis]
Length=520

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 195/227 (86%), Gaps = 7/227 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRL+RED  +      +S+D LY+LCH CL SL+LC SEATC+D+S  DRG +M EIARE
Sbjct  292  SRLIREDASNYENRLDVSKDTLYSLCHRCLGSLILCLSEATCIDDSKGDRGALMAEIARE  351

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QW+VDILI+++M DEFV LWADQ+ELA LH KIPTMYRHEISRITAQLC+AIGRGH
Sbjct  352  ADNMQWLVDILIDKRMCDEFVKLWADQRELAILHCKIPTMYRHEISRITAQLCIAIGRGH  411

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPKD RFSLLSTWLEALYEDFGWMRRA RS+D+ LVEDGLSQTILTLPL QQQAI+LN
Sbjct  412  ILVPKDTRFSLLSTWLEALYEDFGWMRRASRSVDRKLVEDGLSQTILTLPLLQQQAILLN  471

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDY  100
            WFDRFLNKG DCPNIQKAF++WWRRAFI+QY  +   S LQI +CDY
Sbjct  472  WFDRFLNKGGDCPNIQKAFEIWWRRAFIRQYSADQDSSHLQITVCDY  518



>ref|XP_011089383.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
 ref|XP_011089384.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
 ref|XP_011089385.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
Length=511

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 197/227 (87%), Gaps = 6/227 (3%)
 Frame = -2

Query  756  RLLREDVPDNT------ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAR  595
            RLLRED  +NT      ISRD LY+LCH CL+SL+LC S ATC+DES +DRG +M EIAR
Sbjct  285  RLLREDCNNNTFQNKLDISRDTLYHLCHRCLSSLILCLSGATCLDESERDRGTLMAEIAR  344

Query  594  EADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRG  415
            EADN QWIV ILI+RKMGDEFV LWADQKELA LHSKIPT+YRHEIS+ITAQLC++IG+G
Sbjct  345  EADNTQWIVSILIDRKMGDEFVKLWADQKELAVLHSKIPTIYRHEISKITAQLCISIGKG  404

Query  414  HLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIML  235
             +LVPK+ RF+LLSTWLEALY+DF WMR A +S+D+ L+E+GLSQTILTLPLPQQQ+++L
Sbjct  405  EVLVPKETRFALLSTWLEALYDDFKWMRMAGKSVDRKLIEEGLSQTILTLPLPQQQSLLL  464

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYTN  94
            NWFDRFLN+GDDCPNIQ AF++WWRRAF+KQYV +SQLQI +CD  N
Sbjct  465  NWFDRFLNRGDDCPNIQTAFEIWWRRAFVKQYVVDSQLQITVCDIPN  511



>ref|XP_004251284.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Solanum 
lycopersicum]
Length=498

 Score =   330 bits (845),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 199/229 (87%), Gaps = 8/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT-------ISRDMLYNLCHGCLNSLLLCASEATCVDES-GKDRGVVMGE  604
            SRLLRE+  +++       ISRD LY+ CH CL SL+L  SEAT VD++  +DRGV+MGE
Sbjct  269  SRLLRENTSNSSSHESNLDISRDTLYHFCHRCLTSLILSLSEATSVDDNRQQDRGVLMGE  328

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IAREADN+QW+VDILI+RKMGDEFV LWA+QKEL+ LHSKIPTMYRHEIS+ITAQLC+AI
Sbjct  329  IAREADNLQWLVDILIDRKMGDEFVKLWAEQKELSILHSKIPTMYRHEISKITAQLCIAI  388

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG+LLVPKD R+ LLSTWLE+LY+DFGWM+RA RSIDK LVE+GL QTILTLPL QQQ 
Sbjct  389  GRGNLLVPKDVRYCLLSTWLESLYDDFGWMKRAGRSIDKKLVEEGLGQTILTLPLAQQQT  448

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYT  97
            I+LNWFDRFLNKGDDCPNIQ+AF+VWWRR+F+KQY  +SQLQ+A+ DYT
Sbjct  449  ILLNWFDRFLNKGDDCPNIQRAFEVWWRRSFVKQYTVDSQLQLAIFDYT  497



>ref|XP_006365150.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Solanum 
tuberosum]
Length=496

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 199/229 (87%), Gaps = 8/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT-------ISRDMLYNLCHGCLNSLLLCASEATCVDES-GKDRGVVMGE  604
            SRLLRE+  +++       ISRD LY+ CH CL SL+L  SEAT VD++  +DRGV+MGE
Sbjct  267  SRLLRENTSNSSSHESNLDISRDALYHFCHRCLTSLILSLSEATSVDDNRQQDRGVLMGE  326

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IAREADN+QW+VDILI+RKMGDEFV LWA+QKEL+ LHSKIPTMYRHEIS+ITAQLC+AI
Sbjct  327  IAREADNLQWLVDILIDRKMGDEFVKLWAEQKELSILHSKIPTMYRHEISKITAQLCIAI  386

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG+LLVPKD R+ LLSTWLE+LY+DFGWM+RA RSIDK LVE+GL QTILTLPL QQQ 
Sbjct  387  GRGNLLVPKDVRYCLLSTWLESLYDDFGWMKRAGRSIDKKLVEEGLGQTILTLPLAQQQT  446

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYT  97
            I+LNWFDRFLNKGDDCPNIQ+AF+VWWRR+F+KQY  +SQLQ+A+ DYT
Sbjct  447  ILLNWFDRFLNKGDDCPNIQRAFEVWWRRSFVKQYTVDSQLQLAIFDYT  495



>ref|XP_007132142.1| hypothetical protein PHAVU_011G070200g [Phaseolus vulgaris]
 gb|ESW04136.1| hypothetical protein PHAVU_011G070200g [Phaseolus vulgaris]
Length=494

 Score =   328 bits (841),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 198/229 (86%), Gaps = 8/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLL+E+ P+++    +S+D LY+LCH C++SLLLC SEAT  DE   DR VVM +I RE
Sbjct  267  SRLLKENAPNDSSRLDVSKDTLYHLCHKCISSLLLCLSEATNGDER-PDRAVVMSDITRE  325

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDILI +KMG+EFV++WA+QKELA+LHSK+PT+YRHEISRITAQLC+ IGRGH
Sbjct  326  ADNIQWIVDILIGKKMGEEFVEIWAEQKELATLHSKVPTVYRHEISRITAQLCIGIGRGH  385

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ RFSLLSTWLEALYEDFGWMRRA R++D+ LVEDGLSQTILTLPL QQQ ++LN
Sbjct  386  ILVPKEIRFSLLSTWLEALYEDFGWMRRASRTVDRKLVEDGLSQTILTLPLLQQQTVLLN  445

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFLNKGDDCPNIQKAF++WWRRAFI+QY  E   SQLQI L DY +
Sbjct  446  WFDRFLNKGDDCPNIQKAFEIWWRRAFIRQYSAEPDNSQLQITLSDYPS  494



>gb|KHN22018.1| BTB/POZ domain-containing protein [Glycine soja]
Length=233

 Score =   319 bits (817),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 196/229 (86%), Gaps = 8/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLL+E+V +++    +S+D LY+LCH C++SLLLC SEAT  DE   DRG ++ +I RE
Sbjct  6    SRLLKENVSNDSSRLDVSKDTLYHLCHKCISSLLLCLSEATSSDEK-LDRGAIISDITRE  64

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDILI +KM DEFV +WA+QKELA+LHSKI T+YRHEISRITAQLC+ IGRGH
Sbjct  65   ADNIQWIVDILIGKKMSDEFVKIWAEQKELATLHSKISTVYRHEISRITAQLCIGIGRGH  124

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ RFSLLSTWLEALYEDFGWMRRA R++D+ L+EDGLSQTILTLPL QQQ+++LN
Sbjct  125  ILVPKEIRFSLLSTWLEALYEDFGWMRRASRAVDRKLIEDGLSQTILTLPLLQQQSVLLN  184

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFLNKGDDCPNIQKAF++WWRRAFIKQY  E   SQLQI L DY +
Sbjct  185  WFDRFLNKGDDCPNIQKAFEIWWRRAFIKQYSAEPENSQLQITLSDYPS  233



>ref|XP_008222552.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Prunus 
mume]
Length=519

 Score =   328 bits (842),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 197/230 (86%), Gaps = 8/230 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT-----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAR  595
            SRLLRED    +     +S++ LY+LCH CL+SL+LC SEAT +D+S +DRGV+M EIAR
Sbjct  290  SRLLREDAASGSNNRLDVSKETLYHLCHRCLSSLVLCLSEATGMDDSRRDRGVLMAEIAR  349

Query  594  EADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRG  415
            EADN+QWIVDIL+++KMGDEFV LWADQKELA+LHSKIPTMYRHEISRITAQLC+AIG  
Sbjct  350  EADNMQWIVDILVDKKMGDEFVKLWADQKELAALHSKIPTMYRHEISRITAQLCIAIGSR  409

Query  414  HLLVPKDARFSLLSTWLEALYEDFGWMRRAC-RSIDKTLVEDGlsqtiltlplpqqQAIM  238
             LLVPK+ RFSLLSTWLEALYEDFGWMRRA  RSIDK LVE+G+SQTILTLPL QQQ I+
Sbjct  410  QLLVPKETRFSLLSTWLEALYEDFGWMRRASFRSIDKKLVEEGISQTILTLPLQQQQGIL  469

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE--SQLQIALCDYTN  94
            LNWFDRFLNKGDDCPNIQKAF+VWWRRAFIK    +  +QLQI +CDY +
Sbjct  470  LNWFDRFLNKGDDCPNIQKAFEVWWRRAFIKHVSEQENTQLQITVCDYPS  519



>ref|XP_007016614.1| BTB/POZ domain-containing protein [Theobroma cacao]
 gb|EOY34233.1| BTB/POZ domain-containing protein [Theobroma cacao]
Length=512

 Score =   328 bits (840),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 196/227 (86%), Gaps = 7/227 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            S+LLRED  D+     +S++ LY+LCH CL+SL+LC SEAT +D S +DRGV+M EIARE
Sbjct  284  SQLLREDSFDDDHRLDVSKETLYHLCHRCLSSLVLCLSEATGMDNSRRDRGVLMAEIARE  343

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDILI+++M ++FV LWADQ+ELA+LHSKIP MYRHEISRITAQLC+AIGRG+
Sbjct  344  ADNLQWIVDILIDKRMANDFVKLWADQRELAALHSKIPIMYRHEISRITAQLCIAIGRGN  403

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPKD+RFSLLSTWLEALYEDFGWMRRA RS+DK LVEDGLS+TILTL L QQQ I+L+
Sbjct  404  ILVPKDSRFSLLSTWLEALYEDFGWMRRASRSVDKKLVEDGLSKTILTLSLRQQQVILLS  463

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV---PESQLQIALCDY  100
            WFDRFLNKGDDCPNIQ AF+VWWRRAFI+QY      SQLQI +C Y
Sbjct  464  WFDRFLNKGDDCPNIQTAFEVWWRRAFIRQYTDVQDSSQLQITVCSY  510



>gb|KHG07032.1| hypothetical protein F383_02815 [Gossypium arboreum]
Length=504

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 195/229 (85%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRED  D+     +S+D LY+LCH CL+SL+LC SEAT +D S +DRGV+M EIARE
Sbjct  276  SRLLREDSFDDDNRFDVSKDTLYHLCHRCLSSLVLCLSEATAIDSSRRDRGVLMAEIARE  335

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDILIE++M ++FV LWADQ+ELA LHSKIPTMYRHEISRITAQLC+AIGRG+
Sbjct  336  ADNLQWIVDILIEKRMANDFVKLWADQRELAELHSKIPTMYRHEISRITAQLCIAIGRGN  395

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LV K++RF LL+TWLEALY+DFGWMRRA +S+DK LVEDGLS TILTL + QQQAI+L 
Sbjct  396  ILVGKESRFLLLATWLEALYDDFGWMRRASKSVDKKLVEDGLSHTILTLSMRQQQAILLK  455

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV---PESQLQIALCDYTN  94
            WFDRFLNKGDDCPNIQ+AF+VWWRRAFI+QY      SQLQI +C Y +
Sbjct  456  WFDRFLNKGDDCPNIQRAFEVWWRRAFIRQYTDAEDSSQLQITVCSYPS  504



>ref|XP_010260115.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nelumbo 
nucifera]
Length=560

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 194/211 (92%), Gaps = 3/211 (1%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            +S++ LY+LCH CL+SL+LC SEA  +DES +DRGV+M EIAREADN+QWIV+ILI++KM
Sbjct  348  VSKETLYHLCHRCLSSLILCLSEAASLDESRRDRGVLMAEIAREADNMQWIVEILIDKKM  407

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
            GDEFV+LWADQKELA LHSKIP+M+R+EISRITAQLC+A+GRG +LV K+ARFSLLSTWL
Sbjct  408  GDEFVNLWADQKELAILHSKIPSMFRYEISRITAQLCIAVGRGQILVSKEARFSLLSTWL  467

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            EALYEDFGWMRRACRS+DK LVEDGLSQTILTLP+ QQQAI+LNWFDRFL+KGDDCPN+Q
Sbjct  468  EALYEDFGWMRRACRSVDKKLVEDGLSQTILTLPMAQQQAILLNWFDRFLSKGDDCPNMQ  527

Query  183  KAFQVWWRRAFIKQYVP---ESQLQIALCDY  100
            +AF+VWWRRAFI+QY+    +SQLQI +CDY
Sbjct  528  RAFEVWWRRAFIRQYMADQDQSQLQITVCDY  558



>ref|XP_004294641.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Fragaria 
vesca subsp. vesca]
Length=515

 Score =   325 bits (833),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 198/228 (87%), Gaps = 7/228 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRED  +++    +S++ LY+LCH CL+SL+LC SEAT +DE  +DRG++M EIARE
Sbjct  289  SRLLREDSANDSNRLDVSKETLYHLCHRCLSSLVLCLSEATGMDEK-RDRGLLMAEIARE  347

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDI++++KMG++FV LWADQKELA LHSKIPTMYRHEIS+ITAQLC+AIG  H
Sbjct  348  ADNMQWIVDIMVDKKMGEDFVKLWADQKELAVLHSKIPTMYRHEISKITAQLCIAIGTRH  407

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            LLVPKD RFSLLSTWL+ALYEDFGWMRRA RS+DK LVE+GLSQTILTLPL QQQAIMLN
Sbjct  408  LLVPKDTRFSLLSTWLDALYEDFGWMRRASRSVDKKLVEEGLSQTILTLPLHQQQAIMLN  467

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPES--QLQIALCDYTN  94
            WFDRFLNKGDDCPNIQKAF+VWWRRAF+K    +   +LQI +CDY +
Sbjct  468  WFDRFLNKGDDCPNIQKAFEVWWRRAFVKHVAEQENHRLQITVCDYPS  515



>ref|XP_007205061.1| hypothetical protein PRUPE_ppa004481mg [Prunus persica]
 gb|EMJ06260.1| hypothetical protein PRUPE_ppa004481mg [Prunus persica]
Length=507

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 196/230 (85%), Gaps = 8/230 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT-----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAR  595
            SRLLRED    +     +S++ LY+LCH CL+SL+LC SEAT +D+S +DRGV+M EIAR
Sbjct  278  SRLLREDAASGSNNRLDVSKETLYHLCHRCLSSLVLCLSEATGMDDSRRDRGVLMAEIAR  337

Query  594  EADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRG  415
            EADN+QWIVDIL+++KMGDEFV LWADQKELA LHSKIPTMYRHEISRITAQLC+AIG  
Sbjct  338  EADNMQWIVDILVDKKMGDEFVKLWADQKELAVLHSKIPTMYRHEISRITAQLCIAIGSR  397

Query  414  HLLVPKDARFSLLSTWLEALYEDFGWMRRAC-RSIDKTLVEDGlsqtiltlplpqqQAIM  238
             LLVPK+ RFSLLSTWLEALYEDFGWMRRA  RS+DK LVE+G+SQTILTLPL QQQ I+
Sbjct  398  QLLVPKETRFSLLSTWLEALYEDFGWMRRASFRSVDKKLVEEGISQTILTLPLQQQQGIL  457

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE--SQLQIALCDYTN  94
            L+WFDRFLNKGDDCPNIQKAF+VWWRRAFIK    +  +QLQI +CDY +
Sbjct  458  LSWFDRFLNKGDDCPNIQKAFEVWWRRAFIKHVSEQENTQLQITVCDYPS  507



>gb|KHG05277.1| hypothetical protein F383_30980 [Gossypium arboreum]
Length=510

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 197/227 (87%), Gaps = 7/227 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRED  D      +S+D+LY+LCH CL SL+LC SEA C+D S +DRGV+M EIARE
Sbjct  282  SRLLREDSFDYNSRVDVSKDILYHLCHRCLCSLVLCLSEAMCMDSSRQDRGVLMAEIARE  341

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QW+VDILI+++M ++FV LWADQKELA LHSKIPTMYRHEISRITAQLC+AIGRG+
Sbjct  342  ADNLQWLVDILIDKRMANDFVKLWADQKELAELHSKIPTMYRHEISRITAQLCIAIGRGN  401

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPKD+RFSLLSTWL+ALYEDF WMRRA RS+DK L+E+GLSQTILTL L QQQ I+LN
Sbjct  402  ILVPKDSRFSLLSTWLDALYEDFRWMRRASRSVDKKLIEEGLSQTILTLSLRQQQVILLN  461

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQY--VPE-SQLQIALCDY  100
            WF RFLNKGDD PNIQ+AF+VWWRRAFI+QY  VP+ SQ+QI +C+Y
Sbjct  462  WFHRFLNKGDDYPNIQRAFEVWWRRAFIRQYADVPDSSQMQITICNY  508



>gb|KJB20225.1| hypothetical protein B456_003G139200 [Gossypium raimondii]
Length=513

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 193/229 (84%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRED  D+     +S+D LY+LCH CL+SL+LC SEA  +D S +DRGV+M EIARE
Sbjct  285  SRLLREDSFDDDNRFDVSKDTLYHLCHRCLSSLVLCLSEAMAIDGSRRDRGVLMAEIARE  344

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDILIE++M ++FV LWADQ+ELA LHSKIPTMYRH ISRITAQLC+AIGRG+
Sbjct  345  ADNLQWIVDILIEKRMANDFVKLWADQRELAELHSKIPTMYRHGISRITAQLCIAIGRGN  404

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LV K++RFSLL+TWLEALY+DFGWMR A +S+DK LVEDGLS TILTL + QQQAI+L 
Sbjct  405  ILVGKESRFSLLATWLEALYDDFGWMRSASKSVDKKLVEDGLSHTILTLSMRQQQAILLK  464

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV---PESQLQIALCDYTN  94
            WFDRFLNKGDDCPNIQ+AF+VWWRRAFI+QY      SQLQI +C Y +
Sbjct  465  WFDRFLNKGDDCPNIQRAFEVWWRRAFIRQYTDAEDSSQLQITVCSYPS  513



>ref|XP_010043649.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g60050 [Eucalyptus grandis]
Length=520

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 192/229 (84%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRE+  D +    +SRD LY+LCH CL+SL+LC SEA   DE  +DRG +M EIARE
Sbjct  292  SRLLREEASDCSSDIDVSRDSLYHLCHRCLSSLILCLSEAAGPDEKKRDRGTLMAEIARE  351

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADNV WIV+ILI++ MGDEFV LW DQKELA LHSKIPT+YRHEISR+TAQLCVA+G+G 
Sbjct  352  ADNVHWIVEILIDKNMGDEFVKLWGDQKELAILHSKIPTVYRHEISRVTAQLCVAMGKGL  411

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ R SLLSTWLEALYEDFGWMRRA RS+DK L+EDGL QTILTLPLPQQQAI LN
Sbjct  412  ILVPKNTRLSLLSTWLEALYEDFGWMRRASRSMDKKLLEDGLGQTILTLPLPQQQAIFLN  471

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDR+LNKGDDCP+IQKAF++WWRRAFI+Q+ PE   S LQI +C Y N
Sbjct  472  WFDRYLNKGDDCPDIQKAFEIWWRRAFIRQHGPELNNSHLQITVCGYPN  520



>ref|XP_006591005.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Glycine 
max]
Length=494

 Score =   320 bits (821),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 196/229 (86%), Gaps = 8/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLL+E+V +++    +S+D LY+LCH C++SLLLC SEAT  DE   DRG ++ +I RE
Sbjct  267  SRLLKENVSNDSSRLDVSKDTLYHLCHKCISSLLLCLSEATSSDEK-LDRGAIISDITRE  325

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDILI +KM DEFV +WA+QKELA+LHSKI T+YRHEISRITAQLC+ IGRGH
Sbjct  326  ADNIQWIVDILIGKKMSDEFVKIWAEQKELATLHSKISTVYRHEISRITAQLCIGIGRGH  385

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ RFSLLSTWLEALYEDFGWMRRA R++D+ L+EDGLSQTILTLPL QQQ+++LN
Sbjct  386  ILVPKEIRFSLLSTWLEALYEDFGWMRRASRAVDRKLIEDGLSQTILTLPLLQQQSVLLN  445

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFLNKGDDCPNIQKAF++WWRRAFIKQY  E   SQLQI L DY +
Sbjct  446  WFDRFLNKGDDCPNIQKAFEIWWRRAFIKQYSAEPENSQLQITLSDYPS  494



>gb|KCW85653.1| hypothetical protein EUGRSUZ_B02440 [Eucalyptus grandis]
Length=539

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 192/229 (84%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRE+  D +    +SRD LY+LCH CL+SL+LC SEA   DE  +DRG +M EIARE
Sbjct  311  SRLLREEASDCSSDIDVSRDSLYHLCHRCLSSLILCLSEAAGPDEKKRDRGTLMAEIARE  370

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADNV WIV+ILI++ MGDEFV LW DQKELA LHSKIPT+YRHEISR+TAQLCVA+G+G 
Sbjct  371  ADNVHWIVEILIDKNMGDEFVKLWGDQKELAILHSKIPTVYRHEISRVTAQLCVAMGKGL  430

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ R SLLSTWLEALYEDFGWMRRA RS+DK L+EDGL QTILTLPLPQQQAI LN
Sbjct  431  ILVPKNTRLSLLSTWLEALYEDFGWMRRASRSMDKKLLEDGLGQTILTLPLPQQQAIFLN  490

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDR+LNKGDDCP+IQKAF++WWRRAFI+Q+ PE   S LQI +C Y N
Sbjct  491  WFDRYLNKGDDCPDIQKAFEIWWRRAFIRQHGPELNNSHLQITVCGYPN  539



>ref|XP_002531830.1| protein binding protein, putative [Ricinus communis]
 gb|EEF30550.1| protein binding protein, putative [Ricinus communis]
Length=526

 Score =   321 bits (822),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 194/229 (85%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRL +ED  ++     IS+D LY+LCHGCL+SL+LC SEA C++++  DRG +M +I RE
Sbjct  298  SRLFKEDSSNHDNRLDISKDTLYSLCHGCLSSLILCLSEAACMNDARLDRGGLMSDIGRE  357

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            A+N+QWIVDILI+RK  +EFV LWADQKELA LHSKIPT+YRHEIS++TAQLC+AIGRG 
Sbjct  358  AENLQWIVDILIDRKAAEEFVKLWADQKELAVLHSKIPTLYRHEISKVTAQLCIAIGRGQ  417

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ RF LLSTWLE LY DFGW+RRAC+S+DK LVEDGL +TILTLPL QQQAI+LN
Sbjct  418  ILVPKETRFLLLSTWLEPLYADFGWIRRACKSVDKKLVEDGLGRTILTLPLLQQQAILLN  477

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV---PESQLQIALCDYTN  94
            WFDRFL+KGDDCPNIQ+AF+VWWRRAF++QYV     SQLQI +CDY N
Sbjct  478  WFDRFLSKGDDCPNIQRAFEVWWRRAFVRQYVDAQSNSQLQITVCDYPN  526



>gb|KHN05697.1| BTB/POZ domain-containing protein [Glycine soja]
Length=487

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 195/229 (85%), Gaps = 8/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLL+E+V +++    +S+D LY+LCH C+ SLLLC SEA   DE   DRG +M +I RE
Sbjct  260  SRLLKENVSNDSSRLDVSKDTLYHLCHKCIGSLLLCLSEAASSDEK-LDRGAIMSDITRE  318

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDILI +K+GDEFV +WA+QKEL +LHSK+PT+YRHEISRITAQLC+ IGRGH
Sbjct  319  ADNIQWIVDILIGKKIGDEFVKIWAEQKELVTLHSKVPTVYRHEISRITAQLCIGIGRGH  378

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ RFSLLSTWLEALYEDFGWMRRA R++D+ LVEDGLSQTILTLPL QQQ+++LN
Sbjct  379  ILVPKEIRFSLLSTWLEALYEDFGWMRRASRAVDRKLVEDGLSQTILTLPLLQQQSVLLN  438

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFL+KGDDCPNIQKAF++WWRRAFI+QY  E   SQLQI L DY +
Sbjct  439  WFDRFLSKGDDCPNIQKAFEIWWRRAFIRQYSAEPENSQLQITLSDYPS  487



>ref|XP_003540755.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Glycine 
max]
Length=503

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 195/229 (85%), Gaps = 8/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLL+E+V +++    +S+D LY+LCH C+ SLLLC SEA   DE   DRG +M +I RE
Sbjct  276  SRLLKENVSNDSSRLDVSKDTLYHLCHKCIGSLLLCLSEAASSDEK-LDRGAIMSDITRE  334

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDILI +K+GDEFV +WA+QKEL +LHSK+PT+YRHEISRITAQLC+ IGRGH
Sbjct  335  ADNIQWIVDILIGKKIGDEFVKIWAEQKELVTLHSKVPTVYRHEISRITAQLCIGIGRGH  394

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ RFSLLSTWLEALYEDFGWMRRA R++D+ LVEDGLSQTILTLPL QQQ+++LN
Sbjct  395  ILVPKEIRFSLLSTWLEALYEDFGWMRRASRAVDRKLVEDGLSQTILTLPLLQQQSVLLN  454

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFL+KGDDCPNIQKAF++WWRRAFI+QY  E   SQLQI L DY +
Sbjct  455  WFDRFLSKGDDCPNIQKAFEIWWRRAFIRQYSAEPENSQLQITLSDYPS  503



>ref|XP_011005022.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Populus 
euphratica]
Length=503

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 195/229 (85%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SR  RE+  DN+    +S+D LY+LC  CL+SL+LC SE T +D+   DRGV+M ++A+E
Sbjct  275  SRFFRENSSDNSNRLDVSKDSLYSLCQRCLSSLILCLSEVTGIDDCRVDRGVLMAQVAQE  334

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            A+N++WIVDILI+RK+GDEFV LWADQKELA LHS+IPTMYRHEIS+ITAQLC+AIGRGH
Sbjct  335  AENMRWIVDILIDRKIGDEFVKLWADQKELALLHSRIPTMYRHEISKITAQLCIAIGRGH  394

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPKD+RFSLLSTWLEALYEDF WM R+CRS+DK LVEDGLSQTILTLPL QQQ I+L 
Sbjct  395  ILVPKDSRFSLLSTWLEALYEDFAWMTRSCRSVDKKLVEDGLSQTILTLPLLQQQTILLT  454

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFL+KGDDCP+IQKAF+VWWRRAFI+QY  E   S LQI +CD+ +
Sbjct  455  WFDRFLSKGDDCPDIQKAFEVWWRRAFIRQYAAEQDSSHLQITVCDHPD  503



>gb|KJB08821.1| hypothetical protein B456_001G105900 [Gossypium raimondii]
Length=511

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 195/227 (86%), Gaps = 7/227 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRED  D      +S+D LY+LCH CL SL+LC SEA C+D S ++RGV+M EIARE
Sbjct  283  SRLLREDSFDYNSRLDVSKDTLYHLCHRCLCSLVLCLSEAMCMDSSRQERGVLMAEIARE  342

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            A+N+QW+VDILI+++M ++FV LWADQKELA LHS+IPTMYRHEISRITAQLC+AIGRG+
Sbjct  343  ANNLQWLVDILIDKRMANDFVKLWADQKELAELHSRIPTMYRHEISRITAQLCIAIGRGN  402

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPKD+RFSLLSTWL+ALYEDF WMRRA RS+DK L+E+GLSQTILTL L QQQ I+LN
Sbjct  403  ILVPKDSRFSLLSTWLDALYEDFRWMRRASRSVDKKLIEEGLSQTILTLSLRQQQVILLN  462

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQY--VPE-SQLQIALCDY  100
            WF RFLNKGDD PNIQ+AF+VWWRRAFI+QY  VP+ S +QI +C+Y
Sbjct  463  WFHRFLNKGDDYPNIQRAFEVWWRRAFIRQYADVPDSSNMQITICNY  509



>ref|XP_002298385.2| hypothetical protein POPTR_0001s24050g [Populus trichocarpa]
 gb|EEE83190.2| hypothetical protein POPTR_0001s24050g [Populus trichocarpa]
Length=503

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 195/229 (85%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SR  RE+  D++    +S+D LY+LCH CL+SL+LC SE T +D+   DRGV+M ++A+E
Sbjct  275  SRFFRENSSDHSNRLDVSKDSLYSLCHRCLSSLILCLSEVTGIDDCRVDRGVLMAQVAQE  334

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            A+N++WIVDILI+RK+GDEFV LWADQKELA LHS+IPTMYRHEIS+ITAQLC+AIGRGH
Sbjct  335  AENMRWIVDILIDRKIGDEFVKLWADQKELALLHSRIPTMYRHEISKITAQLCIAIGRGH  394

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPKD+RFSLLSTWLEALYEDF WM R+ RS+DK LVEDGLSQTILTLPL QQQ I+L 
Sbjct  395  ILVPKDSRFSLLSTWLEALYEDFAWMTRSSRSVDKKLVEDGLSQTILTLPLLQQQTILLT  454

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            WFDRFL+KGDDCP+IQKAF+VWWRRAFI+QY  E   S LQI +CD+ +
Sbjct  455  WFDRFLSKGDDCPDIQKAFEVWWRRAFIRQYAAEQDSSHLQITVCDHPD  503



>ref|XP_008349723.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Malus 
domestica]
Length=523

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 193/229 (84%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRED   ++    +S++ LY+LCH CL+SL+LC SEAT  D+  +DRGV+M EIARE
Sbjct  295  SRLLREDAGSDSNRIDVSKETLYHLCHRCLSSLVLCLSEATSADDGRRDRGVLMAEIARE  354

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIV IL+++KMG+EFV LWADQKEL  LHSKIPTMYRHEISRITAQLCVAIG  +
Sbjct  355  ADNMQWIVGILVDKKMGEEFVKLWADQKELVDLHSKIPTMYRHEISRITAQLCVAIGSRN  414

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRA-CRSIDKTLVEDGlsqtiltlplpqqQAIML  235
            LLVPK+ RF LLSTWLEALYEDFGWMRRA  RSIDK LVE+G+SQTILTLPL QQQ I+L
Sbjct  415  LLVPKETRFLLLSTWLEALYEDFGWMRRASSRSIDKKLVEEGISQTILTLPLQQQQTILL  474

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE--SQLQIALCDYTN  94
            NWFDRFLNKGDDCPNIQKAF+VWWRRAFI+    +  +QLQI +CDY +
Sbjct  475  NWFDRFLNKGDDCPNIQKAFEVWWRRAFIRHVSEQENTQLQITVCDYPS  523



>ref|XP_009354521.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Pyrus 
x bretschneideri]
Length=523

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 192/229 (84%), Gaps = 7/229 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRED   ++    +S++ LY+LCH CL+SL+LC SEAT  D+  +DRGV+M EIARE
Sbjct  295  SRLLREDAGSDSNRIDVSKETLYHLCHRCLSSLVLCLSEATSADDGRRDRGVLMAEIARE  354

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIV IL+++KM +EFV LWADQKEL  LHSKIPTMYRHEIS+ITAQLCVAIG  +
Sbjct  355  ADNMQWIVGILVDKKMAEEFVKLWADQKELVDLHSKIPTMYRHEISKITAQLCVAIGSRN  414

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRA-CRSIDKTLVEDGlsqtiltlplpqqQAIML  235
            LLVPK+ R+ LLSTWLEALYEDFGWMRRA  RSIDK LVE+G+SQTILTLPL QQQ I+L
Sbjct  415  LLVPKETRYLLLSTWLEALYEDFGWMRRASSRSIDKKLVEEGISQTILTLPLQQQQTILL  474

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE--SQLQIALCDYTN  94
            NWFDRFLNKGDDCPNIQKAF+VWWRRAFIK    +  +QLQI +CDY +
Sbjct  475  NWFDRFLNKGDDCPNIQKAFEVWWRRAFIKHVSEQENTQLQITVCDYPS  523



>ref|XP_010313540.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g60050 [Solanum lycopersicum]
Length=234

 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 193/229 (84%), Gaps = 9/229 (4%)
 Frame = -2

Query  759  SRLLREDVPDNT-------ISRDMLYNLCHGCLNSLLLCASEATCVDES-GKDRGVVMGE  604
            S LLRE+  +++       ISRD +   CH CL SL+L   EAT VD++  +D+GV+MGE
Sbjct  6    SSLLRENTSNSSSHESNLDISRDTI-XFCHRCLTSLILSLFEATSVDDNRQQDQGVLMGE  64

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IAREADN+QW+VDILI+RKMGDEFV LWA+QKEL+ LHSKI TMYRHEIS+ITAQLC+AI
Sbjct  65   IAREADNLQWLVDILIDRKMGDEFVKLWAEQKELSILHSKILTMYRHEISKITAQLCIAI  124

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG+LLVPKD R+ LLSTWLE+LY+DFGWM+RA +SIDK LVE+GL QTILTLPL QQQ 
Sbjct  125  GRGNLLVPKDVRYCLLSTWLESLYDDFGWMKRAGKSIDKKLVEEGLGQTILTLPLAQQQT  184

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYT  97
            I+LNWFDRFLNKGDD PNIQ+AF+VWWRR+F+KQY  +SQLQ+A+ DYT
Sbjct  185  ILLNWFDRFLNKGDDYPNIQRAFEVWWRRSFVKQYTADSQLQLAIFDYT  233



>ref|XP_008358075.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Malus 
domestica]
Length=534

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 192/230 (83%), Gaps = 9/230 (4%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SRLLRED   +     +S++ LY+LCH CL+SL+LC SEAT  D+  +DRGV+M EIARE
Sbjct  306  SRLLREDAASDGNMIDVSKETLYHLCHRCLSSLVLCLSEATSADDGRRDRGVLMAEIARE  365

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIV IL+++KMGDEFV LWADQKELA LHS IPTMYRHEISRITAQLCVAIG  H
Sbjct  366  ADNMQWIVGILVDKKMGDEFVKLWADQKELAVLHSNIPTMYRHEISRITAQLCVAIGSRH  425

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRA-CRSIDKTLVEDGlsqtiltlplpqqQAIML  235
            LL PK+ RF LLSTWLEALYEDFGWMRRA  RS DK LVE+G+SQTILTLPL QQQ I+L
Sbjct  426  LLAPKETRFLLLSTWLEALYEDFGWMRRASSRSFDKQLVEEGISQTILTLPLQQQQTILL  485

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDYTN  94
            NWFDRFLNKGDDCPNI+KAF+VWWRRAFIK +V E   +Q++I +CDY +
Sbjct  486  NWFDRFLNKGDDCPNIRKAFEVWWRRAFIK-HVSEHENTQVEITVCDYPS  534



>gb|AES88747.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=451

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 195/230 (85%), Gaps = 13/230 (6%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEA--TCVDESGKDRGVVMGEIA  598
            S+LL+++  +++    +S+D LY+LCH C++SL+LC SEA  TC      DRGV++ EIA
Sbjct  223  SKLLKDNAFNDSSKLDVSKDTLYHLCHRCISSLVLCLSEARDTC---ERLDRGVLISEIA  279

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            READN+QWIVDILI++KMGDEFV +WA+QKELA+LHSK+ T+YR+EIS+ITAQLC+ IGR
Sbjct  280  READNIQWIVDILIDKKMGDEFVKIWAEQKELAALHSKVQTIYRYEISKITAQLCIGIGR  339

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            GH+LVPK+ RFSLLSTWLEALYEDFGWM+RA R IDK L+EDGL QTILTLPL QQQ ++
Sbjct  340  GHILVPKEIRFSLLSTWLEALYEDFGWMKRASRGIDKKLIEDGLGQTILTLPLFQQQLLL  399

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE----SQLQIALCDY  100
            LNWFDRFLNKGDDCPNIQKAF++WWRRAFI++Y PE    SQLQI L DY
Sbjct  400  LNWFDRFLNKGDDCPNIQKAFEIWWRRAFIRKYSPEPDDSSQLQITLFDY  449



>ref|XP_004505925.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Cicer 
arietinum]
Length=495

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 190/228 (83%), Gaps = 9/228 (4%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            S+LL+++  +++    +S+D LY+LCH C+++L LC SEA    E   DRGV+M EI RE
Sbjct  267  SKLLKDNAFNDSSKVDVSKDTLYHLCHRCISALGLCLSEAIGTLER-PDRGVLMSEITRE  325

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+QWIVDILI +KMG+EFV +WA+QKELA+LH K+ T+YR+EISRITAQLC+ IGRGH
Sbjct  326  ADNIQWIVDILIGKKMGEEFVKIWAEQKELAALHLKVQTVYRYEISRITAQLCIGIGRGH  385

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +LVPK+ RFSLLSTWLEALYEDFGWMRR  R +DK LVEDGLSQTILTLPL QQQ ++LN
Sbjct  386  MLVPKEIRFSLLSTWLEALYEDFGWMRRGSRGLDKKLVEDGLSQTILTLPLFQQQVLLLN  445

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE----SQLQIALCDY  100
            WFDRFLNKGDDCPNIQKAF++WWRRAFI++Y PE    SQLQI L DY
Sbjct  446  WFDRFLNKGDDCPNIQKAFEIWWRRAFIRKYSPEPDNNSQLQITLFDY  493



>ref|XP_010520319.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Tarenaya 
hassleriana]
Length=507

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 191/224 (85%), Gaps = 6/224 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            RLLRE+  D+ +S+++LY+LCH CL SL+LC SEAT  +++ GKDRGV+M EIAREADN+
Sbjct  283  RLLREE-SDHDVSKNILYSLCHRCLTSLVLCLSEATSQMNDPGKDRGVLMREIAREADNL  341

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+K  ++FV LWADQKELA LHSKIPTMYRHEISRITA +CV IG+G +LV 
Sbjct  342  VWVVDILIEKKFCEDFVKLWADQKELADLHSKIPTMYRHEISRITALICVGIGKGRILVN  401

Query  399  KDARFSLLSTWLEALYEDFGWMRRA-CRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ARFS+L+TWLEALY+DFGWMRRA  RS+D+ +VE+GLSQTILTL L QQQ I++ WFD
Sbjct  402  REARFSVLNTWLEALYDDFGWMRRASSRSLDRKVVEEGLSQTILTLSLRQQQVILMKWFD  461

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCDY  100
            RFL+KGDDCPN+Q+AF+VWWRRAF++Q V E   SQLQI L DY
Sbjct  462  RFLSKGDDCPNVQRAFEVWWRRAFVRQVVTEADASQLQITLYDY  505



>emb|CDY09229.1| BnaA02g06550D [Brassica napus]
Length=497

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 188/223 (84%), Gaps = 6/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +L+RE+  D+ +S++ LY LCH CL SL+LC SE T  +++ GKDRG +MGEIAREADN+
Sbjct  276  KLVREEA-DHEVSKETLYGLCHRCLTSLVLCLSEVTTQMNDPGKDRGALMGEIAREADNM  334

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+KM DEFV LWADQKELA LH+KIPTMYRHEIS+ITAQ+CV IGRG +LV 
Sbjct  335  LWMVDILIEKKMCDEFVKLWADQKELAELHAKIPTMYRHEISKITAQICVGIGRGRILVN  394

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALYEDFGWMRR + RS+D+ LVEDGLSQTILTL L QQQ I++ WFD
Sbjct  395  RETRFAVLNTWLEALYEDFGWMRRLSSRSLDRKLVEDGLSQTILTLSLRQQQVILMKWFD  454

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCD  103
            RFL+KGDDCPNIQ+AF+VWWRRAFI+Q + E   SQLQ+ L D
Sbjct  455  RFLSKGDDCPNIQRAFEVWWRRAFIRQVIAEPDASQLQMTLYD  497



>ref|XP_010483651.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Camelina 
sativa]
Length=500

 Score =   295 bits (754),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 188/223 (84%), Gaps = 6/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +L+RE+  D  +S+D LY LCH CL SL+LC SE T  +++ GKDRG +MGEIAREADN+
Sbjct  279  KLVREEA-DYDVSKDTLYGLCHRCLTSLVLCLSEVTTQMNDPGKDRGALMGEIAREADNM  337

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+KM DEFV LWADQKELA+LHSKIPTMYRHEIS+ITAQ+CV IG+G +LV 
Sbjct  338  LWMVDILIEKKMCDEFVKLWADQKELANLHSKIPTMYRHEISKITAQICVGIGKGRILVN  397

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALY+DFGWMRR + RS+D+ LVEDGLSQTILTL L QQQ I++ WFD
Sbjct  398  RETRFAVLNTWLEALYDDFGWMRRLSSRSLDRKLVEDGLSQTILTLSLRQQQVILMKWFD  457

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCD  103
            RFL+KGDDCPN+Q+AF+VWWRRAFI+Q + E   SQLQI L D
Sbjct  458  RFLSKGDDCPNVQRAFEVWWRRAFIRQVLTEPDGSQLQITLYD  500



>ref|XP_010455877.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Camelina 
sativa]
Length=499

 Score =   295 bits (754),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 188/223 (84%), Gaps = 6/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +L+RE+  D  +S+D LY LCH CL SL+LC SE T  +++ GKDRG +MGEIAREADN+
Sbjct  278  KLVREEA-DYDVSKDTLYGLCHRCLTSLVLCLSEVTTQMNDPGKDRGALMGEIAREADNM  336

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+KM DEFV LWADQKELA+LHSKIPTMYRHEIS+ITAQ+CV IG+G +LV 
Sbjct  337  LWMVDILIEKKMCDEFVKLWADQKELANLHSKIPTMYRHEISKITAQICVGIGKGRVLVN  396

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALY+DFGWMRR + RS+D+ LVEDGLSQTILTL L QQQ I++ WFD
Sbjct  397  RETRFAVLNTWLEALYDDFGWMRRLSSRSLDRKLVEDGLSQTILTLSLRQQQVILMKWFD  456

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCD  103
            RFL+KGDDCPN+Q+AF+VWWRRAFI+Q + E   SQLQI L D
Sbjct  457  RFLSKGDDCPNVQRAFEVWWRRAFIRQVLTEPDGSQLQITLYD  499



>gb|KFK27540.1| hypothetical protein AALP_AA8G396600 [Arabis alpina]
Length=360

 Score =   290 bits (741),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 187/223 (84%), Gaps = 6/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +LLRE+  D+ +S+D LY LCH CL SL+LC SE T  +++ G DRG +MGEIAREA+N+
Sbjct  139  KLLREE-ADHDVSKDTLYGLCHRCLTSLVLCLSEVTTQMNDPGNDRGALMGEIAREAENM  197

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+KM DEFV LWADQKELA+LHSKIPTMYRHEIS+ITAQ+CV IGRG +LV 
Sbjct  198  LWMVDILIEKKMCDEFVKLWADQKELANLHSKIPTMYRHEISKITAQICVGIGRGRILVN  257

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALY+DFGWMRR + R++D+ LVEDGLSQTILTL L QQQ I++ WFD
Sbjct  258  RETRFAVLNTWLEALYDDFGWMRRLSSRTLDRKLVEDGLSQTILTLSLRQQQVILMKWFD  317

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPES---QLQIALCD  103
            RFL+KGDDCPN+Q+AF+VWWRRAFI+Q + E    QLQI L D
Sbjct  318  RFLSKGDDCPNVQRAFEVWWRRAFIRQILAEQDTPQLQITLYD  360



>ref|XP_006281633.1| hypothetical protein CARUB_v10027763mg [Capsella rubella]
 gb|EOA14531.1| hypothetical protein CARUB_v10027763mg [Capsella rubella]
Length=500

 Score =   294 bits (753),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 188/223 (84%), Gaps = 6/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +L+RE+  D  +S+D LY LCH CL SL+LC SE T  +++ GKDRG +MGEIAREA+N+
Sbjct  279  KLIREEA-DYDVSKDTLYGLCHRCLTSLVLCLSEVTTQMNDPGKDRGALMGEIAREAENM  337

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+KM DEFV LWADQKELA+LHSKIPTMYRHEIS+ITAQ+CV IG+G +LV 
Sbjct  338  LWMVDILIEKKMCDEFVKLWADQKELANLHSKIPTMYRHEISKITAQICVGIGKGRILVN  397

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALY+DFGWMRR + RS+D+ LVEDGLSQTILTL L QQQ I++ WFD
Sbjct  398  RETRFAVLNTWLEALYDDFGWMRRLSSRSLDRKLVEDGLSQTILTLSLRQQQVILMKWFD  457

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCD  103
            RFL+KGDDCPN+Q+AF+VWWRRAFI+Q + E   SQLQI L D
Sbjct  458  RFLSKGDDCPNVQRAFEVWWRRAFIRQVLTEPDGSQLQITLYD  500



>ref|XP_006828235.1| hypothetical protein AMTR_s00023p00185370 [Amborella trichopoda]
 gb|ERM95651.1| hypothetical protein AMTR_s00023p00185370 [Amborella trichopoda]
Length=489

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 193/231 (84%), Gaps = 10/231 (4%)
 Frame = -2

Query  759  SRLLREDVPDNT------ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S LL+E+   N       IS++ LY++CH C++SLL    EAT ++ SG+DRG++M EI+
Sbjct  258  SALLKENNTHNKNHNRIDISKETLYHICHCCIDSLLRHFMEATAMETSGRDRGLIMAEIS  317

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            RE+DN+QW+VDIL++R+MG+EFV LWADQ EL++LHS+IPTMYR+EIS++TAQLCVAIGR
Sbjct  318  RESDNLQWVVDILVDRQMGEEFVSLWADQSELSALHSRIPTMYRYEISKVTAQLCVAIGR  377

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +L  K+ARFSLL TWLEALY+DFGWMRRA + IDK LVEDGLSQT+LTLPL QQQ I+
Sbjct  378  GQILTSKEARFSLLQTWLEALYDDFGWMRRAGKPIDKKLVEDGLSQTVLTLPLAQQQVIV  437

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE----SQLQIALCDYT  97
            +NWFDRFLN GDD PN+++AF+VWWRRAF++++V E    S+LQ+A+CDY+
Sbjct  438  VNWFDRFLNNGDDYPNLRRAFEVWWRRAFVRRFVVEEIENSRLQLAVCDYS  488



>ref|XP_009126626.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Brassica 
rapa]
Length=495

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 187/223 (84%), Gaps = 6/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +L+RE+  D+ +S++ LY LCH CL SL+LC SE T  +++ GKDRG +MGEIAREADN+
Sbjct  274  KLVREEA-DHEVSKETLYGLCHRCLTSLVLCLSEVTTQMNDPGKDRGALMGEIAREADNM  332

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+KM DEF  LWADQKELA LH+KIPTMYRHEIS+ITAQ+CV IGRG +LV 
Sbjct  333  LWMVDILIEKKMCDEFAKLWADQKELAELHAKIPTMYRHEISKITAQICVGIGRGRILVN  392

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALYEDFGWMRR + RS+D+ LVEDGLSQTILTL L QQQ I++ WFD
Sbjct  393  RETRFAVLNTWLEALYEDFGWMRRLSSRSLDRKLVEDGLSQTILTLSLRQQQVILMKWFD  452

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCD  103
            RFL+KGDDCPN+Q+AF+VWWRRAFI+Q + E   SQLQ+ L D
Sbjct  453  RFLSKGDDCPNVQRAFEVWWRRAFIRQVIAEPDASQLQMTLYD  495



>ref|XP_006400887.1| hypothetical protein EUTSA_v10013333mg [Eutrema salsugineum]
 gb|ESQ42340.1| hypothetical protein EUTSA_v10013333mg [Eutrema salsugineum]
Length=500

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 187/223 (84%), Gaps = 6/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +LLRE+  D+ +S+D LY LCH CL SL+LC SE T  +++ GKDRG +MGEIAREADN+
Sbjct  279  KLLREEA-DHDVSKDALYGLCHRCLTSLVLCLSEVTTQMNDPGKDRGALMGEIAREADNM  337

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+KM DEFV LWADQKELA+LHSKIPTMYRHEIS+ITAQ+CV IG+G +LV 
Sbjct  338  LWMVDILIEKKMCDEFVKLWADQKELANLHSKIPTMYRHEISKITAQICVGIGKGRILVN  397

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALY+DFGWMRR + R++D+ +VEDGLSQTILTL L QQQ I++ WFD
Sbjct  398  RETRFAVLNTWLEALYDDFGWMRRLSSRTLDRKVVEDGLSQTILTLSLRQQQVILMKWFD  457

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCD  103
            RFL  GDDCPN+Q+AF+VWWRRAFI+Q + E   SQLQI L D
Sbjct  458  RFLRNGDDCPNVQRAFEVWWRRAFIRQVLAEPDASQLQITLYD  500



>ref|XP_003606550.1| hypothetical protein MTR_4g061670 [Medicago truncatula]
Length=565

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 187/216 (87%), Gaps = 9/216 (4%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEA--TCVDESGKDRGVVMGEIA  598
            S+LL+++  +++    +S+D LY+LCH C++SL+LC SEA  TC      DRGV++ EIA
Sbjct  243  SKLLKDNAFNDSSKLDVSKDTLYHLCHRCISSLVLCLSEARDTC---ERLDRGVLISEIA  299

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            READN+QWIVDILI++KMGDEFV +WA+QKELA+LHSK+ T+YR+EIS+ITAQLC+ IGR
Sbjct  300  READNIQWIVDILIDKKMGDEFVKIWAEQKELAALHSKVQTIYRYEISKITAQLCIGIGR  359

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            GH+LVPK+ RFSLLSTWLEALYEDFGWM+RA R IDK L+EDGL QTILTLPL QQQ ++
Sbjct  360  GHILVPKEIRFSLLSTWLEALYEDFGWMKRASRGIDKKLIEDGLGQTILTLPLFQQQLLL  419

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE  130
            LNWFDRFLNKGDDCPNIQKAF++WWRRAFI++Y PE
Sbjct  420  LNWFDRFLNKGDDCPNIQKAFEIWWRRAFIRKYSPE  455



>ref|XP_010443796.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Camelina 
sativa]
Length=498

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 188/223 (84%), Gaps = 6/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +L+RE+  D  +S+D LY LCH CL SL+LC SE T  +++ GKDRG +MGEIAREADN+
Sbjct  277  KLVREEA-DYDVSKDTLYGLCHRCLTSLVLCLSEVTTQMNDPGKDRGALMGEIAREADNM  335

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+++ DEFV LWADQKELA+LHSKIPTMYRHEIS++TAQ+C+ IG+G +LV 
Sbjct  336  LWMVDILIEKRLCDEFVKLWADQKELANLHSKIPTMYRHEISKVTAQICIGIGKGRVLVN  395

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALY+DFGWMRR + RS+D+ LVEDGLSQTILTL L QQQ I++ WFD
Sbjct  396  RETRFAVLNTWLEALYDDFGWMRRLSSRSLDRKLVEDGLSQTILTLSLRQQQVILMKWFD  455

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCD  103
            RFL+KGDDCPN+Q+AF+VWWRRAFI+Q + E   SQLQI L D
Sbjct  456  RFLSKGDDCPNVQRAFEVWWRRAFIRQVLTEPDGSQLQITLYD  498



>ref|NP_200813.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q9LVG9.1|Y5600_ARATH RecName: Full=BTB/POZ domain-containing protein At5g60050 [Arabidopsis 
thaliana]
 dbj|BAA96934.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42168.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04024.1| unknown protein [Arabidopsis thaliana]
 gb|AED97271.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=499

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 185/221 (84%), Gaps = 6/221 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +L+RE+  D  +SRD LY LCH CL SL+LC SE T  +++ GKDRG +MGEIAREADN+
Sbjct  279  KLVREEA-DYDVSRDTLYGLCHRCLTSLVLCLSEVTTQMNDPGKDRGALMGEIAREADNM  337

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+K+  EFV LWADQKELA+LHSKIPTMYRHEIS+ITAQ+CV IG+G +LV 
Sbjct  338  LWMVDILIEKKLCSEFVKLWADQKELANLHSKIPTMYRHEISKITAQICVGIGKGRILVN  397

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALY+DFGWMRR + RS+D+ LVEDGLSQTILTL L QQQ I++ WFD
Sbjct  398  RETRFAVLNTWLEALYDDFGWMRRLSSRSLDRKLVEDGLSQTILTLSLRQQQVILMKWFD  457

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVP---ESQLQIAL  109
            RFL+KGDDCPN+Q+AF+VWWRRAFI+Q +    E +LQI L
Sbjct  458  RFLSKGDDCPNVQRAFEVWWRRAFIRQVLTEPDEPRLQITL  498



>ref|XP_010922477.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Elaeis 
guineensis]
Length=544

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 171/208 (82%), Gaps = 3/208 (1%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            +SR+ LY+ C  CLNSL +C SEA   DE  +DRG +M EIAREADN+QW+V+ILI ++M
Sbjct  337  VSRETLYHFCKKCLNSLHMCLSEAANADEGRRDRGTIMAEIAREADNIQWLVEILINKRM  396

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEFV LWAD+ ELAS HSKIP MYR+EISRITAQLC+AIG+GHLLV KDAR SLL TWL
Sbjct  397  CDEFVTLWADETELASCHSKIPCMYRYEISRITAQLCIAIGKGHLLVSKDARISLLRTWL  456

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            EALYEDFGWM+RACR  DK +VEDGL QTILTLP+ QQQ I+L WFD FLNKGDDCPN+Q
Sbjct  457  EALYEDFGWMKRACRIFDKKMVEDGLCQTILTLPMAQQQTILLRWFDCFLNKGDDCPNMQ  516

Query  183  KAFQVWWRRAFIKQYVPE---SQLQIAL  109
            +AF+VWWRRAF++QY      S LQIA+
Sbjct  517  RAFEVWWRRAFVRQYAGNQDLSGLQIAV  544



>ref|XP_002866364.1| hypothetical protein ARALYDRAFT_358221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42623.1| hypothetical protein ARALYDRAFT_358221 [Arabidopsis lyrata subsp. 
lyrata]
Length=500

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 184/223 (83%), Gaps = 6/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATC-VDESGKDRGVVMGEIAREADNV  580
            +L+RE+  D  +S+D LY LCH CL SL+LC SE T  +++ G DRG +MGEIAREADN+
Sbjct  279  KLVREEA-DYDVSKDTLYGLCHRCLTSLVLCLSEVTTQMNDPGIDRGALMGEIAREADNM  337

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W+VDILIE+K+  EFV LWADQKELA+LHSKIPTMYRHEIS+ITAQ+CV IG+G +LV 
Sbjct  338  LWMVDILIEKKLCGEFVKLWADQKELANLHSKIPTMYRHEISKITAQICVGIGKGRILVN  397

Query  399  KDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
            ++ RF++L+TWLEALY+DFGWMRR + RS+D+ LVEDGLSQTILTL L QQQ I++ WFD
Sbjct  398  RETRFAVLNTWLEALYDDFGWMRRLSSRSLDRKLVEDGLSQTILTLSLRQQQVILMKWFD  457

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCD  103
            RFL KGDDCPN+Q+AF+VWWRRAFI+Q + E    QLQI L D
Sbjct  458  RFLTKGDDCPNVQRAFEVWWRRAFIRQVLTEPDAPQLQITLYD  500



>ref|XP_008783774.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Phoenix 
dactylifera]
Length=517

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 170/207 (82%), Gaps = 3/207 (1%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            +SR+ LY+ C  CLNSL LC SEA   DE  +DRG +MGE+AREADN+QW+++ILI ++M
Sbjct  310  VSRETLYHFCKKCLNSLHLCLSEAAKADEGRRDRGSIMGEVAREADNIQWLLEILISKRM  369

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEFV LWADQ ELA  HSKIP MYR+EISRITAQLC+AIG+GHLLV K+AR SLL TWL
Sbjct  370  CDEFVTLWADQTELALCHSKIPCMYRYEISRITAQLCIAIGKGHLLVSKEARISLLRTWL  429

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            EALYEDFGWM+RACR  DK +VEDGL QTILTLP+ QQQ I+L WFD FLNKGDDCPN+Q
Sbjct  430  EALYEDFGWMKRACRIFDKKMVEDGLCQTILTLPMAQQQTILLRWFDCFLNKGDDCPNMQ  489

Query  183  KAFQVWWRRAFIKQYVP---ESQLQIA  112
            +AF+VWWRRAF++QY      S LQIA
Sbjct  490  RAFEVWWRRAFVRQYAGNQDHSGLQIA  516



>ref|XP_008776113.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like isoform 
X1 [Phoenix dactylifera]
Length=509

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 174/229 (76%), Gaps = 10/229 (4%)
 Frame = -2

Query  759  SRLLREDVPDNT-------ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEI  601
            S LLRED   +        I ++ LY+ C  CLNSL LC SEA  VDE  +DR  +MGE+
Sbjct  278  SGLLREDRDQSKNHGNKIDIPKETLYHFCRKCLNSLHLCLSEAANVDEGRRDRKAIMGEV  337

Query  600  AREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIG  421
            AREADN+QW+V+ILI ++M DEFV LWADQ ELA  HSKIP MYR+EISRITAQLCVAIG
Sbjct  338  AREADNIQWLVEILINKRMCDEFVTLWADQSELARCHSKIPCMYRYEISRITAQLCVAIG  397

Query  420  RGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAI  241
            RG +LV KDAR SLL TWLEALYEDFGWM+ ACR  DK +VEDGL + ILTLP+ QQQ I
Sbjct  398  RGQILVSKDARISLLRTWLEALYEDFGWMKSACRIFDKNVVEDGLCRMILTLPMAQQQTI  457

Query  240  MLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVP---ESQLQIALCD  103
            +L WFD FLNKGDDCPNIQ+AF+VWWRRAF++QY      S LQI + D
Sbjct  458  LLKWFDYFLNKGDDCPNIQRAFEVWWRRAFVRQYAGTQDHSGLQIVVYD  506



>ref|XP_008776124.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like isoform 
X2 [Phoenix dactylifera]
Length=507

 Score =   281 bits (720),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 168/214 (79%), Gaps = 7/214 (3%)
 Frame = -2

Query  759  SRLLREDVPDNT-------ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEI  601
            S LLRED   +        I ++ LY+ C  CLNSL LC SEA  VDE  +DR  +MGE+
Sbjct  278  SGLLREDRDQSKNHGNKIDIPKETLYHFCRKCLNSLHLCLSEAANVDEGRRDRKAIMGEV  337

Query  600  AREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIG  421
            AREADN+QW+V+ILI ++M DEFV LWADQ ELA  HSKIP MYR+EISRITAQLCVAIG
Sbjct  338  AREADNIQWLVEILINKRMCDEFVTLWADQSELARCHSKIPCMYRYEISRITAQLCVAIG  397

Query  420  RGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAI  241
            RG +LV KDAR SLL TWLEALYEDFGWM+ ACR  DK +VEDGL + ILTLP+ QQQ I
Sbjct  398  RGQILVSKDARISLLRTWLEALYEDFGWMKSACRIFDKNVVEDGLCRMILTLPMAQQQTI  457

Query  240  MLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
            +L WFD FLNKGDDCPNIQ+AF+VWWRRAF++QY
Sbjct  458  LLKWFDYFLNKGDDCPNIQRAFEVWWRRAFVRQY  491



>gb|EYU18898.1| hypothetical protein MIMGU_mgv1a005394mg [Erythranthe guttata]
Length=485

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 181/223 (81%), Gaps = 4/223 (2%)
 Frame = -2

Query  759  SRLLREDVPDNT-ISRDMLYNLCHGCLNSLLLCASEATCVDESG--KDRGVVMGEIAREA  589
            +RLL ED      ISR+ LY LCH CL+SL+L  S ATC DE    +DRGV+M EIAREA
Sbjct  260  TRLLDEDHYSRLDISRNTLYQLCHRCLSSLVLSLSAATCADEEAVQQDRGVLMAEIAREA  319

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+QWIV IL++RK+G+EFV LWADQKELA LHSKIP MYRH IS+ITAQ+CV IG+G +
Sbjct  320  DNMQWIVGILMDRKIGEEFVKLWADQKELAVLHSKIPVMYRHVISKITAQVCVFIGQGKV  379

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            LVPK+ RF LLSTWL+ALY+DFGWMR    +S+D+ +VE+GL + ILTLPL QQQ I++ 
Sbjct  380  LVPKEVRFGLLSTWLDALYDDFGWMRTCGGKSVDRKVVEEGLGRMILTLPLTQQQLILMK  439

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCD  103
            WFDRF+N G DCPNI+ AF+VWWRRAF+KQYV ESQLQ+ALCD
Sbjct  440  WFDRFVNGGYDCPNIKGAFEVWWRRAFVKQYVVESQLQVALCD  482



>ref|XP_009397488.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Musa 
acuminata subsp. malaccensis]
Length=512

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 174/229 (76%), Gaps = 10/229 (4%)
 Frame = -2

Query  759  SRLLREDVPDNT-------ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEI  601
            +RLLRED+  N        ISR+ LY+LCH CL+ LL   SEA    E   DR  +MGE+
Sbjct  281  ARLLREDLDQNNMHYNKLEISRETLYHLCHKCLDCLLQLLSEAANFGEGHGDRASLMGEV  340

Query  600  AREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIG  421
            AREADNVQW+VDILI +++ DEFV LWADQ EL++ HSKIP MYR EISRITAQLC+AIG
Sbjct  341  AREADNVQWLVDILINKRIADEFVALWADQSELSTWHSKIPCMYRFEISRITAQLCIAIG  400

Query  420  RGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAI  241
            RG +LV KDA+ SLL TWLEALYEDF WM+RACR  DK L+EDGLS TILTLP+ +QQ I
Sbjct  401  RGQILVTKDAKISLLRTWLEALYEDFSWMKRACRMFDKKLIEDGLSATILTLPMAEQQEI  460

Query  240  MLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPES---QLQIALCD  103
            +L WFD FL+KGD+CPNIQ+AF+VWWRRAF +Q+  +    Q QI + D
Sbjct  461  LLRWFDCFLSKGDNCPNIQRAFEVWWRRAFFRQFTGDQDHLQPQIVVSD  509



>ref|XP_009419272.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Musa 
acuminata subsp. malaccensis]
Length=512

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 172/229 (75%), Gaps = 10/229 (4%)
 Frame = -2

Query  759  SRLLREDVPDNTI-------SRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEI  601
            +RLLR D+  + I        R+ LY LCH  ++ L+L  SEA  + E   DR  +MGE+
Sbjct  281  ARLLRGDLNRSDIRYKNLEVPRETLYQLCHKHMDCLMLLLSEAANIVEGQGDRAALMGEV  340

Query  600  AREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIG  421
            AREADNVQW+VDILI++++ DEFV LWA+Q  LA+ HSKIP +YR EIS ITAQLCVAIG
Sbjct  341  AREADNVQWLVDILIDKRIADEFVSLWANQSGLATCHSKIPCIYRFEISMITAQLCVAIG  400

Query  420  RGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAI  241
            +G +LV KDA+ SLL TWLEAL+EDFGWM+R  R+ +K +VEDGLS TILTLP+ +QQ I
Sbjct  401  KGQILVSKDAKVSLLRTWLEALFEDFGWMKRTSRTFNKKMVEDGLSATILTLPMAEQQTI  460

Query  240  MLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE---SQLQIALCD  103
            +L WFD FLNKGDDCPNIQ+AF++WWRRAFI+QY  E   S LQ+   D
Sbjct  461  LLRWFDCFLNKGDDCPNIQRAFEIWWRRAFIRQYAGEHDHSHLQMVDSD  509



>ref|XP_006829095.1| hypothetical protein AMTR_s00001p00262820 [Amborella trichopoda]
 gb|ERM96511.1| hypothetical protein AMTR_s00001p00262820 [Amborella trichopoda]
Length=613

 Score =   244 bits (624),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 170/223 (76%), Gaps = 8/223 (4%)
 Frame = -2

Query  759  SRLLREDVPDNTI---SRDMLYNLCHGCLNSLL---LCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+   N +   S++ LY+ CH CL  LL   L A+    ++ +  +R + + +I+
Sbjct  385  SKMLRENAAHNNLTDLSKESLYSACHHCLALLLQNFLVATAEGFMEWAQDERSITVSQIS  444

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R ADN+ W++DILI+R+M ++F  +WA+Q +LA LH K+PTMYR+E+SR+TA+LCVAIG+
Sbjct  445  RHADNLHWLLDILIDRQMAEDFAKMWANQADLAKLHPKVPTMYRYEVSRLTARLCVAIGK  504

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +L PKD R SLL TWLE LYEDFGWMRRAC+++D+ +VE GL QTILTLPL QQQAI+
Sbjct  505  GQILTPKDVRCSLLGTWLEPLYEDFGWMRRACKALDRNVVEYGLGQTILTLPLEQQQAIL  564

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQ--YVPESQLQI  115
            L WFDRFLN GDDCPNIQ+AF+VWWRRAF+++       QLQI
Sbjct  565  LGWFDRFLNAGDDCPNIQRAFEVWWRRAFLRKGSESERPQLQI  607



>ref|XP_007036221.1| BTB/POZ domain-containing protein [Theobroma cacao]
 gb|EOY20722.1| BTB/POZ domain-containing protein [Theobroma cacao]
Length=152

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 125/150 (83%), Gaps = 3/150 (2%)
 Frame = -2

Query  534  FVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLEAL  355
            FV LWADQ+EL  LHSKIP +YRHEISRITAQLC AIGRG++LVPKD+RF LLSTWLEAL
Sbjct  3    FVKLWADQRELVGLHSKIPILYRHEISRITAQLCTAIGRGNILVPKDSRFPLLSTWLEAL  62

Query  354  YEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQKAF  175
            YEDFGWMRRA RS+DK LVEDGLS+TILT  L QQQ I+L+WFDRFL+KGDDCPNIQ AF
Sbjct  63   YEDFGWMRRASRSVDKKLVEDGLSKTILTPSLRQQQVILLSWFDRFLSKGDDCPNIQTAF  122

Query  174  QVWWRRAFIKQYV---PESQLQIALCDYTN  94
            +VWWRRAFI QY      SQLQI +  Y  
Sbjct  123  EVWWRRAFIGQYTDVQDSSQLQITVGSYPT  152



>gb|EPS62176.1| hypothetical protein M569_12618 [Genlisea aurea]
Length=524

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 154/195 (79%), Gaps = 5/195 (3%)
 Frame = -2

Query  687  CLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKMGDEFVDLWADQK  508
            CL+SL+ C S  +  D   ++RG  M EI R ADN+QWIV ILI+RKMG+E   +WADQ+
Sbjct  332  CLDSLIACLSAVS--DSPEENRGARMAEIGRRADNLQWIVGILIDRKMGEEVARVWADQE  389

Query  507  ELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLEALYEDFGWMRR  328
            ELA+LHS++P MYRHEISR+TAQLCV+IG+G +L PK+ R  LLSTWLEALY+DF WMR 
Sbjct  390  ELAALHSRVPAMYRHEISRVTAQLCVSIGKGEVLAPKETRVRLLSTWLEALYDDFAWMRA  449

Query  327  ACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFI  148
            A   +D+  +E+GL +T+LTLPL +QQA++L W DR+++ GD CP++++AF++WWRRAF+
Sbjct  450  A---MDRKGIEEGLCRTVLTLPLAEQQAVLLRWLDRYVDGGDGCPDMRRAFEIWWRRAFV  506

Query  147  KQYVPESQLQIALCD  103
            KQY  ++Q+QI L D
Sbjct  507  KQYSVQNQMQITLSD  521



>ref|XP_001751363.1| predicted protein [Physcomitrella patens]
 gb|EDQ83680.1| predicted protein, partial [Physcomitrella patens]
Length=440

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 162/208 (78%), Gaps = 10/208 (5%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SR+LRE++  N     +S++ LY  CH CL+SLL    ++    +SG DRG+++ EI+R+
Sbjct  238  SRMLRENMSQNKNTVDVSKESLYRACHACLDSLLHLFMQS----KSGDDRGMLI-EISRQ  292

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+ W+VDILI+R++ D+FV +WA Q ELA+LH+K+P M+R+E+SR+TA+LC+AIG+G 
Sbjct  293  ADNLHWLVDILIDRRIADDFVRMWAHQAELANLHAKVPVMFRYEVSRLTARLCIAIGKGQ  352

Query  411  LLVPK-DARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIML  235
                  D RF LL TWL+ L +DF WM+R CRS+DK +VE+G+SQTILTLPL QQQ+I+L
Sbjct  353  ARQSNLDVRFLLLQTWLQPLVDDFAWMQRCCRSLDKKVVEEGISQTILTLPLKQQQSILL  412

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAF  151
            +WFDRF + GDDCPN+QKAF+VWWRR F
Sbjct  413  SWFDRFSSSGDDCPNLQKAFEVWWRRTF  440



>ref|XP_001762013.1| predicted protein [Physcomitrella patens]
 gb|EDQ73117.1| predicted protein, partial [Physcomitrella patens]
Length=439

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 160/207 (77%), Gaps = 9/207 (4%)
 Frame = -2

Query  759  SRLLREDVPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            SR+LRE++  N     IS++ LY  CHGCL+SLL   +++    +SG+DR +++ EI+R+
Sbjct  238  SRMLRENMSQNKNTVDISKESLYRACHGCLDSLLHLFTQS----KSGEDRNMLV-EISRQ  292

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+ W+VDIL++R++ D+FV +WA Q ELA+LH+++P M+R+E+SR+TA+L        
Sbjct  293  ADNLHWLVDILVDRRIADDFVRMWAHQGELATLHAQVPVMFRYEVSRLTARLLWVRLDKQ  352

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            +L PKD RF LL TWL+ L +DF WM+R CR++DK +VE+G+SQTILTLPL QQQ I+L+
Sbjct  353  VLSPKDVRFLLLQTWLQPLVDDFAWMQRCCRNLDKKVVEEGISQTILTLPLKQQQCILLS  412

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAF  151
            WFDRF + GDDCPN+QKAF+VWWRR F
Sbjct  413  WFDRFSSSGDDCPNLQKAFEVWWRRTF  439



>ref|NP_001169621.1| uncharacterized protein LOC100383502 [Zea mays]
 gb|ACN34307.1| unknown [Zea mays]
Length=546

 Score =   214 bits (545),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 165/231 (71%), Gaps = 16/231 (7%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL+  LLC      V  S  D   V   IA
Sbjct  322  SKMLRENSTSRGGAIGGDLRKESLYSACNGCLS--LLCEQ---FVRASEGDHSEV-ARIA  375

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ ++F+  WA Q ELA++H K+P ++R+E+SR+TA+L V +G+
Sbjct  376  RQADNLHWMLDILVERQIAEDFLRTWATQTELAAMHRKVPAIHRYEVSRVTARLFVGVGK  435

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+AR  LLSTWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+
Sbjct  436  GQILVSKEARCQLLSTWLEPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEIL  495

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV---PESQLQI-ALCDYT  97
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+     P S+L+I A+C+ +
Sbjct  496  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNSEPEPPSRLRITAICENS  546



>dbj|BAJ96039.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   214 bits (545),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 162/231 (70%), Gaps = 16/231 (7%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL     C      V  +G D+  V  +IA
Sbjct  329  SKMLRENSASRGGAIGGDLRKESLYSACNGCL-----CLLREQFVRAAGGDQSEV-PQIA  382

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ ++F+  WA Q ELA +H K+P ++R+E+SR+TA+L V +G+
Sbjct  383  RQADNLHWVLDILVERQIAEDFLRTWAIQNELAEMHGKVPAIHRYEVSRVTARLFVGVGK  442

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+AR  LLSTWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+
Sbjct  443  GQILVSKEARSQLLSTWLEPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEIL  502

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV-PESQLQI---ALCDYT  97
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+   PE   ++   A+CD +
Sbjct  503  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRSAEPEQPPRLRITAICDNS  553



>ref|XP_006343947.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Solanum tuberosum]
Length=642

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 151/206 (73%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++L E+   N + ++ LY+ C+ CL  L    L A++A  +D         +G+IAR+A
Sbjct  423  SKMLHENSSHNDLRKESLYSACNACLQLLRHHFLRAADADMMD---------VGQIARQA  473

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+  HSK+P +YR+E+SR+TA+L V IG+G L
Sbjct  474  DNLHWILDILIDRQIAEDFLRTWASQSELSEAHSKVPALYRYEVSRVTARLFVGIGKGQL  533

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KDAR SLL TWL   YEDFGWMRRA R +D+ L+EDGLS TILTLP+  QQ I+++W
Sbjct  534  LASKDARCSLLQTWLVPFYEDFGWMRRASRGLDRHLIEDGLSNTILTLPMALQQDILMSW  593

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN GDDCPNIQ+ F++WWRR+F
Sbjct  594  FDRFLNSGDDCPNIQRGFEIWWRRSF  619



>ref|XP_004976580.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Setaria 
italica]
Length=549

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 163/231 (71%), Gaps = 16/231 (7%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL+ LL        V  +G D   V  +IA
Sbjct  325  SKMLRENSNSRGGAIGGDLRKESLYSACNGCLSLLL-----EQFVRAAGGDHSEV-SQIA  378

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ +EF+  WA Q ELA +H K+P ++R+E+SR+TA+L V +G+
Sbjct  379  RQADNLHWMLDILVERQIAEEFLRTWAMQTELAEMHRKVPAIHRYEVSRVTARLFVGVGK  438

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+AR  LLSTWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+
Sbjct  439  GQILVSKEARCQLLSTWLEPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEIL  498

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV-PESQLQI---ALCDYT  97
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+   PE   ++   A+C+ +
Sbjct  499  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNAEPEQPARLRITAICENS  549



>ref|XP_004143891.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cucumis 
sativus]
 ref|XP_004166918.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cucumis 
sativus]
Length=523

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 146/203 (72%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE    + + ++ LY+ C GCL  L      A   D  G      +GEIA++ADN+
Sbjct  304  SKMLRESSSQSDLRKESLYSACDGCLQLLRNQFMRAVGSDFHG------VGEIAKQADNL  357

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+  WA Q EL++ HSK+P ++R EISR+TA+L V IG+G LL P
Sbjct  358  HWILDILIDRQIAEDFLKTWASQSELSATHSKVPAVHRFEISRVTARLFVGIGKGQLLAP  417

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R+ LL TWL   Y+DFGWMRRA R +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  418  KDVRYQLLQTWLVPFYDDFGWMRRASRGLDRHLIEDGLSNTILTLPLAWQQDILLAWFNR  477

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            F+N G+DCPNIQ+ F+VWWRRAF
Sbjct  478  FMNSGEDCPNIQRGFEVWWRRAF  500



>gb|EMT26347.1| hypothetical protein F775_16772 [Aegilops tauschii]
Length=451

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 161/231 (70%), Gaps = 16/231 (7%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL     C      V  +G D+  V  +IA
Sbjct  227  SKMLRENSASRGGAIGGDLRKESLYSACNGCL-----CLLREQFVRAAGGDQSEVT-QIA  280

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ ++F+  WA Q ELA +H K+P ++R+E+SR+TA+L V +G+
Sbjct  281  RQADNLHWMLDILVERQIAEDFLRTWAMQNELAEMHGKVPAIHRYEVSRVTARLFVGVGK  340

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+AR  LLSTWLE  YEDFGWMRRAC+ +D+ L+E+GL+ TILTLPL  QQ I 
Sbjct  341  GQILVSKEARSQLLSTWLEPFYEDFGWMRRACKGLDRHLIEEGLANTILTLPLATQQEIF  400

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQ---LQI-ALCDYT  97
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+     Q   L+I A+CD +
Sbjct  401  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRRAEPEQPPRLRITAICDNS  451



>ref|XP_002446981.1| hypothetical protein SORBIDRAFT_06g026230 [Sorghum bicolor]
 gb|EES11309.1| hypothetical protein SORBIDRAFT_06g026230 [Sorghum bicolor]
Length=552

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 167/231 (72%), Gaps = 16/231 (7%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL+  LLC      V  S  D   V  +IA
Sbjct  328  SKMLRENSTSRGGAIGGDLRKESLYSACNGCLS--LLCEQ---FVRASEGDHSEV-AQIA  381

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ +EF+  WA Q ELA++H K+P ++R+E+SR+TA+L V +G+
Sbjct  382  RQADNLHWMLDILVERQIAEEFLRTWAMQTELAAMHRKVPAIHRYEVSRVTARLFVGVGK  441

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+AR  LLSTWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+
Sbjct  442  GQILVSKEARCQLLSTWLEPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEIL  501

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV-PE--SQLQI-ALCDYT  97
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+   PE  S+L+I A+C+ +
Sbjct  502  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNSEPELPSRLRITAICENS  552



>gb|AIB05883.1| TRAF transcription factor, partial [Zea mays]
Length=606

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 165/231 (71%), Gaps = 16/231 (7%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL+  LLC      V  S  D   V   IA
Sbjct  382  SKMLRENSTSRGGAIGGDLRKESLYSACNGCLS--LLCEQ---FVRASEGDHSEV-ARIA  435

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ ++F+  WA Q ELA++H K+P ++R+E+SR+TA+L V +G+
Sbjct  436  RQADNLHWMLDILVERQIAEDFLRTWATQTELAAMHRKVPAIHRYEVSRVTARLFVGVGK  495

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+AR  LLSTWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+
Sbjct  496  GQILVSKEARCQLLSTWLEPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEIL  555

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV---PESQLQI-ALCDYT  97
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+     P S+L+I A+C+ +
Sbjct  556  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNSEPEPPSRLRITAICENS  606



>ref|XP_009800799.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nicotiana 
sylvestris]
Length=645

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 149/206 (72%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++L E+   N + ++ LY+ C+ CL  L    L A++A  VD         +G+IAR+A
Sbjct  426  SKMLHENSSHNDLRKESLYSACNACLQLLRHHFLRAADADMVD---------VGQIARQA  476

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+  H K+P ++R+E+SR+TA+L V IG+G L
Sbjct  477  DNLHWILDILIDRQIAEDFLRTWASQSELSEAHPKVPALHRYEVSRVTARLFVGIGKGQL  536

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KDAR SLL TWL   YEDFGWMRRA R +D+ L+EDGLS TILTLP+  QQ I+ +W
Sbjct  537  LASKDARCSLLQTWLVPFYEDFGWMRRASRGLDRHLIEDGLSNTILTLPMALQQEILTSW  596

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN GDDCPNIQ+ F++WWRRAF
Sbjct  597  FDRFLNSGDDCPNIQRGFEIWWRRAF  622



>gb|AFW59116.1| hypothetical protein ZEAMMB73_743291 [Zea mays]
Length=606

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 165/231 (71%), Gaps = 16/231 (7%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL+  LLC      V  S  D   V   IA
Sbjct  382  SKMLRENSTSRGGAIGGDLRKESLYSACNGCLS--LLCEQ---FVRASEGDHSEV-ARIA  435

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ ++F+  WA Q ELA++H K+P ++R+E+SR+TA+L V +G+
Sbjct  436  RQADNLHWMLDILVERQIAEDFLRTWATQTELAAMHRKVPAIHRYEVSRVTARLFVGVGK  495

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+AR  LLSTWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+
Sbjct  496  GQILVSKEARCQLLSTWLEPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEIL  555

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV---PESQLQI-ALCDYT  97
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+     P S+L+I A+C+ +
Sbjct  556  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNSEPEPPSRLRITAICENS  606



>ref|XP_008437316.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
melo]
 ref|XP_008437317.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
melo]
Length=678

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 146/203 (72%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE    N + ++ LY+ C GCL  L      A   D  G      +GEIA++ADN+
Sbjct  459  SKMLRESSSQNDLRKESLYSACDGCLQLLRNQFMRAVGSDFHG------VGEIAKQADNL  512

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+  WA Q EL++ HSK+P ++R EISR+TA+L V IG+G LL P
Sbjct  513  HWILDILIDRQIAEDFLKTWASQSELSAAHSKVPAVHRFEISRVTARLFVGIGKGQLLAP  572

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R+ LL TWL   Y+DFGWMRRA R +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  573  KDVRYQLLQTWLVPFYDDFGWMRRASRGLDRHLIEDGLSNTILTLPLAWQQDILLAWFNR  632

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            F+N G+DCPNIQ+ F+VWWRRAF
Sbjct  633  FMNSGEDCPNIQRGFEVWWRRAF  655



>ref|XP_004245578.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Solanum 
lycopersicum]
Length=638

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 151/206 (73%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++L E+   N + ++ LY+ C+ CL  L    L A++A  +D         +G+IAR+A
Sbjct  419  SKMLHENSSHNDLRKESLYSACNACLQLLRHHFLRAADADMMD---------VGQIARQA  469

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+  HSK+P ++R+E+SR+TA+L V IG+G L
Sbjct  470  DNLHWILDILIDRQIAEDFLRTWASQSELSEAHSKVPALHRYEVSRVTARLFVGIGKGQL  529

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KDAR SLL TWL   YEDFGWMRRA R +D+ L+EDGLS TILTLP+  QQ I+++W
Sbjct  530  LASKDARCSLLQTWLVPFYEDFGWMRRASRGLDRHLIEDGLSNTILTLPMALQQDILMSW  589

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN GDDCPNIQ+ F++WWRR+F
Sbjct  590  FDRFLNSGDDCPNIQRGFEIWWRRSF  615



>ref|XP_006355468.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Solanum 
tuberosum]
Length=644

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 151/206 (73%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++L E+   N + ++ LY+ C+ CL  L    L A++A  +D         +G+IAR+A
Sbjct  425  SKMLHENSSHNDLRKESLYSACNACLQLLRHHFLRAADADMMD---------VGQIARQA  475

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+  HSK+P ++R+E+SR+TA+L V IG+G L
Sbjct  476  DNLHWILDILIDRQIAEDFLRTWASQSELSEAHSKVPALHRYEVSRVTARLFVGIGKGQL  535

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KDAR SLL TWL   YEDFGWMRRA R +D+ L+EDGLS TILTLP+  QQ I+++W
Sbjct  536  LASKDARCSLLQTWLVPFYEDFGWMRRASRGLDRHLIEDGLSNTILTLPMALQQDILMSW  595

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN GDDCPNIQ+ F++WWRR+F
Sbjct  596  FDRFLNSGDDCPNIQRGFEIWWRRSF  621



>emb|CBI34370.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 148/206 (72%), Gaps = 6/206 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQ  577
            ++LRE+   N + ++ LY+ C GCL  L L    A   D         +G+IAR+ADN+ 
Sbjct  304  KMLRENASQNDLRKESLYSACDGCLELLRLHFLRAAASDLQD------VGQIARQADNLH  357

Query  576  WIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPK  397
            WI+DILI+R++ ++F+  WA Q EL+  HSK+P ++R+E+SR+TA+L V IG+G LL  K
Sbjct  358  WILDILIDRQIAEDFLKTWASQSELSHAHSKVPVVHRYEVSRVTARLFVGIGKGQLLASK  417

Query  396  DARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRF  217
            DAR  LL TWL   Y+DFGWMRRA + +D+ LVEDGLS TILTLPL  QQ I+L WFDRF
Sbjct  418  DARCLLLQTWLVPFYDDFGWMRRASKGLDRHLVEDGLSNTILTLPLAWQQEILLAWFDRF  477

Query  216  LNKGDDCPNIQKAFQVWWRRAFIKQY  139
            LN G+DCPNIQ+ F+VWWRRAF +++
Sbjct  478  LNSGEDCPNIQRGFEVWWRRAFWRRH  503



>gb|KGN50074.1| hypothetical protein Csa_5G152890 [Cucumis sativus]
Length=676

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 146/203 (72%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE    + + ++ LY+ C GCL  L      A   D  G      +GEIA++ADN+
Sbjct  457  SKMLRESSSQSDLRKESLYSACDGCLQLLRNQFMRAVGSDFHG------VGEIAKQADNL  510

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+  WA Q EL++ HSK+P ++R EISR+TA+L V IG+G LL P
Sbjct  511  HWILDILIDRQIAEDFLKTWASQSELSATHSKVPAVHRFEISRVTARLFVGIGKGQLLAP  570

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R+ LL TWL   Y+DFGWMRRA R +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  571  KDVRYQLLQTWLVPFYDDFGWMRRASRGLDRHLIEDGLSNTILTLPLAWQQDILLAWFNR  630

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            F+N G+DCPNIQ+ F+VWWRRAF
Sbjct  631  FMNSGEDCPNIQRGFEVWWRRAF  653



>ref|XP_004300808.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Fragaria 
vesca subsp. vesca]
Length=616

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 148/203 (73%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            +++LRE+   N + ++ LY+ C GCL   LLC   A   +   KD    +G+IAR+ADN+
Sbjct  398  TKMLRENSSHNELRKESLYSACDGCLQ--LLCHHFARAAESDLKD----VGQIARQADNL  451

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R+M ++F+  WA Q EL+  HSK+  ++R+E+SR+TA+L V IG+G LL  
Sbjct  452  HWILDILIDRQMAEDFLKTWASQTELSESHSKVAAVHRYEVSRVTARLFVGIGKGQLLAS  511

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD RF LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  512  KDVRFLLLRTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLAWQQEILLAWFNR  571

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN G+DCPNIQ+ F+VWWRR+F
Sbjct  572  FLNSGEDCPNIQRGFEVWWRRSF  594



>ref|XP_002279382.2| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Vitis 
vinifera]
Length=667

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 148/206 (72%), Gaps = 6/206 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQ  577
            ++LRE+   N + ++ LY+ C GCL  L L    A   D         +G+IAR+ADN+ 
Sbjct  449  KMLRENASQNDLRKESLYSACDGCLELLRLHFLRAAASDLQD------VGQIARQADNLH  502

Query  576  WIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPK  397
            WI+DILI+R++ ++F+  WA Q EL+  HSK+P ++R+E+SR+TA+L V IG+G LL  K
Sbjct  503  WILDILIDRQIAEDFLKTWASQSELSHAHSKVPVVHRYEVSRVTARLFVGIGKGQLLASK  562

Query  396  DARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRF  217
            DAR  LL TWL   Y+DFGWMRRA + +D+ LVEDGLS TILTLPL  QQ I+L WFDRF
Sbjct  563  DARCLLLQTWLVPFYDDFGWMRRASKGLDRHLVEDGLSNTILTLPLAWQQEILLAWFDRF  622

Query  216  LNKGDDCPNIQKAFQVWWRRAFIKQY  139
            LN G+DCPNIQ+ F+VWWRRAF +++
Sbjct  623  LNSGEDCPNIQRGFEVWWRRAFWRRH  648



>ref|XP_009400477.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=643

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 150/205 (73%), Gaps = 6/205 (3%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            +S++ LY+ C GCL SL    + A   D +       + +IAR++DN+ WI+DILI+R++
Sbjct  433  LSKESLYSACDGCLCSLRHHFARAAASDLTE------VAQIARQSDNLHWILDILIDRQI  486

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             D+F+  WA Q EL+ +HS++P ++R+E+SR+TA+L V +G+GH+LV K++R  LL TWL
Sbjct  487  ADDFLRTWACQAELSEMHSRVPAIHRYEVSRVTARLFVGVGKGHILVSKESRSLLLRTWL  546

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            E  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+L WFDRFLN GDDCPNIQ
Sbjct  547  EPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEILLAWFDRFLNAGDDCPNIQ  606

Query  183  KAFQVWWRRAFIKQYVPESQLQIAL  109
            + F+VWWRRAF ++     QL   L
Sbjct  607  RGFEVWWRRAFWRRNGEADQLPPQL  631



>ref|XP_006652685.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Oryza 
brachyantha]
Length=532

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 155/212 (73%), Gaps = 12/212 (6%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL  L         V  +G D+  V+ +IA
Sbjct  308  SKMLRENSTSRGGAIGGDLRKESLYSACNGCLRLL-----HDQFVRAAGGDQSEVV-QIA  361

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ ++F+  WA Q ELA LH K+P ++R+E+SR+TA+L V +G+
Sbjct  362  RQADNLHWMLDILVERQIAEDFLRTWAMQIELAELHGKVPAIHRYEVSRVTARLFVGVGK  421

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+AR  LLSTWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPLP QQ I+
Sbjct  422  GQILVSKEARCQLLSTWLEPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLPTQQEIL  481

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQ  142
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+
Sbjct  482  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKR  513



>ref|XP_002531214.1| protein binding protein, putative [Ricinus communis]
 gb|EEF31191.1| protein binding protein, putative [Ricinus communis]
Length=474

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 147/203 (72%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY+ C GCL  L      A   D+        +G+IAR+ADN+
Sbjct  255  SKMLRENSSQNELRKESLYSACDGCLQLLHYHFIRAAGGDQED------IGQIARQADNL  308

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+  WA Q EL++ HSKIP ++R+EISR+TA+L V IG+G LL  
Sbjct  309  HWILDILIDRQIAEDFLKTWASQSELSNAHSKIPALHRYEISRVTARLFVGIGKGQLLAL  368

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R+ LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  369  KEVRWLLLQTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLAWQQEILLAWFNR  428

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN G+DCPNIQ+ F++WWRRAF
Sbjct  429  FLNSGEDCPNIQRGFEIWWRRAF  451



>ref|XP_010233737.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Brachypodium 
distachyon]
Length=550

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 151/218 (69%), Gaps = 12/218 (6%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL     C         +G D   V  +IA
Sbjct  326  SKMLRENSASRGGAIGGDLRKESLYSACNGCL-----CLLREQFERAAGGDHSQV-AQIA  379

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ +EF+  WA Q ELA +H K+P ++R+E+SR+TA+L V +G+
Sbjct  380  RQADNLHWMLDILVERQVAEEFLRTWAAQDELAEIHGKVPAIHRYEVSRVTARLFVGVGK  439

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+AR  LL TWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+
Sbjct  440  GQILVSKEARAQLLCTWLEPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEIL  499

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQ  124
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+     Q
Sbjct  500  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNAEPEQ  537



>ref|XP_010089067.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB37314.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=437

 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 146/205 (71%), Gaps = 12/205 (6%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREAD  586
            ++LRE+   N + ++ LY+ C GCL  L    L A+E+   D         +G+IAR+AD
Sbjct  219  KMLRENASHNDLRKESLYSACEGCLKLLRQHFLRAAESDLKD---------VGQIARQAD  269

Query  585  NVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLL  406
            N+ WI+DILI+R++ ++F+  WA Q ELA  H K+P ++R+E+SR+TA+L V IG+G LL
Sbjct  270  NLHWILDILIDRQIAEDFLKTWASQTELAEAHLKVPAIHRYEVSRVTARLFVGIGKGQLL  329

Query  405  VPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWF  226
              KD R  LL TWL   Y+DFGWMRRA R +D+ L+EDGLS TILTLPL  QQ I+L WF
Sbjct  330  ASKDVRGLLLRTWLVPFYDDFGWMRRASRGLDRHLIEDGLSNTILTLPLAWQQDILLAWF  389

Query  225  DRFLNKGDDCPNIQKAFQVWWRRAF  151
            +RFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  390  NRFLNSGEDCPNIQRGFEVWWRRAF  414



>ref|XP_011015247.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Populus euphratica]
Length=621

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 149/206 (72%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++LRE+   N + ++ LY  C+GCL  L    L  +     D         +G+IAR+A
Sbjct  402  SKMLRENSSQNDLRKESLYLACNGCLQLLQDHFLRVASGVLND---------VGQIARQA  452

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+++HSKIPT++R+E+SR+TA+L V IG+G L
Sbjct  453  DNLHWILDILIDRQIAEDFLKTWASQSELSAVHSKIPTIHRYEVSRVTARLFVGIGKGQL  512

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+AR  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  513  LASKEARSLLLQTWLVPFYDDFGWMRRATKGLDRHLIEDGLSNTILTLPLAWQQDILLAW  572

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  573  FDRFLNSGEDCPNIQRGFEVWWRRAF  598



>ref|XP_011080923.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Sesamum 
indicum]
Length=532

 Score =   209 bits (531),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 149/203 (73%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            +++LRE+   N + ++ LY+ C  CL  L     +A   D   KD    +G+IAR+ADN+
Sbjct  313  TKMLRENSSQNDLRKESLYSACDECLKLLRHHFLQAAVADM--KD----VGQIARQADNL  366

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W++DILI+R++ D+F+ +WA Q +L+  HSK+P ++R+E+SR+TA+L V IG+G LL  
Sbjct  367  HWLLDILIDRQIADDFLKMWASQSDLSEAHSKVPAIHRYEVSRVTARLLVGIGKGQLLAS  426

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+AR  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLP+  QQ I+L+WFDR
Sbjct  427  KEARCMLLQTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPMAWQQEILLSWFDR  486

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN GDDCPNIQ+ F+VWWRRAF
Sbjct  487  FLNAGDDCPNIQRGFEVWWRRAF  509



>ref|XP_011022633.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=658

 Score =   211 bits (537),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 149/206 (72%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++LRE+   N + ++ LY  C+GCL  L    L  +     D         +G+IAR+A
Sbjct  439  SKMLRENSSQNDLRKESLYLACNGCLQLLQDHFLRVASGVLND---------VGQIARQA  489

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+++HSKIPT++R+E+SR+TA+L V IG+G L
Sbjct  490  DNLHWILDILIDRQIAEDFLKTWASQSELSAVHSKIPTIHRYEVSRVTARLFVGIGKGQL  549

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+AR  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  550  LASKEARSLLLQTWLVPFYDDFGWMRRATKGLDRHLIEDGLSNTILTLPLAWQQDILLAW  609

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  610  FDRFLNSGEDCPNIQRGFEVWWRRAF  635



>ref|XP_011015245.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Populus euphratica]
Length=658

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 149/206 (72%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++LRE+   N + ++ LY  C+GCL  L    L  +     D         +G+IAR+A
Sbjct  439  SKMLRENSSQNDLRKESLYLACNGCLQLLQDHFLRVASGVLND---------VGQIARQA  489

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+++HSKIPT++R+E+SR+TA+L V IG+G L
Sbjct  490  DNLHWILDILIDRQIAEDFLKTWASQSELSAVHSKIPTIHRYEVSRVTARLFVGIGKGQL  549

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+AR  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  550  LASKEARSLLLQTWLVPFYDDFGWMRRATKGLDRHLIEDGLSNTILTLPLAWQQDILLAW  609

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  610  FDRFLNSGEDCPNIQRGFEVWWRRAF  635



>ref|XP_009628159.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nicotiana 
tomentosiformis]
Length=667

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 147/206 (71%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++L E+   N + ++ LY+ C+ CL  L    L  ++A   D         +G+IAR+A
Sbjct  448  SKMLHENSSHNDLRKESLYSACNACLQLLRHHFLQVADAGMAD---------VGQIARQA  498

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+  H K+P ++R+E+SR+TA+L V IG+G L
Sbjct  499  DNLHWILDILIDRQIAEDFLRTWASQSELSVAHPKVPALHRYEVSRVTARLFVGIGKGQL  558

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KDAR SLL TWL   YEDFGWMRRA R +D+ L+EDGLS TILTLP+  QQ I+ +W
Sbjct  559  LASKDARCSLLQTWLLPFYEDFGWMRRASRGLDRHLIEDGLSNTILTLPMALQQEILTSW  618

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN GDDCPNIQ+ F++WWRRAF
Sbjct  619  FDRFLNSGDDCPNIQRGFEIWWRRAF  644



>emb|CDP12055.1| unnamed protein product [Coffea canephora]
Length=648

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 146/206 (71%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++L E+   N + ++ LY+ C GCL SL    L  SE    D S         +IAR+A
Sbjct  429  SKMLHENTAQNDLRKESLYSACDGCLQSLRHYFLKVSEGNLEDVS---------QIARQA  479

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++DILI+R++ ++F+  WA Q EL+  HSK+P ++R+E+SR+TA+L V IG+G L
Sbjct  480  DNLHWVLDILIDRQIAEDFLKTWACQSELSEAHSKVPAIHRYEVSRVTARLFVGIGKGQL  539

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KDAR  LL TWL   YEDFGWMRRA + +D+ L+EDGL  TILTLP+  QQ I+++W
Sbjct  540  LASKDARCLLLQTWLVPFYEDFGWMRRASKGLDRHLIEDGLCNTILTLPMAWQQEILMSW  599

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN GDDCPNIQ+ F+VWWRRAF
Sbjct  600  FDRFLNSGDDCPNIQRGFEVWWRRAF  625



>ref|XP_010919095.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Elaeis 
guineensis]
Length=637

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/217 (52%), Positives = 154/217 (71%), Gaps = 17/217 (8%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            +S++ LY+ C GCL  L    LCA+ A               +IAR+ADN+ W++DILI+
Sbjct  430  LSKESLYSACDGCLRLLRHHFLCAAAAD---------LSEAAQIARQADNLHWLLDILID  480

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            R+M DEF+  WA Q EL+  HSK+P ++R+E+SR+TA+L V +G+G +LV K+AR  LLS
Sbjct  481  RQMADEFLRTWAGQAELSEAHSKVPAIHRYEVSRVTARLFVGVGKGQILVSKEARCLLLS  540

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
            TWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+L WF+RFLN GDDCP
Sbjct  541  TWLEPFYEDFGWMRRACKGLDRHLMEDGLANTILTLPLAMQQEILLAWFERFLNSGDDCP  600

Query  192  NIQKAFQVWWRRAFIK-----QYVPESQLQIALCDYT  97
            NIQ+ F+VWWRRAF +     +  P+ ++  A+C+ +
Sbjct  601  NIQRGFEVWWRRAFWRRNGEPEQPPQLRIAAAVCENS  637



>ref|XP_009389780.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 143/191 (75%), Gaps = 6/191 (3%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            +S++ LY+ C GCL SL    + A   D       +   +IAR+ADN+ WI+DILI+R++
Sbjct  441  LSKESLYSACDGCLRSLRHHFALAAASDL------IEAAQIARQADNLHWILDILIDRQI  494

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             D+F+  WA Q EL+ +H ++P ++R+E+SR+TA+L VA+G+G +LV K+AR  LL TWL
Sbjct  495  ADDFLRTWACQAELSEMHPRVPAIHRYEVSRVTARLFVAVGKGQILVSKEARCLLLRTWL  554

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            E  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+L WFDRFLN GDDCPNIQ
Sbjct  555  EPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEILLAWFDRFLNAGDDCPNIQ  614

Query  183  KAFQVWWRRAF  151
            + F+VWWRRAF
Sbjct  615  RGFEVWWRRAF  625



>ref|XP_011073126.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g63850 [Sesamum indicum]
Length=615

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 150/209 (72%), Gaps = 12/209 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            +++LRE+   N + ++ LY  C GCL  L    L A+EA   D         +G+IAR+A
Sbjct  396  TKMLRENSSQNDLRKESLYFACDGCLKLLRCHFLQAAEADMHD---------VGQIARQA  446

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++DILI+R++ ++F+ +W+ Q +LA +HSK+P ++R+E+SR+TA+L V IG+  L
Sbjct  447  DNLHWLLDILIDRQIAEDFLKIWSSQSDLAHVHSKVPPIHRYEVSRVTARLFVGIGKRQL  506

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+AR  LL TWL   YEDFGWMRRA R +D+ L+EDGLS TI TLP+  QQ I+ +W
Sbjct  507  LASKEARCMLLQTWLVPFYEDFGWMRRASRGLDRHLIEDGLSNTISTLPMAWQQEILTSW  566

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQ  142
            FDRFLN GDDCPNIQ+ F+VWWRRAF ++
Sbjct  567  FDRFLNSGDDCPNIQRGFEVWWRRAFSRR  595



>gb|KCW72192.1| hypothetical protein EUGRSUZ_E00642 [Eucalyptus grandis]
Length=404

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 146/206 (71%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            +++LRE+   + I ++ LY  C GCL SL    L A+E+   D         + +IAR+A
Sbjct  185  AKMLRENSSQSDIRKESLYAACDGCLQSLRDHFLLAAESELKD---------VAQIARQA  235

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
             N+QW++DILI+R++ ++F+  WA + E++  H K+P ++R E+SR+TA+L V IG+G L
Sbjct  236  SNLQWLLDILIDRQIAEDFLASWASESEMSDAHPKVPAVHRFEVSRVTARLFVGIGKGQL  295

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L PKDAR  LL TWL   Y DFGWMRRA + +D+ L+EDGLS TILTLPLP QQ IML W
Sbjct  296  LAPKDARCLLLQTWLVPFYNDFGWMRRASKGLDRHLIEDGLSNTILTLPLPWQQEIMLAW  355

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN  +DCPNIQ+ F+VWWRRAF
Sbjct  356  FDRFLNSSEDCPNIQRGFEVWWRRAF  381



>ref|XP_006439497.1| hypothetical protein CICLE_v10019226mg [Citrus clementina]
 gb|ESR52737.1| hypothetical protein CICLE_v10019226mg [Citrus clementina]
Length=653

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 152/214 (71%), Gaps = 6/214 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++L E+   N + ++ LY+ C GCL  L     +A     SG+ + V  G+IAR+ADN+
Sbjct  434  SKMLHENSSQNDLRKESLYSACDGCLQLLRQYFLQAA----SGEMQEV--GQIARQADNL  487

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA Q E++  H K+P ++R+E+SR+TA+L V IG+  LL  
Sbjct  488  HWILDILIDRQIAEDFLKIWASQSEISEAHPKVPAVHRYEVSRVTARLFVGIGKAQLLAT  547

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R+ LL TWLE  Y+DFGWMRRA   +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  548  KDVRYLLLRTWLEPFYDDFGWMRRASNGLDRHLIEDGLSNTILTLPLAWQQEILLAWFNR  607

Query  219  FLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQ  118
            FLN G+DCPNIQ+ F+VWWRRAF +    + QLQ
Sbjct  608  FLNSGEDCPNIQRGFEVWWRRAFWRHNGEQEQLQ  641



>ref|NP_001053645.1| Os04g0579700 [Oryza sativa Japonica Group]
 emb|CAE03270.1| OSJNBa0011J08.25 [Oryza sativa Japonica Group]
 emb|CAD41158.2| OSJNBa0064M23.3 [Oryza sativa Japonica Group]
 dbj|BAF15559.1| Os04g0579700 [Oryza sativa Japonica Group]
 gb|EAY95268.1| hypothetical protein OsI_17091 [Oryza sativa Indica Group]
 gb|EAZ31736.1| hypothetical protein OsJ_15888 [Oryza sativa Japonica Group]
Length=533

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 151/212 (71%), Gaps = 12/212 (6%)
 Frame = -2

Query  759  SRLLREDVPD------NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIA  598
            S++LRE+           + ++ LY+ C+GCL  L      A   D+S       + +IA
Sbjct  309  SKMLRENSTSRGGAIGGDLRKESLYSACNGCLRLLHEQFEMAAGGDQSE------VAQIA  362

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W++DIL+ER++ ++F+  WA Q ELA LH K+P ++R+E+SR+TA+L V +G+
Sbjct  363  RQADNLHWMLDILVERQIAEDFLRTWAMQIELAELHGKVPAIHRYEVSRVTARLFVGVGK  422

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LV K+ R  LLSTWLE  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+
Sbjct  423  GQILVSKEVRCQLLSTWLEPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLATQQEIL  482

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQ  142
            L WF+RFLN G+DCPNIQ+ F+VWWRRAF K+
Sbjct  483  LAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKR  514



>ref|XP_010676445.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Beta 
vulgaris subsp. vulgaris]
Length=585

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 147/213 (69%), Gaps = 9/213 (4%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++L E+   N + ++ LY+ C GCL  L     +A   D         + +IAR+ADN+
Sbjct  365  SKMLHENANHNDLRKESLYSACDGCLQRLRHHFLQAAASDLQD------VSQIARQADNL  418

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+  WA Q E++  HSK+P ++R EISR+TA+L V IG+G LL  
Sbjct  419  HWILDILIDRQIAEDFLKTWASQSEMSKAHSKVPPVHRFEISRVTARLFVGIGKGQLLAS  478

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L WFDR
Sbjct  479  KDVRCLLLQTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLSWQQEILLAWFDR  538

Query  219  FLNKGDDCPNIQKAFQVWWRRAFIK---QYVPE  130
            FLN G+DCPNIQ+ F+VWWRRAF K   QY PE
Sbjct  539  FLNSGEDCPNIQRGFEVWWRRAFWKRNSQYQPE  571



>ref|XP_002299517.2| hypothetical protein POPTR_0001s09710g [Populus trichocarpa]
 gb|EEE84322.2| hypothetical protein POPTR_0001s09710g [Populus trichocarpa]
Length=656

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 147/206 (71%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++LRE+   N + ++ LY  C+GCL  L    L A+     D         +G+IAR+A
Sbjct  437  SKMLRENSSQNDLRKESLYLACNGCLQLLQDHFLRAASGDLND---------VGQIARQA  487

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ +EF+  WA Q EL+ +HSKIP ++R+E+SR+TA+L V IG+G L
Sbjct  488  DNLHWILDILIDRQIAEEFLKTWASQSELSGVHSKIPAVHRYEVSRVTARLFVGIGKGQL  547

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+AR  LL TWL   Y+DFGWMRR  + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  548  LASKEARCLLLQTWLVPFYDDFGWMRRTSKGLDRHLIEDGLSNTILTLPLAWQQDILLAW  607

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  608  FDRFLNSGEDCPNIQRGFEVWWRRAF  633



>ref|XP_008807229.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
Length=630

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 151/214 (71%), Gaps = 10/214 (5%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            +S++ LY  C GCL  L      A   D S         +IAR+ADN+ W++DILI+R+M
Sbjct  423  LSKESLYFACDGCLRLLRHHFLRAAGADLSEA------AQIARQADNLHWVLDILIDRQM  476

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF+  WA Q EL+  HS++P ++R+E+SR+TA+L V +G+G +LV K+AR  LL TWL
Sbjct  477  ADEFLWTWAAQLELSEAHSRVPAIHRYEVSRVTARLFVGVGKGQILVSKEARSLLLRTWL  536

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            E  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+L WFDRFLN GDDCPNIQ
Sbjct  537  EPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLAMQQEILLAWFDRFLNSGDDCPNIQ  596

Query  183  KAFQVWWRRAFIKQYV-PESQLQI---ALCDYTN  94
            + F+VWWRRAF ++   PE   Q+   A+C+ ++
Sbjct  597  RGFEVWWRRAFWRRNSEPERPPQLRMAAVCENSS  630



>gb|KHG01374.1| hypothetical protein F383_23678 [Gossypium arboreum]
Length=640

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 158/225 (70%), Gaps = 11/225 (5%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQ  577
            ++LRE+   N + ++ LY+ C GCL   LLC+           D    + +IAR+ADN+ 
Sbjct  422  KMLRENSSQNDLRKESLYSACDGCLE--LLCSHFLRAALSDLTD----VNQIARQADNLH  475

Query  576  WIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPK  397
            WI+DILI+R++ ++F+  WA Q EL+++HSK+P ++R+E+SR+TA+L V IG+G LL  K
Sbjct  476  WILDILIDRQIAEDFLKSWASQSELSNVHSKVPAVHRYEVSRVTARLFVGIGKGQLLASK  535

Query  396  DARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRF  217
            + R  LL TWL   Y+DFGWMRRA R +D+ L+EDGLS TILTLPL  QQ I+L WFDRF
Sbjct  536  EVRCLLLQTWLVPFYDDFGWMRRASRGLDRHLIEDGLSNTILTLPLAWQQDILLAWFDRF  595

Query  216  LNKGDDCPNIQKAFQVWWRRAFIK----QYVP-ESQLQIALCDYT  97
            LN G+DCPNIQ+AF++WWRRAF K    Q +P ES + IA  + +
Sbjct  596  LNSGEDCPNIQRAFEIWWRRAFWKRSGDQELPRESHVTIATIENS  640



>ref|XP_011029330.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=648

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 147/206 (71%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++LRE+   N + ++ LY  C+GCL  L    L A+     D         +G IAR+A
Sbjct  429  SKMLRENSSQNDLRKESLYLACNGCLQLLQDHFLRAASGDLND---------VGLIARQA  479

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ +EF+  WA Q EL+ +HSKIP ++R+E+SR+TA+L V IG+G L
Sbjct  480  DNLHWILDILIDRQIAEEFLKTWASQSELSDVHSKIPAVHRYEVSRVTARLFVGIGKGQL  539

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+AR  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  540  LASKEARCLLLQTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLAWQQDILLAW  599

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  600  FDRFLNSGEDCPNIQRGFEVWWRRAF  625



>ref|XP_007040315.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 ref|XP_007040316.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 ref|XP_007040319.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24816.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24817.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24820.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=657

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 154/228 (68%), Gaps = 15/228 (7%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++LRE+   N + ++ LY+ C GCL  L    L A+ +   D S         +IAR+A
Sbjct  438  SKMLRENSSQNDLRKESLYSACDGCLELLRHHFLRAASSDLQDVS---------QIARQA  488

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+  HSK+P ++R+E+SR+TA+L V IG+G L
Sbjct  489  DNLHWILDILIDRQIAEDFLKSWASQSELSDAHSKVPAVHRYEVSRVTARLFVGIGKGQL  548

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+ R  LL TWL   Y+DFGWMRRA + +D+ LVEDGLS TILTLPL  QQ I+L W
Sbjct  549  LASKEMRCLLLQTWLVPFYDDFGWMRRASKGLDRHLVEDGLSNTILTLPLAWQQEILLAW  608

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIK---QYVPESQLQIALCDYTN  94
            FDRFLN G+DCPNIQ+ F+VWWRRAF +   +  P  QLQ+      N
Sbjct  609  FDRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQEPPRQLQVTTATIEN  656



>gb|KJB20610.1| hypothetical protein B456_003G156100 [Gossypium raimondii]
 gb|KJB20611.1| hypothetical protein B456_003G156100 [Gossypium raimondii]
Length=638

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 159/228 (70%), Gaps = 17/228 (7%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLN---SLLLCASEATCVDESGKDRGVVMGEIAREAD  586
            ++LRE+   N + ++ LY+ C GCL    S  L A+ +   D         + +IAR+AD
Sbjct  420  KMLRENSSQNDLRKESLYSACDGCLELLRSHFLRAALSDLTD---------VNQIARQAD  470

Query  585  NVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLL  406
            N+ WI+DILI+R++ ++F+  WA Q EL+++HSK+P ++R+E+SR+TA+L V IG+G LL
Sbjct  471  NLHWILDILIDRQIAEDFLKSWASQSELSNVHSKVPAVHRYEVSRVTARLFVGIGKGQLL  530

Query  405  VPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWF  226
              K+ R  LL TWL   Y+DFGWMRRA R +D+ L+EDGLS TILTLPL  QQ I+L WF
Sbjct  531  ASKEVRCLLLQTWLVPFYDDFGWMRRASRGLDRHLIEDGLSNTILTLPLAWQQDILLAWF  590

Query  225  DRFLNKGDDCPNIQKAFQVWWRRAFIK----QYVP-ESQLQIALCDYT  97
            DRFLN G+DCPNIQ+AF++WWRRAF K    Q +P ES + IA  + +
Sbjct  591  DRFLNSGEDCPNIQRAFEIWWRRAFWKRSGDQELPRESHVTIATIENS  638



>ref|XP_010058250.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g63850 [Eucalyptus grandis]
Length=523

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 146/206 (71%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            +++LRE+   + I ++ LY  C GCL SL    L A+E+   D         + +IAR+A
Sbjct  304  AKMLRENSSQSDIRKESLYAACDGCLQSLRDHFLLAAESELKD---------VAQIARQA  354

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
             N+QW++DILI+R++ ++F+  WA + E++  H K+P ++R E+SR+TA+L V IG+G L
Sbjct  355  SNLQWLLDILIDRQIAEDFLASWASESEMSDAHPKVPAVHRFEVSRVTARLFVGIGKGQL  414

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L PKDAR  LL TWL   Y DFGWMRRA + +D+ L+EDGLS TILTLPLP QQ IML W
Sbjct  415  LAPKDARCLLLQTWLVPFYNDFGWMRRASKGLDRHLIEDGLSNTILTLPLPWQQEIMLAW  474

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN  +DCPNIQ+ F+VWWRRAF
Sbjct  475  FDRFLNSSEDCPNIQRGFEVWWRRAF  500



>gb|KDO76298.1| hypothetical protein CISIN_1g006210mg [Citrus sinensis]
Length=656

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 151/214 (71%), Gaps = 6/214 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++L E+   N + ++ LY+ C GCL  L     +A     SG+ + V  G+IAR+ADN+
Sbjct  437  SKMLHENSSQNDLRKESLYSACDGCLQLLRQYFLQAA----SGEMQEV--GQIARQADNL  490

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA Q E++  H K+P ++R+E+SR+TA+L V IG+  LL  
Sbjct  491  HWILDILIDRQIAEDFLKIWASQSEISEAHPKVPAVHRYEVSRVTARLFVGIGKAQLLAT  550

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R  LL TWLE  Y+DFGWMRRA   +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  551  KDVRCLLLRTWLEPFYDDFGWMRRASNGLDRHLIEDGLSNTILTLPLAWQQEILLAWFNR  610

Query  219  FLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQ  118
            FLN G+DCPNIQ+ F+VWWRRAF +    + QLQ
Sbjct  611  FLNSGEDCPNIQRGFEVWWRRAFWRHNGEQEQLQ  644



>ref|XP_010255266.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nelumbo 
nucifera]
Length=667

 Score =   206 bits (524),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 146/203 (72%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N +S++ LY+ C GCL  L L    A   D         +G+IAR+ADN+
Sbjct  448  SKMLRENASHNDLSKESLYSACDGCLELLRLHFLRAASSDLQD------VGQIARQADNL  501

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+  WA Q EL+  HS+IP ++R E+SR+TA+L V IG+G LL  
Sbjct  502  HWILDILIDRQIAEDFLKTWAAQSELSKAHSRIPPIHRFEVSRVTARLFVGIGKGQLLAS  561

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL TWL+  Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  562  KEVRCLLLQTWLDPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLAWQQEILLAWFNR  621

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN G+DCPNIQ+ F+VWWRRAF
Sbjct  622  FLNCGEDCPNIQRGFEVWWRRAF  644



>ref|XP_009363413.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Pyrus 
x bretschneideri]
Length=651

 Score =   206 bits (523),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 144/203 (71%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY+ C GCL  L    S A   D         +G+IAR+ADN+
Sbjct  432  SKMLRENSSHNDLRKESLYSACDGCLQLLRHHFSRAAESDLQD------VGQIARQADNL  485

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R+M +EF+  WA Q EL+  HSK+  ++R+EISR+TA+L V +G+G LLV 
Sbjct  486  HWILDILIDRQMAEEFLATWASQTELSEAHSKVAAVHRYEISRVTARLFVGLGKGQLLVS  545

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD RF LL TWL   Y+DF WMRRA + +D+  +EDGLS TILTLPL  Q+ I+L WF+R
Sbjct  546  KDVRFLLLRTWLVPFYDDFAWMRRASKGLDRHSIEDGLSNTILTLPLAWQKEILLAWFNR  605

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN G+DCPNIQ+ F+VWWRRAF
Sbjct  606  FLNSGEDCPNIQRGFEVWWRRAF  628



>ref|XP_006425769.1| hypothetical protein CICLE_v10026330mg [Citrus clementina]
 gb|ESR39009.1| hypothetical protein CICLE_v10026330mg [Citrus clementina]
Length=254

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 149/216 (69%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  VP+N  S D+    +Y  C  CLNSL+     A+E    D+S  ++  V+ +
Sbjct  22   KLLRENNSVPNNAGSADICSETIYTSCRSCLNSLVALFRQANEPEFADKSVHNKEPVVKQ  81

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I  EADN+ W+++IL  R+  DEF  +WA Q+ELA+LHSKIP + R+ IS ITA+L V I
Sbjct  82   IVLEADNLSWLLEILAIRQAADEFALMWASQQELAALHSKIPVVTRYRISCITARLFVGI  141

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL +QQ+
Sbjct  142  GRGELLPSKDTRQMLLQTWLQPLIDDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEEQQS  201

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L W   FL  GD+CPN+Q+AF+VWWRR FI+ YV
Sbjct  202  ILLAWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYV  237



>ref|XP_006476518.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Citrus 
sinensis]
Length=656

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 152/214 (71%), Gaps = 6/214 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++L E+   N + ++ LY+ C GCL  L     +A     SG+ + V  G+IAR+ADN+
Sbjct  437  SKMLHENSSQNDLRKESLYSACDGCLQLLRQYFLQAA----SGEMQEV--GQIARQADNL  490

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA Q E++  H K+P ++R+E+SR+TA+L V IG+  LL  
Sbjct  491  HWILDILIDRQIAEDFLKIWASQSEISEAHPKVPAVHRYEVSRVTARLFVGIGKAQLLAT  550

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R  LL TWLE  Y+DFGWMRRA   +D+ L+EDGLS TILTLPL  QQ I++ WF+R
Sbjct  551  KDVRCLLLRTWLEPFYDDFGWMRRASNGLDRHLIEDGLSNTILTLPLAWQQEILIAWFNR  610

Query  219  FLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQ  118
            FLN G+DCPNIQ+ F+VWWRRAF ++   + QLQ
Sbjct  611  FLNSGEDCPNIQRGFEVWWRRAFWRRNGEQEQLQ  644



>gb|AAR14275.1| predicted protein [Populus tremula x Populus alba]
Length=533

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 145/206 (70%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++LRE+   N + ++ LY  C+GCL  L    L A+     D         +G +AR+A
Sbjct  314  SKMLRENSSQNDLRKESLYLACNGCLQLLQDHFLRAASGDLND---------VGLVARQA  364

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ +EF+  WA Q EL+ +HSKIP ++R+ +SR+TA+L V IG+G L
Sbjct  365  DNLHWILDILIDRQIAEEFLKTWASQSELSDVHSKIPAVHRYGVSRVTARLFVGIGKGQL  424

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+AR  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I L W
Sbjct  425  LASKEARCLLLQTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLAWQQDIFLAW  484

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  485  FDRFLNSGEDCPNIQRGFEVWWRRAF  510



>gb|KJB24321.1| hypothetical protein B456_004G139400 [Gossypium raimondii]
Length=518

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 153/226 (68%), Gaps = 15/226 (7%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREAD  586
            ++LRE+   N + ++ LY+ C GCL  L    L A+ +   D S         +IAR+AD
Sbjct  300  KMLRENSSPNDLRKESLYSACDGCLELLRHHFLRAASSDLQDVS---------QIARQAD  350

Query  585  NVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLL  406
            N+ W++DILIER++ ++F+  WA Q EL+ +HSK+P ++RH +SR+TA+L V +G+G LL
Sbjct  351  NLHWMLDILIERRIAEDFLKSWASQSELSDVHSKVPAVHRHGVSRVTARLFVGMGKGQLL  410

Query  405  VPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWF  226
            VPK+ R+ LL TWL   YEDFGWMRR  + +D  L+EDGLS TILTLPL  Q+ I+L WF
Sbjct  411  VPKEVRYMLLQTWLVPFYEDFGWMRRVSKGVDTHLIEDGLSNTILTLPLAWQREILLAWF  470

Query  225  DRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQL--QIALCDYTN  94
             RFLN  ++CPNIQ+ F+VWWRRAF  Q   E QL  Q+ L   TN
Sbjct  471  YRFLNSSENCPNIQRGFEVWWRRAFW-QRNGEQQLPTQLHLTTPTN  515



>gb|KHN16799.1| BTB/POZ domain-containing protein [Glycine soja]
Length=429

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 151/225 (67%), Gaps = 9/225 (4%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C  CL  L     +A  +D         + +IAR+ADN+
Sbjct  210  SKMLRENASQNDLRKESLYLACDDCLQLLRHHFLQAAALDMQD------VSQIARQADNL  263

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DIL++R++ ++F+  WA Q +LA +HSK+P ++R E+SR+TA+L V IG+G LL  
Sbjct  264  HWILDILVDRQIAEDFLKTWASQSDLAEVHSKVPAVHRFEVSRVTARLFVGIGKGQLLAS  323

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  324  KDVRCLLLKTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLSWQQDILLAWFNR  383

Query  219  FLNKGDDCPNIQKAFQVWWRRAFIKQYVPES---QLQIALCDYTN  94
            FLN G+DCPNIQ+ F+VWWRRAF K+   +    QL+I      N
Sbjct  384  FLNSGEDCPNIQRGFEVWWRRAFWKRNGEQERTRQLRITTTSVEN  428



>ref|XP_007210316.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica]
 gb|EMJ11515.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica]
Length=700

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 144/203 (71%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY+ C GCL  L    S A   D         +G+IAR+ADN+
Sbjct  481  SKMLRENSSHNDLRKESLYSACDGCLQLLRHHFSRAAESDLQD------VGQIARQADNL  534

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+  WA Q EL+  HSK+  +YR+E+SR+TA+L V +G+G LLV 
Sbjct  535  HWILDILIDRQIAEDFLKTWASQTELSEAHSKVAAVYRYEVSRVTARLFVGLGKGQLLVS  594

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD RF LL TWL   Y+DF WMRRA + +D+  +EDGLS TILTLPL  QQ I+L WF+R
Sbjct  595  KDVRFLLLRTWLVPFYDDFAWMRRASKGLDRHSIEDGLSNTILTLPLAWQQEILLAWFNR  654

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN G+DCPNIQ+ F+VWWRRAF
Sbjct  655  FLNSGEDCPNIQRGFEVWWRRAF  677



>gb|KHG15549.1| hypothetical protein F383_06896 [Gossypium arboreum]
Length=613

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 147/206 (71%), Gaps = 13/206 (6%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREAD  586
            ++LRE+   N + ++ LY+ C GCL  L    L A+ +   D         + +IAR+AD
Sbjct  415  KMLRENPSQNDLRKESLYSACDGCLELLQRHFLRAASSVLQD---------VNQIARQAD  465

Query  585  NVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLL  406
            N+ WI+DILI+R++ ++F+  WA Q EL++ HSK+P ++R E+SR+TA+L V IG+G LL
Sbjct  466  NLHWILDILIDRQIAEDFLKSWASQSELSATHSKVPAIHRFEVSRVTARLFVGIGKGQLL  525

Query  405  VPKDARFSLLSTWLEALYEDFGW-MRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            V K+ARF LL TWL   Y DFGW MRRA + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  526  VSKEARFLLLQTWLVPFYNDFGWMMRRASKGLDRHLIEDGLSNTILTLPLAWQQDILLAW  585

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  586  FDRFLNSGEDCPNIQRGFEVWWRRAF  611



>gb|KDP25402.1| hypothetical protein JCGZ_20558 [Jatropha curcas]
Length=665

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 145/206 (70%), Gaps = 12/206 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++LRE+   N + ++ LY+ C GCL  L      A+     D         +G+IAR+A
Sbjct  446  SKMLRENSSQNDLRKESLYSACDGCLQLLRNHFFRAATGNMED---------IGQIARQA  496

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+  HSKIP ++R+E+SR+TA+L V IG+G L
Sbjct  497  DNLHWILDILIDRQIAEDFLKTWASQTELSDAHSKIPAVHRYEVSRVTARLFVGIGKGQL  556

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+ R  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  557  LASKEVRCLLLQTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLAWQQEILLAW  616

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            F+RFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  617  FNRFLNSGEDCPNIQRGFEVWWRRAF  642



>ref|XP_008238939.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Prunus 
mume]
Length=643

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 144/203 (71%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY+ C GCL  L    S A   D         +G+IAR+ADN+
Sbjct  424  SKMLRENSSHNDLRKESLYSACDGCLELLRHHFSRAAESDLQD------VGQIARQADNL  477

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+  WA Q EL+  HSK+  +YR+E+SR+TA+L V +G+G LLV 
Sbjct  478  HWILDILIDRQIAEDFLKTWASQIELSEAHSKVAAVYRYEVSRVTARLFVGLGKGQLLVS  537

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD RF LL TWL   Y+DF WMRRA + +D+  +EDGLS TILTLPL  QQ I+L WF+R
Sbjct  538  KDVRFLLLQTWLVPFYDDFAWMRRASKGLDRHSIEDGLSNTILTLPLAWQQEILLAWFNR  597

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN G+DCPNIQ+ F+VWWRRAF
Sbjct  598  FLNSGEDCPNIQRGFEVWWRRAF  620



>ref|XP_009341340.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Pyrus 
x bretschneideri]
Length=653

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 146/205 (71%), Gaps = 6/205 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQ  577
            ++LRE+   N + ++ LY+ C GCL  L    S A   D         +G+IAR+ADN+ 
Sbjct  435  KMLRENSSHNDLRKESLYSACDGCLQLLRHHFSRAAESDLQD------VGQIARQADNLH  488

Query  576  WIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPK  397
            WI+DILI+R+M ++F+  WA Q EL+ +HSK+  ++R+EISR+TA+L V +G+G LLV K
Sbjct  489  WILDILIDRQMAEDFLTTWASQTELSEVHSKVAAVHRYEISRVTARLFVGLGKGQLLVSK  548

Query  396  DARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRF  217
            D RF LL TWL   Y+DF WM+RA + +D+  +EDGLS TILTLPL  QQ I+L WF+RF
Sbjct  549  DVRFLLLRTWLVPFYDDFAWMKRASKGLDRHSIEDGLSNTILTLPLAWQQEILLAWFNRF  608

Query  216  LNKGDDCPNIQKAFQVWWRRAFIKQ  142
            LN G+DCPNIQ+ F+VWWRRAF K+
Sbjct  609  LNSGEDCPNIQRGFEVWWRRAFWKR  633



>ref|XP_002963321.1| hypothetical protein SELMODRAFT_270367 [Selaginella moellendorffii]
 gb|EFJ35192.1| hypothetical protein SELMODRAFT_270367 [Selaginella moellendorffii]
Length=450

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 153/217 (71%), Gaps = 6/217 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTIS----RDMLYNLCHGCLNSLL-LCASEATCVDESGKDR-GVVMGEIA  598
            SR+LRE+      S    R  +Y  C  CL +L  L        + +G ++ G +  +I+
Sbjct  227  SRMLRENPSIAKDSWDSCRGCIYRACESCLEALSRLFTQVIESSNAAGYEKEGTLGAQIS  286

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W+VDILI+R++ D FV +WA Q ELASL+S+IP++YR+++SRITA+LC+AIG+
Sbjct  287  RQADNLNWMVDILIDREIADTFVKIWASQAELASLYSRIPSVYRYDVSRITARLCMAIGK  346

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LVP+D RF LL TW + L +DFGW++R C+S+DK  VE+G+SQTILTLPL QQQ I+
Sbjct  347  GQVLVPQDVRFLLLQTWFQPLVDDFGWLQRCCKSLDKKSVEEGISQTILTLPLKQQQFIL  406

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPES  127
            L WFD F     DCPN+ +AF+VWWRR F++  +  S
Sbjct  407  LGWFDCFSRSAGDCPNLNRAFEVWWRRTFVRPLLETS  443



>ref|XP_002974611.1| hypothetical protein SELMODRAFT_271097 [Selaginella moellendorffii]
 gb|EFJ24131.1| hypothetical protein SELMODRAFT_271097 [Selaginella moellendorffii]
Length=450

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 153/217 (71%), Gaps = 6/217 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTIS----RDMLYNLCHGCLNSLL-LCASEATCVDESGKDR-GVVMGEIA  598
            SR+LRE+      S    R  +Y  C  CL +L  L        + +G ++ G +  +I+
Sbjct  227  SRMLRENPSVAKDSWDSCRGCIYRACESCLEALSRLFTQVIESSNAAGYEKEGTLGAQIS  286

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
            R+ADN+ W+VDILI+R++ D FV +WA Q ELASL+S+IP++YR+++SRITA+LC+AIG+
Sbjct  287  RQADNLNWMVDILIDREIADTFVKIWASQAELASLYSRIPSVYRYDVSRITARLCMAIGK  346

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +LVP+D RF LL TW + L +DFGW++R C+S+DK  VE+G+SQTILTLPL QQQ I+
Sbjct  347  GQVLVPQDVRFLLLQTWFQPLVDDFGWLQRCCKSLDKKSVEEGISQTILTLPLKQQQFIL  406

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPES  127
            L WFD F     DCPN+ +AF+VWWRR F++  +  S
Sbjct  407  LGWFDCFSRSAGDCPNLNRAFEVWWRRTFVRPLLETS  443



>ref|XP_010933990.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Elaeis 
guineensis]
Length=639

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 150/214 (70%), Gaps = 10/214 (5%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            +S++ LY+ C GCL  L            +         +IAR+ADN+ WI+DILI+R++
Sbjct  432  LSKESLYSACEGCLRLL------RHHFVRAAAADLSEAAQIARQADNLHWILDILIDRQI  485

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF+  WA Q EL+  HSK+P ++R+E+SR+TA+L V +G+G +LV K+AR  LL TWL
Sbjct  486  ADEFLWTWAAQAELSEAHSKVPAIHRYEVSRVTARLFVGVGKGQILVSKEARCLLLGTWL  545

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            +  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I+L WFDRFLN GDDCPNIQ
Sbjct  546  DPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLAVQQEILLAWFDRFLNSGDDCPNIQ  605

Query  183  KAFQVWWRRAFIKQY-VPESQLQI---ALCDYTN  94
            + F+VWWRRAF ++   PE   Q+   A+C+ ++
Sbjct  606  RGFEVWWRRAFWRRNGEPERPPQLRLAAVCENSS  639



>gb|KDO79429.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
Length=357

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 149/216 (69%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  VP+N  S D+    +Y  C  CLNSL+     A+E    D+S  ++  V+ +
Sbjct  125  KLLRENNSVPNNAGSADICSETIYTSCRSCLNSLVALFRQANEPEFADKSVHNKEPVVKQ  184

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I  EADN+ W+++IL  R+  DEF  +WA Q+ELA+LHSKIP + R+ IS ITA+L V I
Sbjct  185  IVLEADNLSWLLEILAIRQAADEFALMWASQQELAALHSKIPVVTRYRISCITARLFVGI  244

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL +QQ+
Sbjct  245  GRGELLPSKDTRQMLLQTWLQPLIDDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEEQQS  304

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L W   FL  GD+CPN+Q+AF+VWWRR FI+ YV
Sbjct  305  ILLAWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYV  340



>ref|XP_003532421.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Glycine max]
 ref|XP_006584729.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Glycine max]
Length=538

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 145/206 (70%), Gaps = 6/206 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C  CL  L     +A  +D         + +IAR+ADN+
Sbjct  319  SKMLRENASQNDLRKESLYLACDDCLQLLRHHFLQAAALDMQD------VSQIARQADNL  372

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DIL++R++ ++F+  WA Q +LA +HSK+P ++R E+SR+TA+L V IG+G LL  
Sbjct  373  HWILDILVDRQIAEDFLKTWASQSDLAEVHSKVPAVHRFEVSRVTARLFVGIGKGQLLAS  432

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  433  KDVRCLLLKTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLSWQQDILLAWFNR  492

Query  219  FLNKGDDCPNIQKAFQVWWRRAFIKQ  142
            FLN G+DCPNIQ+ F+VWWRRAF K+
Sbjct  493  FLNSGEDCPNIQRGFEVWWRRAFWKR  518



>gb|KJB37507.1| hypothetical protein B456_006G208800 [Gossypium raimondii]
Length=613

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 146/206 (71%), Gaps = 13/206 (6%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREAD  586
            ++LRE+   N + ++ LY+ C GCL  L    L A+ +   D         + +IAR+AD
Sbjct  415  KMLRENPSQNDLRKESLYSACDGCLELLQRHFLRAASSDLQD---------VNQIARQAD  465

Query  585  NVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLL  406
            N+ WI+DILI+R++ ++F+  WA Q EL++ HSK+P ++R E+SR+TA+L V IG+G LL
Sbjct  466  NLHWILDILIDRQIAEDFLKSWASQSELSATHSKVPAIHRFEVSRVTARLFVGIGKGQLL  525

Query  405  VPKDARFSLLSTWLEALYEDFGW-MRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
              K+ARF LL TWL   Y DFGW MRRA + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  526  ASKEARFLLLQTWLVPFYNDFGWMMRRASKGLDRHLIEDGLSNTILTLPLAWQQDILLAW  585

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
            FDRFLN G+DCPNIQ+ F+VWWRRAF
Sbjct  586  FDRFLNSGEDCPNIQRGFEVWWRRAF  611



>gb|KDO79424.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79425.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79426.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79427.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
 gb|KDO79428.1| hypothetical protein CISIN_1g014635mg [Citrus sinensis]
Length=421

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 149/216 (69%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  VP+N  S D+    +Y  C  CLNSL+     A+E    D+S  ++  V+ +
Sbjct  189  KLLRENNSVPNNAGSADICSETIYTSCRSCLNSLVALFRQANEPEFADKSVHNKEPVVKQ  248

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I  EADN+ W+++IL  R+  DEF  +WA Q+ELA+LHSKIP + R+ IS ITA+L V I
Sbjct  249  IVLEADNLSWLLEILAIRQAADEFALMWASQQELAALHSKIPVVTRYRISCITARLFVGI  308

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL +QQ+
Sbjct  309  GRGELLPSKDTRQMLLQTWLQPLIDDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEEQQS  368

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L W   FL  GD+CPN+Q+AF+VWWRR FI+ YV
Sbjct  369  ILLAWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYV  404



>gb|KHG02986.1| hypothetical protein F383_23864 [Gossypium arboreum]
Length=646

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 140/202 (69%), Gaps = 6/202 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQ  577
            ++LRE+   N + ++ LY+ C  CL  L      A  +D           +IAR+ADN+ 
Sbjct  428  KMLRENSSHNDLRKESLYSACDSCLELLRHLFFRAASLDLQD------ASQIARQADNLH  481

Query  576  WIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPK  397
            WI+DILI+R++ +EF+  WA Q EL+  HSK+P ++R E+SR+TA+L V IG+G LL  K
Sbjct  482  WILDILIDRQIAEEFLKTWASQSELSGAHSKVPVVHRFEVSRVTARLFVGIGKGQLLASK  541

Query  396  DARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRF  217
            + R+ LL TWL   Y+DFGWMRRA + +D+ L+EDGLS +ILTLPL  QQ I L WFDRF
Sbjct  542  EVRWLLLQTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNSILTLPLAWQQEIFLAWFDRF  601

Query  216  LNKGDDCPNIQKAFQVWWRRAF  151
            LN G+DCPNIQ+ F+VWWRRAF
Sbjct  602  LNSGEDCPNIQRGFEVWWRRAF  623



>gb|KHN00573.1| BTB/POZ domain-containing protein [Glycine soja]
Length=404

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 152/226 (67%), Gaps = 7/226 (3%)
 Frame = -2

Query  756  RLLRED--VPD----NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAR  595
            +LLRE+  +P       I  D +Y  C  CL+SLL    +A   D+  +DR  +   IA 
Sbjct  172  KLLRENNSLPSYARSTDICNDTIYRSCRSCLDSLLSLFKQAAEPDKPSEDRDPIAKCIAL  231

Query  594  EADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRG  415
            EADN+ W+++IL++++  DEF  +WA+Q+ELA LH+K+PTM R+ +S ++ +L V IGRG
Sbjct  232  EADNLSWLLEILVDKQAADEFALMWANQQELALLHTKLPTMLRYHVSCLSGRLYVGIGRG  291

Query  414  HLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIML  235
             LL  KD R  LL TWL+ L  D+ W++  CRS D+ LVE+G+ +TILTLPL  QQ+I+L
Sbjct  292  ELLPSKDTRRLLLQTWLQPLMNDYNWLQHGCRSFDRKLVEEGIGRTILTLPLEYQQSILL  351

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYT  97
            +W   FL  GD CPN+Q+AF+VWWRR FI+ YV E+Q  +A+ D +
Sbjct  352  SWLGSFLKTGDSCPNLQRAFEVWWRRTFIRPYV-ENQGNVAVSDSS  396



>gb|EYU40075.1| hypothetical protein MIMGU_mgv1a002655mg [Erythranthe guttata]
Length=649

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 146/203 (72%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            +++LRE+   N + ++ LY  C+GCL  L +   +A   D         +G+IAR+ADN+
Sbjct  429  TKMLRENSSQNDLRKESLYFACNGCLKLLRVSFLQAAQGDMQD------VGQIARQADNL  482

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W++DILI+R + ++F+++WA +  L+  HSK+  ++R+E+SR+TA+L V IG+  LL  
Sbjct  483  HWLLDILIDRLIAEDFLNIWASENLLSESHSKVAPIHRYEVSRVTARLFVGIGKRQLLAS  542

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+AR+ LL TWL   YEDFGWM+RA R +D+ L+EDGLS TI TLP+  Q+ I+L+WF+R
Sbjct  543  KEARYMLLQTWLVPFYEDFGWMKRASRGLDRHLIEDGLSNTISTLPMEWQKEILLSWFER  602

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN GDDCPNIQ+ F++WWRRAF
Sbjct  603  FLNGGDDCPNIQRGFEMWWRRAF  625



>ref|XP_008783441.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
 ref|XP_008783443.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
 ref|XP_008783444.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Phoenix 
dactylifera]
Length=640

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 149/214 (70%), Gaps = 10/214 (5%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            +S++ LY+ C GCL  L            +         +IAR+ADN+ WI+DILI+R++
Sbjct  433  LSKESLYSACDGCLRLL------RHHFLRAAAADLSEAAQIARQADNLHWILDILIDRQI  486

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF+  WA Q EL+ +HSK+P ++R+E+SR+TA+L V +G+G +LV K+AR  LL  WL
Sbjct  487  ADEFLRTWAAQAELSVVHSKVPAIHRYEVSRVTARLFVGVGKGQILVSKEARCLLLRIWL  546

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            E  YEDFGWMRRAC+ +D+ L+EDGL+ TILTLPL  QQ I L WF+RFLN GD+CPNIQ
Sbjct  547  EPFYEDFGWMRRACKGLDRHLIEDGLANTILTLPLAMQQEIFLAWFERFLNSGDECPNIQ  606

Query  183  KAFQVWWRRAFIKQY-VPESQLQI---ALCDYTN  94
            + F+VWWRRAF ++   PE   Q+   A+C+ ++
Sbjct  607  RGFEVWWRRAFWRRNGEPEQPPQLRIAAVCENSS  640



>ref|XP_010243288.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
 ref|XP_010243289.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
Length=538

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 150/217 (69%), Gaps = 10/217 (5%)
 Frame = -2

Query  756  RLLRED--VPDNT-----ISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMG  607
            RLLRE+  +P N+     I    +YN C  CL+SLLL    A++    D+S   +G V+ 
Sbjct  301  RLLRENNKLPVNSGGIADICNVNIYNSCRNCLDSLLLLFRQAADPGFTDKSMDGKGSVVK  360

Query  606  EIAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVA  427
            +IA EADN+ W+++IL +R+  DEF  +WA Q+ELA+LHS++PT+ RH IS ITA+L V 
Sbjct  361  QIALEADNLLWLLEILADRQAADEFALIWASQQELATLHSRLPTVSRHLISCITARLFVG  420

Query  426  IGRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQ  247
            IGRG +L  KD R  LL TWL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ
Sbjct  421  IGRGEILPSKDTRLLLLQTWLQPLIDDYSWLQHGCRSFDRKVVEEGMGRTILTLPLEDQQ  480

Query  246  AIMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            +I+L+W   FL  GD CPN+Q+AF+VWWRR FIK + 
Sbjct  481  SILLSWLGSFLKAGDSCPNLQRAFEVWWRRTFIKPFT  517



>ref|XP_002887934.1| hypothetical protein ARALYDRAFT_315042 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64193.1| hypothetical protein ARALYDRAFT_315042 [Arabidopsis lyrata subsp. 
lyrata]
Length=548

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 141/203 (69%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  329  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  382

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +HSK+P ++R EISR+TA++ V IG+G +L P
Sbjct  383  HWILDILIDRQIAEDFIVMWASLSELSEVHSKVPVVHRFEISRVTARIFVGIGKGQILTP  442

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ   L WFDR
Sbjct  443  KEVRCLLLRNWLTPFYDDFGWMRRASKGLDRYLIEDGLSNTILTLPLAWQQEFFLAWFDR  502

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  503  FLNSNEDCPNIQRGFEVWWRRAF  525



>ref|NP_176570.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q9CAJ9.1|Y1385_ARATH RecName: Full=BTB/POZ domain-containing protein At1g63850 [Arabidopsis 
thaliana]
 gb|AAG52452.1|AC010852_9 hypothetical protein; 43750-42004 [Arabidopsis thaliana]
 gb|AEE34156.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=548

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 141/203 (69%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  329  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  382

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +HSK+P ++R EISR+TA++ V IG+G +L P
Sbjct  383  HWILDILIDRQIAEDFIVMWASLSELSEVHSKVPVVHRFEISRVTARIFVGIGKGQILTP  442

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ   L WFDR
Sbjct  443  KEVRCLLLRNWLTPFYDDFGWMRRASKGLDRYLIEDGLSNTILTLPLAWQQEFFLAWFDR  502

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  503  FLNSNEDCPNIQRGFEVWWRRAF  525



>ref|XP_010254985.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
Length=539

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 150/216 (69%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNT----ISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            RLLRE+  VP N     I  + +YN C  CL+SLL     A+E    D+S   +G V+ +
Sbjct  300  RLLRENNNVPTNGGLADICSENIYNSCQSCLSSLLHLFRQAAEPGFTDKSMDGKGPVVKQ  359

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I+ EADN+ W+++IL +R+  DEF  +WA Q+ELA+LHS++P + RH IS ITA+L V I
Sbjct  360  ISLEADNLLWLLEILADRQAADEFALIWASQQELATLHSRLPAVSRHLISCITARLFVGI  419

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            G+G +L  KD R  LL TWL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+
Sbjct  420  GKGEILPSKDTRLLLLQTWLQPLIDDYSWLQHGCRSFDRKVVEEGMGRTILTLPLENQQS  479

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L+W   FL  GD+CPN+Q+AF+VWWRR FI+ +V
Sbjct  480  ILLSWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPFV  515



>ref|XP_006466699.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Citrus 
sinensis]
Length=535

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 149/216 (69%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  VP+N  S D+    +Y  C  CLNSL+     A+E    D+S  ++  V+ +
Sbjct  303  KLLRENNSVPNNAGSADICSETIYTSCRSCLNSLVALFRQANEPEFADKSVHNKEPVVKQ  362

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I  EADN+ W+++IL  R+  DEF  +WA Q+ELA+LHSKIP + R+ IS ITA+L V I
Sbjct  363  IVLEADNLSWLLEILAIRQAADEFALMWASQQELAALHSKIPVVTRYRISCITARLFVGI  422

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL +QQ+
Sbjct  423  GRGELLPSKDTRQMLLQTWLQPLIDDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEEQQS  482

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L W   FL  GD+CPN+Q+AF+VWWRR FI+ YV
Sbjct  483  ILLAWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYV  518



>gb|KEH21112.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=595

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 148/209 (71%), Gaps = 12/209 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++L E+   N + ++ LY+ C  CL  L    L A+++   D         + +IAR+A
Sbjct  376  SKMLHENSSQNDLRKESLYSACDDCLQLLRHHFLRAADSDLQD---------VSQIARQA  426

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+ +WA + EL+  HSK+P ++R E+SR+TA+L V IG+G L
Sbjct  427  DNLHWILDILIDRQIAEDFLKMWASESELSEAHSKVPAVHRFEVSRVTARLFVGIGKGQL  486

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+AR  LL TWL   Y+DFGWMRRA + +D+ ++EDGLS TILTLPL  QQ I+L W
Sbjct  487  LATKEARCLLLKTWLVPFYDDFGWMRRASKGLDRHIIEDGLSNTILTLPLSWQQEILLAW  546

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQ  142
            F+RFLN G+DCPNIQ+ F+VWWRRAF K+
Sbjct  547  FNRFLNSGEDCPNIQRGFEVWWRRAFWKR  575



>ref|XP_003629532.1| hypothetical protein MTR_8g078590 [Medicago truncatula]
Length=328

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 145/216 (67%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLREDVPDNTISR------DMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+    + +R      DM+Y  C  CL+SL+     A+E T  D+    R  V+  
Sbjct  95   KLLRENNSLPSYARSTDSCNDMIYRSCRSCLDSLVSLFKQAAEPTFADKPSDGRDSVVKH  154

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W++DIL++++  DEF  LWA+Q+ELA LH+K+P + R+ +S I+ +L V I
Sbjct  155  IALEADNLSWLLDILVDKQAADEFALLWANQQELAVLHAKLPIVSRYHVSCISGKLYVGI  214

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L  D+ W++  CRS D+ LVE+G+ +TILTLPL  QQ+
Sbjct  215  GRGELLPLKDTRQLLLQTWLQPLMSDYNWLQHGCRSFDRKLVEEGIGRTILTLPLEDQQS  274

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L+W   FL  GD CPN+Q+AF+VWWRR FI+ YV
Sbjct  275  ILLSWVGSFLKTGDSCPNLQRAFEVWWRRTFIRPYV  310



>ref|XP_010418426.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Camelina 
sativa]
Length=548

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 141/203 (69%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  329  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  382

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +HSK+P ++R EISR+TA++ V IG+G +L P
Sbjct  383  HWILDILIDRQIAEDFIVMWASLSELSDVHSKVPVVHRFEISRVTARIFVGIGKGQILTP  442

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DFGWMRRA + +D+ ++EDGLS TILTLPL  QQ   L WFDR
Sbjct  443  KEVRCLLLRNWLTPFYDDFGWMRRASKGLDRYMIEDGLSNTILTLPLAWQQEFFLAWFDR  502

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  503  FLNSNEDCPNIQRGFEVWWRRAF  525



>gb|EPS69450.1| hypothetical protein M569_05314, partial [Genlisea aurea]
Length=512

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 145/206 (70%), Gaps = 7/206 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            +++LRE+ P N + ++ LY+ C GCL SL    L A+ A       KD      +IAR++
Sbjct  291  TKMLRENSPRNDLRKESLYSACDGCLKSLHSHFLAAAAAAAAAVDTKD----AVQIARQS  346

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++DILIER+MG++F+  WA   EL+  HS++P ++R+E+SR+T +L + IGRG +
Sbjct  347  DNLHWLLDILIERQMGEDFLKTWASLSELSEAHSRVPPVHRYEVSRVTGRLLIGIGRGQV  406

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            LV K AR  LL TWL   YEDFGW+RRA + +D+ L+E+GLS T+LTLP+  Q+ IM+ W
Sbjct  407  LVSKAARCLLLQTWLVPFYEDFGWLRRASKGLDRHLMEEGLSNTVLTLPMAWQKEIMMAW  466

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAF  151
             DRFL+   DCPN+Q+ FQVWWRRAF
Sbjct  467  LDRFLDGSQDCPNMQRGFQVWWRRAF  492



>ref|XP_007160095.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris]
 gb|ESW32089.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris]
Length=610

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 144/209 (69%), Gaps = 12/209 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++L E+   N + ++ LY  C  CL  L    L A+ +   D         + +IAR+A
Sbjct  391  SKMLHENSSQNDLRKESLYLACDDCLQLLRHHFLQAAGSNLQD---------VSQIARQA  441

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DIL++R++ ++F+  WA Q +LA  HSK+P ++R EISR+TA+L V IG+G L
Sbjct  442  DNLHWILDILVDRQIAEDFLKTWASQADLAEAHSKVPAVHRFEISRVTARLFVGIGKGQL  501

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KD R  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  502  LASKDVRCLLLKTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLSWQQDILLAW  561

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQ  142
            FDRFLN G+DCPNIQ+ F+VWWRRAF K+
Sbjct  562  FDRFLNSGEDCPNIQRGFEVWWRRAFWKR  590



>ref|XP_003524451.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Glycine max]
Length=564

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 144/206 (70%), Gaps = 6/206 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   + + ++ LY  C  CL  L     +A   D         + +IAR+ADN+
Sbjct  345  SKMLRENSSQSDLRKESLYLACDDCLQLLRHHFLQAVASDMQD------LSQIARQADNL  398

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DIL++R++ ++F+  WA Q +LA  HSK+P ++R E+SR+TA+L V IG+G LL  
Sbjct  399  HWILDILVDRQIAEDFLKTWASQSDLAEAHSKVPAVHRFEVSRVTARLFVGIGKGQLLAS  458

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPLP QQ I+L WF+R
Sbjct  459  KDVRCLLLKTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLPCQQDILLAWFNR  518

Query  219  FLNKGDDCPNIQKAFQVWWRRAFIKQ  142
            FLN G+DCPNIQ+ F+VWWRRAF K+
Sbjct  519  FLNSGEDCPNIQRGFEVWWRRAFWKR  544



>ref|XP_006302105.1| hypothetical protein CARUB_v10020096mg [Capsella rubella]
 gb|EOA35003.1| hypothetical protein CARUB_v10020096mg [Capsella rubella]
Length=548

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 140/203 (69%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  329  SKMLRENSSGNDLRKESLYLACDGCLHKLKRHFLQAAESDLENVD------QIARQADNL  382

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +H K+P ++R EISR+TA++ V IG+G +L P
Sbjct  383  HWILDILIDRQIAEDFIVMWASLSELSEVHGKVPVVHRFEISRVTARIFVGIGKGQILTP  442

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ   L WFDR
Sbjct  443  KEVRCLLLRNWLTPFYDDFGWMRRASKGLDRYLIEDGLSNTILTLPLAWQQEFFLAWFDR  502

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  503  FLNSNEDCPNIQRGFEVWWRRAF  525



>ref|XP_010473631.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Camelina 
sativa]
Length=547

 Score =   196 bits (497),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 140/203 (69%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  328  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  381

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +H K+P ++R EISR+TA++ V IG+G +L P
Sbjct  382  HWILDILIDRQIAEDFIVMWASLSELSEVHGKVPVVHRFEISRVTARIFVGIGKGQILTP  441

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ   L WFDR
Sbjct  442  KEVRCLLLRNWLTPFYDDFGWMRRASKGLDRYLIEDGLSNTILTLPLAWQQEFFLAWFDR  501

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  502  FLNSNEDCPNIQRGFEVWWRRAF  524



>ref|XP_010430498.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Camelina 
sativa]
Length=549

 Score =   196 bits (497),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 140/203 (69%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  330  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  383

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +H K+P ++R EISR+TA++ V IG+G +L P
Sbjct  384  HWILDILIDRQIAEDFIVMWASLSELSDVHGKVPVVHRFEISRVTARIFVGIGKGQILTP  443

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ   L WFDR
Sbjct  444  KEVRCLLLRNWLTPFYDDFGWMRRASKGLDRYLIEDGLSNTILTLPLAWQQEFFLAWFDR  503

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  504  FLNSNEDCPNIQRGFEVWWRRAF  526



>gb|KHN44517.1| BTB/POZ domain-containing protein [Glycine soja]
Length=404

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 144/210 (69%), Gaps = 1/210 (0%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            I  DM+Y  C  CL+SLL    +A   D+  +D       IA EADN+ W+++ILI+++ 
Sbjct  189  ICNDMIYRSCRSCLDSLLSLFKQAAEPDKLSEDHNPTAKCIALEADNLSWLLEILIDKQA  248

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF  +WA+Q+ELA LH+K+PT+ R+ +S ++ +L V IGRG LL  KD R  LL TWL
Sbjct  249  ADEFALMWANQQELAVLHAKLPTVSRYYVSCLSGRLYVGIGRGELLPSKDVRRLLLQTWL  308

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L  D+ W++  CRS D+ LVE+G+ +TILTLPL  QQ+I+L+W   FL  GD CPN+Q
Sbjct  309  QPLMNDYNWLQHGCRSFDRKLVEEGIGRTILTLPLEDQQSILLSWLGSFLKTGDSCPNLQ  368

Query  183  KAFQVWWRRAFIKQYVPESQLQIALCDYTN  94
            +AF+VWWRR FI+ YV E+Q  +A+ D ++
Sbjct  369  RAFEVWWRRTFIRPYV-ENQGNVAVSDSSS  397



>gb|KFK38021.1| hypothetical protein AALP_AA3G059800 [Arabis alpina]
Length=537

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 139/203 (68%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  318  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  371

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +HSK+P ++R EISR+TA+  V IG+G +L P
Sbjct  372  HWILDILIDRQIAEDFLVIWASLSELSEVHSKVPVVHRFEISRVTARFFVGIGKGQILTP  431

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DF WMRRA + +D+ L+EDGLS TILTLPL  QQ   L WFDR
Sbjct  432  KEVRCLLLRNWLTPFYDDFAWMRRASKGLDRYLIEDGLSNTILTLPLAWQQEFFLAWFDR  491

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  492  FLNSTEDCPNIQRGFEVWWRRAF  514



>gb|KJB52168.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
 gb|KJB52169.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
 gb|KJB52170.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
Length=643

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 138/202 (68%), Gaps = 6/202 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQ  577
            ++LRE+   N + ++ LY+ C  CL  L      A  +D           +IAR+ADN+ 
Sbjct  425  KMLRENSSHNDLRKESLYSACDSCLELLRHHFFRAASLDLQD------ASQIARQADNLH  478

Query  576  WIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPK  397
            WI+DILI+R++ ++F+  WA Q EL+  HSK+P  +R E+SR+TA+L V IG+G LL  K
Sbjct  479  WILDILIDRQIAEDFLKTWASQSELSDSHSKVPVFHRFEVSRVTARLFVGIGKGQLLASK  538

Query  396  DARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRF  217
            + R  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS +ILTLPL  QQ I L WFDRF
Sbjct  539  ELRCLLLQTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNSILTLPLAWQQEIFLAWFDRF  598

Query  216  LNKGDDCPNIQKAFQVWWRRAF  151
            LN G+DCPNIQ+ F+VWWRRAF
Sbjct  599  LNSGEDCPNIQRGFEVWWRRAF  620



>ref|XP_002303602.2| hypothetical protein POPTR_0003s13090g [Populus trichocarpa]
 gb|EEE78581.2| hypothetical protein POPTR_0003s13090g [Populus trichocarpa]
Length=656

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 143/200 (72%), Gaps = 12/200 (6%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREA  589
            S++LRE+   N + ++ LY  C+GCL  L    L A+     D         +G+IAR+A
Sbjct  437  SKMLRENSSQNDLRKESLYLACNGCLQLLQDHFLRAASGVLND---------VGQIARQA  487

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ WI+DILI+R++ ++F+  WA Q EL+++HSKIP ++R+E+SR+TA+L V IG+G L
Sbjct  488  DNLHWILDILIDRQIAEDFLKTWASQSELSAVHSKIPAIHRYEVSRVTARLFVGIGKGQL  547

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  K+AR  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L W
Sbjct  548  LASKEARSLLLQTWLVPFYDDFGWMRRATKGLDRHLIEDGLSNTILTLPLAWQQDILLAW  607

Query  228  FDRFLNKGDDCPNIQKAFQV  169
            FDRFLN G+DCPNIQ+ F+V
Sbjct  608  FDRFLNSGEDCPNIQRGFEV  627



>ref|XP_003548003.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Glycine 
max]
Length=543

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 144/210 (69%), Gaps = 1/210 (0%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            I  DM+Y  C  CL+SLL    +A   D+  +D       IA EADN+ W+++ILI+++ 
Sbjct  328  ICNDMIYRSCRSCLDSLLSLFKQAAEPDKLSEDHNPTAKCIALEADNLSWLLEILIDKQA  387

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF  +WA+Q+ELA LH+K+PT+ R+ +S ++ +L V IGRG LL  KD R  LL TWL
Sbjct  388  ADEFALMWANQQELAVLHAKLPTVSRYYVSCLSGRLYVGIGRGELLPSKDVRRLLLQTWL  447

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L  D+ W++  CRS D+ LVE+G+ +TILTLPL  QQ+I+L+W   FL  GD CPN+Q
Sbjct  448  QPLMNDYNWLQHGCRSFDRKLVEEGIGRTILTLPLEDQQSILLSWLGSFLKTGDSCPNLQ  507

Query  183  KAFQVWWRRAFIKQYVPESQLQIALCDYTN  94
            +AF+VWWRR FI+ YV E+Q  +A+ D ++
Sbjct  508  RAFEVWWRRTFIRPYV-ENQGNVAVSDSSS  536



>ref|XP_002275454.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Vitis 
vinifera]
 emb|CBI17589.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 150/222 (68%), Gaps = 10/222 (5%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  VP    S D+    +Y+ C  CL+SLL     A+E    D+  +++  V+ +
Sbjct  302  KLLRENSSVPSYAGSADICNETIYSSCRSCLDSLLSMFRQAAEPGFTDKPMENKEPVLKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I  EADN+ W+++IL +R+  DEF  +WA Q+ELA+LH+K+P + RH +S ITA+L V I
Sbjct  362  ITLEADNLSWLLEILADRQAADEFAVMWASQQELATLHTKLPVVSRHHVSCITARLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+
Sbjct  422  GRGELLPSKDTRQLLLQTWLQPLINDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQS  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV-PESQL  121
            I+L W   FL  GD+CPN+Q+AF+VWWRR F++ YV P+  L
Sbjct  482  ILLAWLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYVEPQGNL  523



>ref|XP_006404002.1| hypothetical protein EUTSA_v10010286mg [Eutrema salsugineum]
 gb|ESQ45455.1| hypothetical protein EUTSA_v10010286mg [Eutrema salsugineum]
Length=527

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 146/219 (67%), Gaps = 7/219 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISR--DMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADN  583
            +LLRE   +N      + +Y  C  CL+S+L    +A+     G++      +IA EADN
Sbjct  306  KLLREQNRNNVADNFNETIYTSCQNCLDSVLSLFKQAS----EGENPETDTKQIAVEADN  361

Query  582  VQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLV  403
            + W++D+L ER+  ++F   WA+QKELA LH K+P M R+ ISR+T++L V IGRG LL 
Sbjct  362  LTWLLDVLAERQAAEDFSITWANQKELALLHEKLPLMSRYHISRVTSRLFVGIGRGELLP  421

Query  402  PKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
             KD R  LLSTWL+ L++D+ W++  CRS D TLVE+G+ +TILTLPL  QQ+I+L W  
Sbjct  422  SKDTRLLLLSTWLQPLFKDYNWLQHGCRSFDGTLVEEGIGRTILTLPLEDQQSILLLWLG  481

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALC  106
             FLN GD CPN+Q+AF+VWWRR+F++ Y  + Q    LC
Sbjct  482  SFLNGGDGCPNLQRAFEVWWRRSFVRPY-SDRQANNGLC  519



>ref|NP_001067187.1| Os12g0596600 [Oryza sativa Japonica Group]
 dbj|BAF30206.1| Os12g0596600, partial [Oryza sativa Japonica Group]
Length=233

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 142/201 (71%), Gaps = 6/201 (3%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMG-EIAREADNVQWIVDILIERK  547
            IS ++LY+ C GCL+ L L  SEAT     G++  V +  +I  E DN+ W+V+IL+ ++
Sbjct  38   ISSELLYSSCQGCLDRLRLLFSEAT-----GQEFSVELTRQITLETDNLLWLVEILVNQR  92

Query  546  MGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTW  367
            + D+FV LWA+Q ++A LH K+P   RH +S ITA+L V IGRG +L  K+ R  LL  W
Sbjct  93   ICDDFVALWANQSKIAELHGKLPVASRHTVSCITARLFVGIGRGEMLPSKNTRLLLLQVW  152

Query  366  LEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNI  187
            L+ L +D+ W++ +CRS D+ LVE+G+ QTILTLPL  Q++++L W  RFL  GD+CPN+
Sbjct  153  LQPLIDDYSWLQCSCRSFDRKLVEEGIGQTILTLPLEDQRSMLLAWLGRFLKLGDNCPNL  212

Query  186  QKAFQVWWRRAFIKQYVPESQ  124
            Q+AF+VWWRR F++ YV +++
Sbjct  213  QRAFEVWWRRTFVRPYVSQAR  233



>ref|XP_009376454.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Pyrus 
x bretschneideri]
Length=536

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 137/199 (69%), Gaps = 3/199 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLN---SLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            +  + LYN C  CLN   SL   A+E    D++  ++  V+ +I   ADNV W+++IL +
Sbjct  323  VCNETLYNSCRSCLNLLLSLFKQAAEPESSDKTSNNKEPVVKQIDLAADNVSWLLEILAD  382

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            ++  DEF  +WA Q+ELA+LH+K+P + R  +SRITA+L V IGRG LL  KD R  LL 
Sbjct  383  KQAADEFAVMWASQQELAALHTKLPIVSRFHVSRITARLFVGIGRGELLPSKDTRQLLLQ  442

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
            TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL +QQ+IML+W   FL  GD CP
Sbjct  443  TWLQPLINDYNWLQHGCRSFDRKIVEEGIGRTILTLPLEEQQSIMLSWLGSFLKAGDSCP  502

Query  192  NIQKAFQVWWRRAFIKQYV  136
            N+Q+AF+VWWRR F++ YV
Sbjct  503  NLQRAFEVWWRRTFVRPYV  521



>gb|KEH20448.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=542

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 145/216 (67%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLREDVPDNTISR------DMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+    + +R      DM+Y  C  CL+SL+     A+E T  D+    R  V+  
Sbjct  309  KLLRENNSLPSYARSTDSCNDMIYRSCRSCLDSLVSLFKQAAEPTFADKPSDGRDSVVKH  368

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W++DIL++++  DEF  LWA+Q+ELA LH+K+P + R+ +S I+ +L V I
Sbjct  369  IALEADNLSWLLDILVDKQAADEFALLWANQQELAVLHAKLPIVSRYHVSCISGKLYVGI  428

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L  D+ W++  CRS D+ LVE+G+ +TILTLPL  QQ+
Sbjct  429  GRGELLPLKDTRQLLLQTWLQPLMSDYNWLQHGCRSFDRKLVEEGIGRTILTLPLEDQQS  488

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L+W   FL  GD CPN+Q+AF+VWWRR FI+ YV
Sbjct  489  ILLSWVGSFLKTGDSCPNLQRAFEVWWRRTFIRPYV  524



>ref|XP_004509225.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509226.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Cicer arietinum]
Length=545

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 146/216 (68%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPD----NTISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P     N I  DM+Y  C  C++SLL      +E +  ++   +R  V+  
Sbjct  312  KLLRENNSLPSYARSNDICNDMIYRSCRSCVDSLLSLFKQVAEPSFAEKPSNERDSVVKH  371

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W++DILI+++  DEF  +WA+Q ELASLH+K+P + R+ +S I+ +L V I
Sbjct  372  IALEADNISWLLDILIDKQAADEFALIWANQHELASLHAKLPIVSRYHVSCISGRLYVGI  431

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  K+ R  LL TWL+ L  D+ W++  CRS D+ LVE+G+ +TILTLPL  QQ+
Sbjct  432  GRGELLPSKETRQLLLQTWLQPLMNDYNWLQHGCRSFDRKLVEEGIGRTILTLPLEDQQS  491

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L+W   FL  GD CPN+Q+AF+VWWRR FI+ Y+
Sbjct  492  ILLSWVGSFLKTGDSCPNLQRAFEVWWRRTFIRPYI  527



>ref|XP_006391703.1| hypothetical protein EUTSA_v10023392mg [Eutrema salsugineum]
 gb|ESQ28989.1| hypothetical protein EUTSA_v10023392mg [Eutrema salsugineum]
Length=554

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 140/203 (69%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  335  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  388

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +H+K+P ++R EISR+TA++ V IG+G +L P
Sbjct  389  HWILDILIDRQIAEDFLVMWASLSELSQVHAKVPVVHRFEISRVTARIFVGIGKGQILTP  448

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DF WM+RA + +D+ L+EDGLS TILTLPL  QQ   L WFDR
Sbjct  449  KEVRCLLLRNWLTPFYDDFAWMKRASKGLDRYLIEDGLSSTILTLPLAWQQEFFLAWFDR  508

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPN+Q+ F+VWWRRAF
Sbjct  509  FLNSNEDCPNMQRGFEVWWRRAF  531



>ref|XP_010555851.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Tarenaya 
hassleriana]
Length=539

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 137/203 (67%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++L E+   N +S++ LY  C GCL  L     +A   D    D      +I R+ADN+
Sbjct  316  SKMLHENSSGNDLSKESLYLACDGCLQMLKHHFLQAAASDMENVD------QIGRQADNL  369

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W++DILI+R++ ++F+  WA   EL+ +H K+P ++R+EISR+TA+L V IG+G +L P
Sbjct  370  HWVLDILIDRQIAEDFLITWASLSELSEMHPKVPAVHRYEISRVTARLFVGIGKGQILAP  429

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y DFGWMRRA + +D+ L+E+GLS TILTLPL  QQ   L WFDR
Sbjct  430  KEVRCLLLRNWLTPFYNDFGWMRRASKGLDRYLIEEGLSNTILTLPLAWQQEFFLAWFDR  489

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPN+Q+ F+VWWRR+F
Sbjct  490  FLNSSEDCPNLQRGFEVWWRRSF  512



>ref|XP_006419001.1| hypothetical protein EUTSA_v10002519mg [Eutrema salsugineum]
 gb|ESQ37437.1| hypothetical protein EUTSA_v10002519mg [Eutrema salsugineum]
Length=464

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 154/221 (70%), Gaps = 31/221 (14%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQ  577
            RL+RE+  D+ +S+D LYN+     + L+LC SE T    +  + G ++GE AREA N+ 
Sbjct  269  RLIREEA-DHDVSKDSLYNVS----SLLILCLSEITS---NMINPGDLIGETAREASNLL  320

Query  576  WIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPK  397
            W  DILIE+ + DEFV LWADQKELA+LHSKI                +  G+G ++V +
Sbjct  321  W--DILIEKNICDEFVQLWADQKELANLHSKI----------------LRFGKGKIVVKR  362

Query  396  DARFSLLSTWLEALYEDFGWMRRAC-RSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            + RFS+L TWLEA+Y+DF WMRRA  RS+D  +VEDGLS+ ILTL L QQQ I++ WFDR
Sbjct  363  ETRFSVLKTWLEAMYDDFVWMRRASSRSMDWKVVEDGLSKMILTLSLRQQQVILMKWFDR  422

Query  219  FLNKGDDCPNIQKAFQVWWRRAFIKQYVPE----SQLQIAL  109
            F++KGD+CPN+++AF+VWWRRAFI+Q + E    SQ+QI L
Sbjct  423  FMSKGDECPNVERAFEVWWRRAFIRQVIVEPRDASQVQITL  463



>ref|XP_010941924.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941925.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=526

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 141/212 (67%), Gaps = 4/212 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            I  + L   C  CL+SLL     ASE   VD+S + +  V+  IA EADN+ W+V+IL +
Sbjct  316  ICTETLNGSCQNCLDSLLALLRQASEPGFVDKSLESKDPVVRRIALEADNLLWLVEILAD  375

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            R M  EF  +W+ Q ELA LHSK+P + RH +S ITA+L VAIGRG +L  KD R  LL 
Sbjct  376  RHMAGEFAVMWSSQNELAELHSKLPIVSRHPVSSITARLFVAIGRGEMLPSKDTRQQLLH  435

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
             WL+ L +D+ W++  CRS D+ +VE+G+ QTILTLPL  QQ I+L+W   FL  GD+CP
Sbjct  436  VWLQPLIDDYSWLQHGCRSFDRKVVEEGIGQTILTLPLEDQQNILLSWLGSFLKVGDNCP  495

Query  192  NIQKAFQVWWRRAFIKQYVPESQLQIALCDYT  97
            N+Q+AF+VWWRR FI+ YV E Q  +A  D +
Sbjct  496  NLQRAFEVWWRRTFIRPYV-EQQGNLAQLDRS  526



>ref|XP_002310195.1| hypothetical protein POPTR_0007s12160g [Populus trichocarpa]
 gb|EEE90645.1| hypothetical protein POPTR_0007s12160g [Populus trichocarpa]
Length=536

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 146/216 (68%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNT----ISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P  T    I  D +Y+ C  CLNSLL     A+E    D+   ++  V+ +
Sbjct  302  KLLRENNSLPSYTDSSDICNDTIYSSCRSCLNSLLSLFKQAAEPEFSDKPLDNKEPVVKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W+++IL +R+  DEF  +W+ Q+ELA+LHSK+P + R+ +S IT++L V I
Sbjct  362  IALEADNLSWLLEILADRQAADEFALMWSSQQELAALHSKLPIVSRYHVSCITSRLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  Q++
Sbjct  422  GRGELLPSKDTRHLLLQTWLQPLINDYSWLQHGCRSFDRKVVEEGIGRTILTLPLENQRS  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L W   FL  GD+CPN+Q+AF+VWWRR FI+ Y 
Sbjct  482  ILLAWLGTFLKAGDNCPNLQRAFEVWWRRTFIRPYT  517



>ref|XP_010069058.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW57276.1| hypothetical protein EUGRSUZ_H00077 [Eucalyptus grandis]
Length=529

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 137/203 (67%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+       +  LY+ C  C  SL      A   D +       +G+I+R+ADN+
Sbjct  310  SKMLRENPSLGNQRKKSLYSACDMCFQSLRHHFLRAMASDFTE------VGQISRQADNL  363

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W++DILI+R++ +EF+  WA Q EL+  HS +P ++R E+SR+TA+L V +G+G +LVP
Sbjct  364  HWMLDILIDRQIAEEFLRKWASQFELSKAHSSVPAIHRFEVSRVTARLFVGVGKGQILVP  423

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R  LL TWL   Y DF WMR+A + +D+ L+E+GL   ILTLPL QQQ I L WF+R
Sbjct  424  KDTRSLLLQTWLVPFYGDFPWMRKASKGLDRHLIEEGLGSMILTLPLAQQQEIFLGWFER  483

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN G+DCPNIQ+ F+VWW+RAF
Sbjct  484  FLNSGEDCPNIQRGFEVWWKRAF  506



>ref|XP_008241873.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Prunus 
mume]
Length=529

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 137/199 (69%), Gaps = 3/199 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLN---SLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            +  + LYN C  CLN   SL   A+E  C D+   ++  V+ +IA  +DN+ W+++IL +
Sbjct  316  VCHETLYNSCRNCLNLLLSLFKQATEPVCADKPVDNKEPVVKQIALASDNLSWLLEILAD  375

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            ++  DEF  +WA Q+ELASLH+K+P + R+ +S ITA+L V IGRG LL  KD R  LL 
Sbjct  376  KQAADEFGVMWASQQELASLHTKLPIVSRYHVSCITARLFVGIGRGELLPSKDTRQLLLQ  435

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
            TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+I+L+W   FL  GD CP
Sbjct  436  TWLQPLINDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQSILLSWLGSFLKAGDSCP  495

Query  192  NIQKAFQVWWRRAFIKQYV  136
            N+Q+AF+VWWRR F++ YV
Sbjct  496  NLQRAFEVWWRRTFVRPYV  514



>ref|XP_007203630.1| hypothetical protein PRUPE_ppa003965mg [Prunus persica]
 gb|EMJ04829.1| hypothetical protein PRUPE_ppa003965mg [Prunus persica]
Length=537

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 137/199 (69%), Gaps = 3/199 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLN---SLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            +  + LYN C  CLN   SL   A+E  C D+   ++  V+ +IA  +DN+ W+++IL +
Sbjct  324  VCHETLYNSCRNCLNLLLSLFKQATEPECADKPVDNKEPVVKQIALASDNLSWLLEILAD  383

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            ++  DEF  +WA Q+ELASLH+K+P + R+ +S ITA+L V IGRG LL  KD R  LL 
Sbjct  384  KQAADEFGVMWASQQELASLHTKLPIVSRYHVSCITARLFVGIGRGELLPSKDTRQLLLQ  443

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
            TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+I+L+W   FL  GD CP
Sbjct  444  TWLQPLINDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQSILLSWLGSFLKAGDSCP  503

Query  192  NIQKAFQVWWRRAFIKQYV  136
            N+Q+AF+VWWRR F++ YV
Sbjct  504  NLQRAFEVWWRRTFVRPYV  522



>ref|XP_011025688.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Populus 
euphratica]
Length=536

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 145/216 (67%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNT----ISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P  T    I  D +Y  C  CLNSLL     A+E    D+   ++  V+ +
Sbjct  302  KLLRENNSLPSYTDSSDICNDTIYRSCRSCLNSLLSLFKQAAEPEFSDKPLDNKEPVVKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W+++IL +R+  DEF  +W+ Q+ELA+LHSK+P + R+ +S IT++L V I
Sbjct  362  IALEADNLSWLLEILADRQAADEFALMWSSQQELAALHSKLPIVSRYHVSCITSRLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  Q++
Sbjct  422  GRGELLPSKDTRHLLLQTWLQPLINDYSWLQHGCRSFDRKVVEEGIGRTILTLPLENQRS  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L W   FL  GD+CPN+Q+AF+VWWRR FI+ Y 
Sbjct  482  ILLAWLGTFLKAGDNCPNLQRAFEVWWRRTFIRPYT  517



>ref|XP_010069057.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Eucalyptus grandis]
Length=545

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 137/203 (67%), Gaps = 6/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+       +  LY+ C  C  SL      A   D +       +G+I+R+ADN+
Sbjct  326  SKMLRENPSLGNQRKKSLYSACDMCFQSLRHHFLRAMASDFTE------VGQISRQADNL  379

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             W++DILI+R++ +EF+  WA Q EL+  HS +P ++R E+SR+TA+L V +G+G +LVP
Sbjct  380  HWMLDILIDRQIAEEFLRKWASQFELSKAHSSVPAIHRFEVSRVTARLFVGVGKGQILVP  439

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KD R  LL TWL   Y DF WMR+A + +D+ L+E+GL   ILTLPL QQQ I L WF+R
Sbjct  440  KDTRSLLLQTWLVPFYGDFPWMRKASKGLDRHLIEEGLGSMILTLPLAQQQEIFLGWFER  499

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN G+DCPNIQ+ F+VWW+RAF
Sbjct  500  FLNSGEDCPNIQRGFEVWWKRAF  522



>ref|XP_011085536.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011085537.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011085538.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
Length=525

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 136/199 (68%), Gaps = 7/199 (4%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKMGDE  535
            + L++ C   L+SLL    +A        +R  V+  +A EADN+ W++DIL +R+  DE
Sbjct  322  ETLFSSCRNSLDSLLSLFRKAA-------EREPVVKLMAIEADNLLWLLDILADRQAADE  374

Query  534  FVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLEAL  355
            F   WA+Q+ELASLH+++P +YRH +S ITA+L V IGRG LL  KD R  LL TWLE L
Sbjct  375  FAITWANQQELASLHTRLPIVYRHHVSTITARLFVGIGRGELLPSKDTRHLLLKTWLEPL  434

Query  354  YEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQKAF  175
              D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+I+L+W   FL  GD+CPN+Q+AF
Sbjct  435  INDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQSILLSWLGSFLKAGDNCPNLQRAF  494

Query  174  QVWWRRAFIKQYVPESQLQ  118
            +VWWRR FI+ YV    LQ
Sbjct  495  EVWWRRTFIRPYVESEALQ  513



>ref|XP_008338182.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Malus 
domestica]
Length=536

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 137/199 (69%), Gaps = 3/199 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLN---SLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            +  + LYN C  CLN   SL   A+E    D++  ++  V+ +I   ADN+ W+++IL +
Sbjct  323  VCNETLYNSCRSCLNLLLSLFKQAAEPESSDKTFDNKEPVVKQIDLAADNLSWLLEILAD  382

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            ++  DEF  +WA Q+ELA+LH+K+P + R+ +SRITA+L V IGRG LL  KD R  LL 
Sbjct  383  KQAADEFAVMWASQQELAALHTKLPIVSRYXVSRITARLFVGIGRGELLPSKDTRQLLLQ  442

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
            TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+IML+W   FL  GD CP
Sbjct  443  TWLQPLINDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQSIMLSWLGSFLKAGDSCP  502

Query  192  NIQKAFQVWWRRAFIKQYV  136
            N+Q+AF+VWWRR F++ YV
Sbjct  503  NLQRAFEVWWRRTFVRPYV  521



>ref|XP_011009912.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Populus 
euphratica]
Length=518

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 146/216 (68%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPD----NTISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P     + I ++ +Y+ C  CLNSLL     A+E    D+    +  V+ +
Sbjct  302  KLLRENSSLPSYAGSSDICKETIYSSCTICLNSLLSLFKKAAEPEFTDKPVNSKQTVVKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W+++IL +R+  DEF  +W+ Q+EL +LHSK+P + R+ +S IT++L V I
Sbjct  362  IALEADNLSWLLEILADRQAADEFALMWSSQQELTALHSKLPIVSRYHVSCITSRLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ 
Sbjct  422  GRGELLPSKDTRHLLLQTWLQPLISDYSWLQHGCRSFDRKVVEEGIGRTILTLPLENQQT  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L+W   FL  GD+CPN+Q+AF+VWWRR FI+ Y+
Sbjct  482  ILLSWLGTFLKSGDNCPNLQRAFEVWWRRTFIRPYM  517



>ref|XP_008808898.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
 ref|XP_008808899.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
 ref|XP_008808900.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
Length=528

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 141/207 (68%), Gaps = 4/207 (2%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            + LY+ C  CL+SLL     ASE    + S + +  V+ +IA EADN+ W+V+IL +R +
Sbjct  319  ETLYSSCRNCLDSLLAVFRQASEPGFAERSLEIKDPVVRQIALEADNLVWLVEILADRHI  378

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF  +WA Q ELA LHSK+P M RH IS ITA+L VAIG+G +L  KD R  LL  WL
Sbjct  379  ADEFAVIWASQNELAELHSKLPIMSRHLISCITARLFVAIGKGEMLPSKDTRQLLLHVWL  438

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ I+L+W   FL  GD+CPN+Q
Sbjct  439  QPLIDDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQNILLSWLGSFLKVGDNCPNLQ  498

Query  183  KAFQVWWRRAFIKQYVPESQLQIALCD  103
            +AF+VWWRR FI+ YV E Q  +A  D
Sbjct  499  RAFEVWWRRTFIRPYV-EQQGNLAQSD  524



>ref|XP_002307226.1| hypothetical protein POPTR_0005s13800g [Populus trichocarpa]
 gb|EEE94222.1| hypothetical protein POPTR_0005s13800g [Populus trichocarpa]
Length=518

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 144/216 (67%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P    S D+    +Y+ C  CLNSLL     A+E    D     +  V+ +
Sbjct  302  KLLRENSSLPSYAGSSDICNETIYSSCRICLNSLLSLFKKAAEPEFTDTPVNSKQTVVKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W+++IL +R+  DEF  +W+ Q+EL +LHSK+P + R+ +S IT++L V I
Sbjct  362  IALEADNLSWLLEILADRQAADEFALMWSSQQELTALHSKLPIVSRYHVSCITSRLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ 
Sbjct  422  GRGELLPSKDTRHLLLQTWLQPLISDYSWLQHGCRSFDRKVVEEGIGRTILTLPLENQQT  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L+W   FL  GD+CPN+Q+AF+VWWRR FI+ Y+
Sbjct  482  ILLSWLGTFLKSGDNCPNLQRAFEVWWRRTFIRPYM  517



>ref|XP_009398931.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=584

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 132/186 (71%), Gaps = 6/186 (3%)
 Frame = -2

Query  708  LYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKMGDEFV  529
            LY     CL SL    + A   D +         +IAR+ADN+ WI+DILI+R+  D+F+
Sbjct  394  LYTASDRCLRSLRHHFARAAASDLTDA------AQIARQADNLHWILDILIDRQSADDFL  447

Query  528  DLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLEALYE  349
              WA Q EL+ LH ++P + R+E+SR+TA+L + +G+G +LVPK+AR  LL TW+E+ YE
Sbjct  448  RTWACQTELSELHPRVPAINRYEVSRVTARLFIGVGKGQILVPKEARCLLLRTWMESFYE  507

Query  348  DFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQKAFQV  169
            DFGW+R+ C  +D+ L+E+GL+ T+LTLPL  QQ ++L WF RFLN GDDCPNIQK F++
Sbjct  508  DFGWIRQRCNGLDRHLIEEGLANTVLTLPLATQQEVLLGWFHRFLNAGDDCPNIQKGFEM  567

Query  168  WWRRAF  151
            WWRRAF
Sbjct  568  WWRRAF  573



>gb|KJB17837.1| hypothetical protein B456_003G018200 [Gossypium raimondii]
Length=536

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 142/213 (67%), Gaps = 9/213 (4%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKD---RGVVMGEIAREADNVQWIVDILIE  553
            +  + +Y L   CL+SLL    +A  ++ S K    R  V+ +IA EADN+ W+++IL +
Sbjct  319  VCNETVYTLSRSCLDSLLSLFKQAVELEPSDKSMDSREPVVKQIALEADNLSWLLEILAD  378

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            R+  DEF  +WA Q+ELA+LHSK+P + RH +S ITA+L V IG+G LL  KD R  LL 
Sbjct  379  RQSADEFALMWASQQELATLHSKLPIVSRHHVSCITARLFVGIGKGELLPAKDTRQLLLQ  438

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
            TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+I+L W   FL  GD+CP
Sbjct  439  TWLQPLINDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQSILLTWLGSFLKAGDNCP  498

Query  192  NIQKAFQVWWRRAFIKQY------VPESQLQIA  112
            N+Q+AF+VWWRR FI+ Y      VP+S   +A
Sbjct  499  NLQRAFEVWWRRTFIRPYSDAQGNVPQSDSSMA  531



>emb|CDY08328.1| BnaC09g12680D [Brassica napus]
Length=532

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 139/203 (68%), Gaps = 7/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  313  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  366

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +H K+P ++R EISR+TA++ V IG+G +L P
Sbjct  367  HWILDILIDRQIAEDFLVMWASLSELSDVHGKVPVVHRFEISRVTARIFVGIGKGQILTP  426

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DF WM+RA + +D+ LVEDGLS TILTLPL  QQ   L WFDR
Sbjct  427  KEVRCLLLRNWLTPFYDDFAWMKRASKGLDRYLVEDGLSNTILTLPLAWQQEFFLAWFDR  486

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  487  FLN-SNDCPNIQRGFEVWWRRAF  508



>ref|XP_010941741.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941747.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941755.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=526

 Score =   187 bits (475),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 135/196 (69%), Gaps = 3/196 (2%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            + LY+ C  CL+SLL     ASE    + S + +  V+  IA EADN+ W+V+IL +R +
Sbjct  319  ETLYSSCRNCLDSLLAVFRQASEPGFAERSLEIKDPVVRHIALEADNLLWLVEILADRHI  378

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF  +WA Q ELA LHSK+P M RH IS ITA+L VAIGRG +L  KD R  LL  WL
Sbjct  379  ADEFAVMWASQNELAELHSKLPIMSRHLISCITARLFVAIGRGEMLPSKDTRQLLLHVWL  438

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ I+L+W   FL  GD+CPN+Q
Sbjct  439  QPLIDDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQNILLSWLGSFLKVGDNCPNLQ  498

Query  183  KAFQVWWRRAFIKQYV  136
            +AF+VWWRR FI+ YV
Sbjct  499  RAFEVWWRRTFIRPYV  514



>ref|XP_009388509.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388510.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388511.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388512.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388513.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=532

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 133/196 (68%), Gaps = 3/196 (2%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLL---LCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            ++ Y+ C  C+ SLL     ASE    D+S   +  VM  IA EADN+ W+V+IL +R  
Sbjct  325  ELFYSSCRSCMESLLDLFRQASEPGFSDKSLDSKDPVMRHIALEADNLLWLVEILADRHA  384

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF  LWA Q ELA LHSK+P M RH +S ITA+L V IG+G +L P+D R  LL  WL
Sbjct  385  ADEFAVLWAGQHELAELHSKLPIMSRHLVSCITARLFVGIGKGEILPPRDTRQLLLQVWL  444

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L  D+ W++  CRS D+ +VE+G+ QTILTLPL  QQ+I+L+W   FL  GD+CPN+Q
Sbjct  445  QPLIGDYSWLQHGCRSFDRKVVEEGIGQTILTLPLEDQQSILLSWLGSFLKVGDNCPNLQ  504

Query  183  KAFQVWWRRAFIKQYV  136
            +AF+VWWRR FI+ YV
Sbjct  505  RAFEVWWRRTFIRPYV  520



>ref|XP_009776607.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
sylvestris]
 ref|XP_009776608.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
sylvestris]
Length=536

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            +++Y  C  CLNS+L     A+E    + S   R  V+ ++  EADN+ W+++IL +R+ 
Sbjct  322  EIIYGSCTSCLNSVLSLFKQAAEPEFSNNSSDCREPVVKQMVLEADNLSWMLEILTDRQA  381

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF  +WA Q+ELASLH+K+P + RH +S ITA+L V IGRG LL  KD R  LL TWL
Sbjct  382  ADEFAVMWASQQELASLHTKLPIVSRHHVSCITARLFVGIGRGELLPSKDTRNLLLQTWL  441

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L  D+ W++  CRS D+ +VE+G+ +TILTLPL +QQ+I+L+W   FL  GD+CPN+Q
Sbjct  442  QPLINDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEEQQSILLSWLGSFLKSGDNCPNLQ  501

Query  183  KAFQVWWRRAFIKQY  139
            +AF+VWWRR F++ Y
Sbjct  502  RAFEVWWRRTFVRPY  516



>ref|XP_009112778.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Brassica 
rapa]
Length=534

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 139/203 (68%), Gaps = 7/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  315  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  368

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +H K+P ++R EISR+TA++ V IG+G +L P
Sbjct  369  HWILDILIDRQIAEDFLVMWASLSELSDVHGKVPVVHRFEISRVTARIFVGIGKGQILTP  428

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DF WM+RA + +D+ LVEDGLS TILTLPL  QQ   L WFDR
Sbjct  429  KEVRCLLLRNWLTPFYDDFAWMKRASKGLDRYLVEDGLSNTILTLPLAWQQEFFLAWFDR  488

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  489  FLN-SNDCPNIQRGFEVWWRRAF  510



>ref|XP_010029862.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 ref|XP_010029863.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 ref|XP_010029864.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 gb|KCW56822.1| hypothetical protein EUGRSUZ_I02489 [Eucalyptus grandis]
Length=526

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 149/216 (69%), Gaps = 8/216 (4%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDE-----SGKDRGVVMGEIARE  592
            +LL+E+        + +YN C  CL +L+ C  +AT ++      +GK+  +++ +IA E
Sbjct  301  KLLKENNSSLPSCNEAIYNSCRSCLYALVSCFKQATELESNDSIIAGKE--MLVKQIALE  358

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            +DN+ W+++IL +R+  D+F  +WA Q+ELA+LH K+P M R+ +S ITA+L V IGRG 
Sbjct  359  SDNLTWLLEILADRQAADDFAVMWAGQQELATLHGKLPIMSRYHVSCITARLFVGIGRGQ  418

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            LL  K+ R  LL TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+I+L+
Sbjct  419  LLPSKETRQMLLKTWLQPLINDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQSILLS  478

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQ  124
            W   FL  GD+CPN+Q+AF+VWWRR F++ YV ESQ
Sbjct  479  WLGSFLKAGDNCPNLQRAFEVWWRRTFVRPYV-ESQ  513



>ref|XP_009379165.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Pyrus 
x bretschneideri]
 ref|XP_009379166.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Pyrus 
x bretschneideri]
Length=531

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 137/200 (69%), Gaps = 3/200 (2%)
 Frame = -2

Query  726  TISRDMLYNLCHGCLN---SLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILI  556
             +  + LYN C  C+N   SL   A+E    D+   ++  V+ +IA  ADN+ W+++IL 
Sbjct  324  NVCNETLYNSCRSCVNLLLSLFKHAAEPESSDKPVDNKEPVVKQIALAADNLSWLLEILA  383

Query  555  ERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLL  376
            +++  DEF  +WA Q+ELA+LH+K+P + R+ +S ITA+L V IGRG LL  KD R  LL
Sbjct  384  DKQAADEFAVMWASQQELAALHTKLPIVSRYHVSCITARLFVGIGRGELLPSKDTRLLLL  443

Query  375  STWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDC  196
             TWL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+IML+W   FL  GD C
Sbjct  444  QTWLQPLIDDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQSIMLSWLGSFLKAGDSC  503

Query  195  PNIQKAFQVWWRRAFIKQYV  136
            PN+Q+AF+VWWRR F++ Y+
Sbjct  504  PNLQRAFEVWWRRTFVRPYM  523



>gb|KHG25971.1| hypothetical protein F383_06642 [Gossypium arboreum]
Length=536

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 144/215 (67%), Gaps = 9/215 (4%)
 Frame = -2

Query  756  RLLRED--VPDNT----ISRDMLYNLCHGCLNSLLLCASEATCVDESGKD---RGVVMGE  604
            +LLRE+  +P       +  + +Y L   CL+SLL    +A  ++ S K    R  V+ +
Sbjct  302  KLLRENNSLPSYAGPADVCNETVYTLSRSCLDSLLSLFKQAVELERSDKSVDSREPVVKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W+++IL +R+  DEF  +WA Q+ELA+LHSK+P + RH +S ITA+L V I
Sbjct  362  IALEADNLSWLLEILADRQSADEFALMWASQQELATLHSKLPIVSRHHVSCITARLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            G+G LL  KD R  LL TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+
Sbjct  422  GKGELLPAKDTRQLLLQTWLQPLINDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQS  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
            I+L W   FL  GD+CPN+Q+AF+VWWRR FI+ Y
Sbjct  482  ILLTWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPY  516



>emb|CDY38217.1| BnaA09g11720D [Brassica napus]
Length=533

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 139/203 (68%), Gaps = 7/203 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++LRE+   N + ++ LY  C GCL+ L     +A   D    D      +IAR+ADN+
Sbjct  314  SKMLRENSSGNDLRKESLYLACDGCLHKLKRQFLQAAESDLENVD------QIARQADNL  367

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+ +WA   EL+ +H K+P ++R EISR+TA++ V IG+G +L P
Sbjct  368  HWILDILIDRQIAEDFLVMWASLSELSDVHGKVPVVHRFEISRVTARIFVGIGKGQILTP  427

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            K+ R  LL  WL   Y+DF WM+RA + +D+ +VEDGLS TILTLPL  QQ   L WFDR
Sbjct  428  KEVRCLLLRNWLTPFYDDFAWMKRASKGLDRYVVEDGLSNTILTLPLAWQQEFFLVWFDR  487

Query  219  FLNKGDDCPNIQKAFQVWWRRAF  151
            FLN  +DCPNIQ+ F+VWWRRAF
Sbjct  488  FLN-SNDCPNIQRGFEVWWRRAF  509



>gb|EMT31851.1| hypothetical protein F775_21356 [Aegilops tauschii]
Length=559

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 134/196 (68%), Gaps = 3/196 (2%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            + LY+ C  CL SLL     AS++   ++S + +  V+ +I  EADN+ W+ DIL  R  
Sbjct  352  ETLYSYCQNCLESLLTLFQQASDSDFSEQSSELKEPVLRQITLEADNLLWLTDILAGRNA  411

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             +EF  LW++Q+ELA LHSK+PT  RH +S +TA+L VAIG+G +L  KD R  LL  WL
Sbjct  412  AEEFAGLWSNQRELAGLHSKLPTKSRHLVSCVTARLFVAIGKGEMLPSKDTRQLLLDVWL  471

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L +D+ W++  CRS D+T+VE+G+  TILTLPL  QQ I+L+W   FL  G+ CPN+Q
Sbjct  472  QPLMDDYNWLQHGCRSFDRTVVEEGIGATILTLPLEDQQTILLSWLGSFLKVGNSCPNLQ  531

Query  183  KAFQVWWRRAFIKQYV  136
            KAF+VWWRR F++ YV
Sbjct  532  KAFEVWWRRTFVRPYV  547



>ref|XP_008797004.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
Length=526

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 140/204 (69%), Gaps = 4/204 (2%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            + LY+ CH CL+SLL     ASE    D+S + +  V+ +IA  ADN+ W+V+IL +R +
Sbjct  319  ETLYSSCHNCLDSLLALFREASEPGFADKSLESKDPVVRQIALGADNLLWLVEILADRHI  378

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
              EF  +W+ Q EL+ LHSK+P + RH +S ITA+L VAIGRG +L   D R  LL  WL
Sbjct  379  AGEFAVMWSSQNELSELHSKLPIVSRHPVSCITARLFVAIGRGEVLPSMDTRQLLLHVWL  438

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L +D+ W++  CRS D+ +VE+G+ QTILTLPL  QQ I+L+WF  FL  GD+CPN+Q
Sbjct  439  QPLIDDYSWLQHVCRSFDRKVVEEGIGQTILTLPLEDQQNILLSWFGSFLKVGDNCPNLQ  498

Query  183  KAFQVWWRRAFIKQYVPESQLQIA  112
            +AF+VWWRR FI+ YV E Q  +A
Sbjct  499  RAFEVWWRRTFIRPYV-EQQGNLA  521



>ref|XP_002522395.1| protein binding protein, putative [Ricinus communis]
 gb|EEF40079.1| protein binding protein, putative [Ricinus communis]
Length=532

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 135/199 (68%), Gaps = 3/199 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            I  + +Y+    CLNSLL     A+E    +   + R  V+ +IA EADN  W+++IL +
Sbjct  318  ICNETIYSSYRSCLNSLLSLFRQAAEPEFANRPMESREPVVKQIALEADNASWLLEILAD  377

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            R+  DEF  +WA Q+ELA+LH+K+  + R+ +S ITA+L V IGRG LL  KD R  LL 
Sbjct  378  RQAADEFALMWASQQELAALHTKLAIVSRYHVSCITARLFVGIGRGELLPSKDTRQKLLQ  437

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
            TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+I+L W   FL  GD+CP
Sbjct  438  TWLQPLINDYSWLQHGCRSFDRKVVEEGIGRTILTLPLENQQSILLTWLGSFLKAGDNCP  497

Query  192  NIQKAFQVWWRRAFIKQYV  136
            N+QKAF+VWWRRAFI+ YV
Sbjct  498  NLQKAFEVWWRRAFIRPYV  516



>dbj|BAJ95813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 139/200 (70%), Gaps = 4/200 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            I  ++ Y  C GCL  L L   EA+   E+G    V   +I  E DN+ W+V+IL+ +++
Sbjct  329  ICSELFYGSCRGCLERLQLLFVEAS---EAGFPSQVTR-QITLETDNLLWLVEILVNQRI  384

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             D+FV +WA Q ELASLH+K+P   RH +S ITA+L V IGRG +L  KD R  LL  WL
Sbjct  385  CDDFVVMWASQSELASLHAKLPIASRHTVSSITARLFVGIGRGEMLPSKDTRLLLLQVWL  444

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            +AL +D+ W++ +CRS D+ LVE+G+ QTILTLPL  Q++I+L+W  RFL  GD+CPN+Q
Sbjct  445  QALIDDYSWLQCSCRSFDRKLVEEGIGQTILTLPLEDQRSILLSWLGRFLKLGDNCPNLQ  504

Query  183  KAFQVWWRRAFIKQYVPESQ  124
            +AF+VWWRR F++ YV +++
Sbjct  505  RAFEVWWRRTFVRPYVNQAR  524



>ref|XP_006338266.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Solanum 
tuberosum]
Length=536

 Score =   185 bits (469),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 146/215 (68%), Gaps = 9/215 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRD----MLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P ++ S D    ++Y  C  CL+S+L+    A+E      S   R  V+ +
Sbjct  302  KLLRENNCLPSSSGSVDSYNEIIYGSCRSCLDSILILFKQAAEPEFSSNSTDCREPVVKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I  EADN+ W+++IL +R+  DEF  +WA Q+ELASLH+K+P + RH +S ITA+L V I
Sbjct  362  IYLEADNLSWMLEILTDRQAADEFAVMWASQQELASLHTKLPIVSRHHVSCITAKLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            G+G LL  KD R  LL TWL+ L  D+ W++   RS D+ +VE+G+ +TILTLPL +QQ+
Sbjct  422  GKGELLPSKDTRNLLLQTWLQPLINDYSWLQHGSRSFDRKVVEEGIGRTILTLPLEEQQS  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
            I+L+W   FL  GD+CPN+Q+AF+VWWRR F++ Y
Sbjct  482  ILLSWLGSFLKSGDNCPNLQRAFEVWWRRTFVRPY  516



>gb|ABG22069.1| expressed protein [Oryza sativa Japonica Group]
Length=510

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 142/201 (71%), Gaps = 6/201 (3%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMG-EIAREADNVQWIVDILIERK  547
            IS ++LY+ C GCL+ L L  SEAT     G++  V +  +I  E DN+ W+V+IL+ ++
Sbjct  315  ISSELLYSSCQGCLDRLRLLFSEAT-----GQEFSVELTRQITLETDNLLWLVEILVNQR  369

Query  546  MGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTW  367
            + D+FV LWA+Q ++A LH K+P   RH +S ITA+L V IGRG +L  K+ R  LL  W
Sbjct  370  ICDDFVALWANQSKIAELHGKLPVASRHTVSCITARLFVGIGRGEMLPSKNTRLLLLQVW  429

Query  366  LEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNI  187
            L+ L +D+ W++ +CRS D+ LVE+G+ QTILTLPL  Q++++L W  RFL  GD+CPN+
Sbjct  430  LQPLIDDYSWLQCSCRSFDRKLVEEGIGQTILTLPLEDQRSMLLAWLGRFLKLGDNCPNL  489

Query  186  QKAFQVWWRRAFIKQYVPESQ  124
            Q+AF+VWWRR F++ YV +++
Sbjct  490  QRAFEVWWRRTFVRPYVSQAR  510



>ref|XP_009407677.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407678.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407679.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=528

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 132/195 (68%), Gaps = 3/195 (2%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            ++ Y  C  C+ SLL      SE    D S   +  VM +IA EADN+ W+++ILI+R  
Sbjct  323  ELFYGSCRTCMESLLHLFRQVSEPGLSDTSIDSKDPVMRQIALEADNLIWLLEILIDRHA  382

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF   WA Q ELA LHSK+P M RH +S IT++L V IGRG +L  ++ R  LL  WL
Sbjct  383  ADEFATTWASQHELAELHSKLPIMSRHLVSCITSRLFVGIGRGEMLPSRETRQLLLQIWL  442

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L +D+ W++  CRS D+T+VE+G+ QTILTLPL  QQ+I+L+W  RFL  GD+CPN+Q
Sbjct  443  QPLIDDYTWLQHGCRSFDRTVVEEGIGQTILTLPLEDQQSILLSWLGRFLKVGDNCPNLQ  502

Query  183  KAFQVWWRRAFIKQY  139
            +AF+VWWRR FI+ Y
Sbjct  503  RAFEVWWRRTFIRPY  517



>gb|ABA99196.2| expressed protein [Oryza sativa Japonica Group]
Length=513

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 142/201 (71%), Gaps = 6/201 (3%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMG-EIAREADNVQWIVDILIERK  547
            IS ++LY+ C GCL+ L L  SEAT     G++  V +  +I  E DN+ W+V+IL+ ++
Sbjct  315  ISSELLYSSCQGCLDRLRLLFSEAT-----GQEFSVELTRQITLETDNLLWLVEILVNQR  369

Query  546  MGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTW  367
            + D+FV LWA+Q ++A LH K+P   RH +S ITA+L V IGRG +L  K+ R  LL  W
Sbjct  370  ICDDFVALWANQSKIAELHGKLPVASRHTVSCITARLFVGIGRGEMLPSKNTRLLLLQVW  429

Query  366  LEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNI  187
            L+ L +D+ W++ +CRS D+ LVE+G+ QTILTLPL  Q++++L W  RFL  GD+CPN+
Sbjct  430  LQPLIDDYSWLQCSCRSFDRKLVEEGIGQTILTLPLEDQRSMLLAWLGRFLKLGDNCPNL  489

Query  186  QKAFQVWWRRAFIKQYVPESQ  124
            Q+AF+VWWRR F++ YV +++
Sbjct  490  QRAFEVWWRRTFVRPYVSQAR  510



>ref|XP_007156002.1| hypothetical protein PHAVU_003G250400g [Phaseolus vulgaris]
 gb|ESW27996.1| hypothetical protein PHAVU_003G250400g [Phaseolus vulgaris]
Length=546

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 151/227 (67%), Gaps = 10/227 (4%)
 Frame = -2

Query  756  RLLRED--VPD----NTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAR  595
            +LLRE+  +P       I  D +Y  C  CL+SLL    +A    E  +DR  +   IA 
Sbjct  308  KLLRENNSLPSYARTTDICNDTIYRSCRTCLDSLLELFKQAA---EPSEDRDPLAKSIAL  364

Query  594  EADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRG  415
            EADN+ W+++IL++++  DEF  +WA+Q+ELA LH+K+PT+ R+ +S ++ +L V IGRG
Sbjct  365  EADNLTWLLEILVDKQAADEFALMWANQQELAVLHAKLPTVSRYCVSCLSGRLYVGIGRG  424

Query  414  HLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIML  235
             LL  KD R  LL TWL+ L  D+ W++  CRS D+ LVE+G+ +TILTLPL  QQ+I+L
Sbjct  425  ELLPSKDTRRLLLQTWLQPLMNDYNWLQHGCRSFDRKLVEEGIGRTILTLPLEDQQSILL  484

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYTN  94
            +W   FL  GD CPN+Q+AF+VWWRR FI+ YV E+  ++A+ D + 
Sbjct  485  SWCGSFLKTGDSCPNLQRAFEVWWRRTFIRPYV-ENLGKVAVSDSSK  530



>ref|XP_004963062.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Setaria 
italica]
Length=526

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 139/200 (70%), Gaps = 4/200 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            I  + LY+ C GCL+ L    +EA+  D S      V   I  E DN+ W+V+IL+ +++
Sbjct  319  ICSETLYSSCQGCLDRLHRLFTEASEEDYSVS----VTRRITLETDNLLWLVEILVTQRI  374

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             D+FV +W+ Q ELA LHSK+P   RH +S ITA+L V IGRG +L  K+ R  LL  WL
Sbjct  375  CDDFVVMWSSQTELAELHSKLPGASRHTVSCITARLFVGIGRGEMLPSKNTRLRLLQVWL  434

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            +AL +D+ W++ +CRS D+ LVEDG+ QTILTLPL  Q++I+L+WF RFL  GD+CPN+Q
Sbjct  435  QALIDDYSWLQCSCRSFDRKLVEDGIGQTILTLPLEDQRSILLSWFGRFLKLGDNCPNLQ  494

Query  183  KAFQVWWRRAFIKQYVPESQ  124
            +AF+VWWRR F++ YV +++
Sbjct  495  RAFEVWWRRTFVRPYVNQAE  514



>ref|XP_004503685.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cicer 
arietinum]
Length=609

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 143/206 (69%), Gaps = 6/206 (3%)
 Frame = -2

Query  759  SRLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNV  580
            S++L E+   N + ++ LY+ C  C+  L      A   D         + +IAR+ADN+
Sbjct  390  SKMLHENSSQNDLRKESLYSACDDCMQLLRHHFLRAASSDLQN------VSQIARQADNL  443

Query  579  QWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVP  400
             WI+DILI+R++ ++F+  WA + EL+  HSK+P ++R E+SR+TA+L V IG+G LL  
Sbjct  444  HWILDILIDRQIAEDFLKTWASESELSEEHSKVPAVHRFEVSRVTARLFVGIGKGQLLAS  503

Query  399  KDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDR  220
            KDAR  LL TWL   Y+DFGWMRRA + +D+ L+EDGLS TILTLPL  QQ I+L WF+R
Sbjct  504  KDARCLLLKTWLVPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLPLSWQQEILLAWFNR  563

Query  219  FLNKGDDCPNIQKAFQVWWRRAFIKQ  142
            FLN G+DCPNIQ+ F+VWWRRAF K+
Sbjct  564  FLNSGEDCPNIQRGFEVWWRRAFWKR  589



>ref|XP_004232086.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Solanum 
lycopersicum]
Length=536

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 146/215 (68%), Gaps = 9/215 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRD----MLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P ++ S D    ++Y  C  CL+S+L+    A+E      S   R  V+ +
Sbjct  302  KLLRENNCLPSSSGSVDSYNEIIYGSCRSCLDSILILFKQAAEPEFSSNSTDCREPVVKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            +  EADN+ W+++IL +R+  DEF  +WA Q+ELASLH+K+P + RH +S ITA+L V I
Sbjct  362  MVLEADNLSWMLEILTDRQAADEFAVMWASQQELASLHTKLPIVSRHHVSCITAKLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            G+G LL  KD R  LL TWL+ L  D+ W++   RS D+ +VE+G+ +TILTLPL +QQ+
Sbjct  422  GKGELLPSKDTRNLLLQTWLQPLINDYSWLQHGSRSFDRKVVEEGIGRTILTLPLEEQQS  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
            I+L+W   FL  GD+CPN+Q+AF+VWWRR F++ Y
Sbjct  482  ILLSWLGSFLKSGDNCPNLQRAFEVWWRRTFVRPY  516



>gb|KDP31825.1| hypothetical protein JCGZ_12286 [Jatropha curcas]
Length=534

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 145/216 (67%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P    S D+    +Y+ C  CLNSLL     A+E    ++    R  V+ +
Sbjct  302  KLLRENNSLPTYAGSTDICNETIYSSCRCCLNSLLSLFRQAAEPEFANKPMDSREPVVKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W+++IL +R+  DEF  +WA Q+ELA LH ++P + R+ +S +TA+L V I
Sbjct  362  IALEADNLSWLLEILADRQAADEFALMWASQEELAVLHKELPVVSRYHVSCVTARLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  KD R  LL TWL+ L  D+ W++  CR+ D+ +VE+G+ +TILTLPL  QQ+
Sbjct  422  GRGELLPSKDTRNLLLQTWLQPLINDYSWLQHGCRTFDRKVVEEGIGRTILTLPLENQQS  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L+W   FL  GD+CPN+Q+AF+VWWRR FI+ Y+
Sbjct  482  ILLSWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPYI  517



>ref|XP_007047072.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 ref|XP_007047073.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOX91229.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOX91230.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
Length=534

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 146/215 (68%), Gaps = 9/215 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLCASEATCVDESGK---DRGVVMGE  604
            +LLRE+  +P    S D+    +Y  C  CL+SLL    +A+  + + K    +  V+ +
Sbjct  302  KLLRENNSLPSYAGSADICNETVYASCRSCLDSLLSLFKQASDPEFTAKPMESKEPVVKQ  361

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA +ADN+ W+++IL +R+  DEF  +WA Q+ELA+LHSK+P + RH +S ITA+L V I
Sbjct  362  IALQADNLSWLLEILSDRQAADEFALMWASQQELATLHSKLPIVSRHHVSCITARLFVGI  421

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            G+G LL  KD R  LL TWL+ L  D+ W++ +CRS D+ +VE+G+ +TILTLPL  QQ+
Sbjct  422  GKGELLPVKDTRQLLLQTWLQPLINDYSWLQHSCRSFDRKVVEEGIGRTILTLPLEDQQS  481

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
            I+L W   FL  GD+CPN+Q+AF+VWWRR FI+ Y
Sbjct  482  ILLAWLGSFLKAGDNCPNLQRAFEVWWRRTFIRPY  516



>ref|XP_009629328.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
tomentosiformis]
 ref|XP_009629329.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Nicotiana 
tomentosiformis]
Length=538

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 146/215 (68%), Gaps = 9/215 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRD----MLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P ++ S D    ++Y  C  CL+S+L     A+E    + S   R  V+ +
Sbjct  304  KLLRENNSLPSSSDSVDSYNEIIYGSCRSCLDSVLSLFKQAAEPEFSNNSIDCREPVVKQ  363

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            +  EADN+ W+++IL +R+  DEF   WA Q+ELASLH+K+P + RH +S ITA+L V I
Sbjct  364  MVLEADNLSWMLEILTDRQAADEFAVTWASQQELASLHTKLPIVSRHHVSCITARLFVGI  423

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG LL  K+ R  LL TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL +QQ+
Sbjct  424  GRGELLPSKETRNLLLQTWLQPLINDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEEQQS  483

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
            I+L+W   FL  GD+CPN+Q+AF+VWWRR F++ Y
Sbjct  484  ILLSWLGSFLKAGDNCPNLQRAFEVWWRRTFVRPY  518



>ref|XP_004141951.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Cucumis 
sativus]
 gb|KGN48457.1| hypothetical protein Csa_6G487780 [Cucumis sativus]
Length=534

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 147/229 (64%), Gaps = 10/229 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            RLLRE+  V  N  S D+    +Y+ C  CL SLL     A+E    D S   +  V+ +
Sbjct  300  RLLRENQSVSSNASSTDICNEIIYSSCRSCLASLLFLFQQAAETDFTDRSVDRKEPVLKQ  359

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I  EADN+ W+++IL +R+  DEF  +W+  +ELA+LH+K+P + R+ IS ITA+L V I
Sbjct  360  ITLEADNLSWLLEILADRQAADEFAVMWSKHQELATLHAKLPIVSRYHISCITARLFVGI  419

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            G+G LL  KD R  LL TWLE L  D+ W++  C S D+ +VE+G+ +TILTLPL  QQ+
Sbjct  420  GKGELLPAKDTRKLLLHTWLEPLINDYSWLKHGCGSFDRKVVEEGIGRTILTLPLEDQQS  479

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYT  97
            I+L W   FL  GD CPN+Q+AF+VWWRR F++ YV E+Q  I   D +
Sbjct  480  ILLTWLGSFLKVGDSCPNLQRAFEVWWRRTFVRPYV-ETQGSIHQQDSS  527



>gb|EMT14102.1| hypothetical protein F775_07870 [Aegilops tauschii]
Length=518

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 138/200 (69%), Gaps = 4/200 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            I  ++ Y  C GCL  L     EA+   E+G    V   +I  E DN+ W+V+IL+ +++
Sbjct  323  ICSELFYGSCRGCLERLQPLFVEAS---EAGFPSQVTR-QITLETDNILWLVEILVNQRI  378

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             D+FV +WA Q ELASLH+K+P   RH +S ITA+L V IGRG +L  KD R  LL  WL
Sbjct  379  CDDFVVMWASQSELASLHAKLPIASRHTVSSITARLFVGIGRGEMLPSKDTRLLLLQVWL  438

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            +AL +D+ W++ +CRS D+ LVE+G+ QTILTLPL  Q++I+L+W  RFL  GD+CPN+Q
Sbjct  439  QALIDDYSWLQCSCRSFDRKLVEEGIGQTILTLPLEDQRSILLSWLGRFLKLGDNCPNLQ  498

Query  183  KAFQVWWRRAFIKQYVPESQ  124
            +AF+VWWRR F++ YV +++
Sbjct  499  RAFEVWWRRTFVRPYVNQAR  518



>ref|XP_004160488.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At3g50780-like [Cucumis sativus]
Length=534

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 147/229 (64%), Gaps = 10/229 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            RLLRE+  V  N  S D+    +Y+ C  CL SLL     A+E    D S   +  V+ +
Sbjct  300  RLLRENHSVSSNASSTDICNEIIYSSCRSCLASLLFLFQQAAETDFTDRSVDRKEPVLKQ  359

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I  EADN+ W+++IL +R+  DEF  +W+  +ELA+LH+K+P + R+ IS ITA+L V I
Sbjct  360  ITLEADNLSWLLEILADRQAADEFAVMWSKHQELATLHAKLPIVSRYHISCITARLFVGI  419

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            G+G LL  KD R  LL TWLE L  D+ W++  C S D+ +VE+G+ +TILTLPL  QQ+
Sbjct  420  GKGELLPAKDTRKLLLHTWLEPLINDYSWLKHGCGSFDRKVVEEGIGRTILTLPLEDQQS  479

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYT  97
            I+L W   FL  GD CPN+Q+AF+VWWRR F++ YV E+Q  I   D +
Sbjct  480  ILLTWLGSFLKVGDSCPNLQRAFEVWWRRTFVRPYV-ETQGSIHQQDSS  527



>dbj|BAK06120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=523

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 131/196 (67%), Gaps = 3/196 (2%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLLLCASEATCVDESGKD---RGVVMGEIAREADNVQWIVDILIERKM  544
            D LY  C  CL SLL     A+  D S +    +  V+ +I  EADN+ W+ +IL  R  
Sbjct  316  DTLYRYCQNCLESLLTLFQRASDNDFSEQPLELKESVLRQITLEADNLLWLTEILAGRNA  375

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             +EF  LW++Q+ELA LHSK+PT  RH +S +TA+L VAIG+G +L  KD R  LL  WL
Sbjct  376  AEEFAGLWSNQRELAGLHSKLPTKSRHLVSCVTARLFVAIGKGEMLPSKDTRQLLLDVWL  435

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L +D+ W++  CRS D+T+VE+G+  TILTLPL  QQAI+L+W   FL  G+ CPN+Q
Sbjct  436  QPLMDDYNWLQHGCRSFDRTVVEEGIGSTILTLPLEDQQAILLSWLGSFLKVGNSCPNLQ  495

Query  183  KAFQVWWRRAFIKQYV  136
            KAF+VWWRR F++ YV
Sbjct  496  KAFEVWWRRTFVRPYV  511



>ref|XP_010680938.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Beta 
vulgaris subsp. vulgaris]
Length=532

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 141/217 (65%), Gaps = 13/217 (6%)
 Frame = -2

Query  756  RLLRED--------VPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKD---RGVVM  610
            +LLRE+         PD  I  + +Y  C  CL+SLL     AT  + S K    +  + 
Sbjct  302  KLLRENNSSSDSDSSPD--ICYETIYASCRSCLDSLLSHFKRATGPEFSDKPMDCQDPIA  359

Query  609  GEIAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCV  430
             +IA EADN+ W+++IL ER++ DEF  +W  Q+ELASLH K+P M R+ +S ITA+L V
Sbjct  360  KQIALEADNLAWLLEILAERQVADEFALMWIRQQELASLHQKLPAMTRYHVSCITARLFV  419

Query  429  AIGRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqq  250
             IG+G LL  KD R  LL TWLE L  D+ W+   CRS D+ +VE+G+ +TILTLPL  Q
Sbjct  420  GIGKGELLPSKDIRQMLLQTWLEPLTSDYSWLNHGCRSFDRKVVEEGIGRTILTLPLEDQ  479

Query  249  QAIMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
            ++I+L+W   FL  GD+CPN+Q+AF+VWWRR FI+ Y
Sbjct  480  RSILLSWLGNFLKAGDNCPNLQRAFEVWWRRTFIRPY  516



>ref|XP_006664162.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=516

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 139/200 (70%), Gaps = 4/200 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            I  ++LY+ C GCL+ L L   EA+  D S +    +  +I  E DN+ W+V+IL+ +++
Sbjct  321  ICSELLYSSCRGCLDRLRLLFGEASEPDFSAQ----LTRQITLETDNLLWLVEILVNQRI  376

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             D+FV LWA Q E+A LH K+P   RH +S +TA+L V IGRG +L  K+ R  LL  WL
Sbjct  377  CDDFVTLWASQSEIAELHGKLPVASRHTVSCVTARLFVGIGRGEMLPSKNTRLLLLQVWL  436

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            +AL +D+ W++ +CRS D+ LVE+G+ QTILTLPL  Q++++L W  RFL  GD+CPN+Q
Sbjct  437  QALIDDYSWLQCSCRSFDRKLVEEGIGQTILTLPLEDQRSMLLAWLGRFLKLGDNCPNLQ  496

Query  183  KAFQVWWRRAFIKQYVPESQ  124
            +AF+VWWRR F++ YV +++
Sbjct  497  RAFEVWWRRTFVRPYVSQAR  516



>emb|CDP02424.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 137/209 (66%), Gaps = 8/209 (4%)
 Frame = -2

Query  711  MLYNLCHGCLNSLLLCASEATCVDESGKD---RGVVMGEIAREADNVQWIVDILIERKMG  541
            ++Y  C  C++ LL    +AT  + + K    +   + +I+ EADN+ W++DIL +R+  
Sbjct  325  IIYGSCRSCMDVLLSAFRQATESELTSKLHDCKEPFLKQISLEADNLSWLLDILADRQAA  384

Query  540  DEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLE  361
            DEF  +WA Q+ELASLH K+P M R+ +S ITA+L V IGRG LL  KD R  LL TWL+
Sbjct  385  DEFAVMWASQQELASLHGKLPIMSRYHVSCITARLFVGIGRGELLPSKDIRLLLLETWLQ  444

Query  360  ALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQK  181
             L  D+ W++  CRS D+ +VE+G+ +TILTLPL +QQ+I+L W   FL  GD CPN+QK
Sbjct  445  PLINDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEEQQSILLGWLGTFLKAGDSCPNLQK  504

Query  180  AFQVWWRRAFIKQYV-----PESQLQIAL  109
            AF+VWWRR F++ Y      P+S   + L
Sbjct  505  AFEVWWRRTFVRPYTDSVNPPQSDTTVGL  533



>ref|XP_010930640.1| PREDICTED: BTB/POZ domain-containing protein At2g13690-like, 
partial [Elaeis guineensis]
Length=488

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/207 (45%), Positives = 139/207 (67%), Gaps = 5/207 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATC---VDESGK--DRGVVMGEIAREADNVQWIVDIL  559
            I +D LYN+CH CLNSL+    EA+    VD++     R  ++ +I ++ +N+ W+++IL
Sbjct  282  IDKDSLYNICHSCLNSLMGLFQEASASIPVDQTATVGGRNSLIEQITKQVENINWLLEIL  341

Query  558  IERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSL  379
            I++ + ++FV+LWADQKEL  LH K   M R+E+SRI+A + + IGRG L   +D RFS+
Sbjct  342  IDKHIAEDFVELWADQKELVMLHEKASPMIRYELSRISASVFIVIGRGKLHCCRDVRFSV  401

Query  378  LSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDD  199
            L  W   +  DFGW++R  + +DK ++E+GL Q ILTL L QQQ++ L WF  F  +G +
Sbjct  402  LRAWFSPILMDFGWLKRYSKGLDKGILEEGLGQAILTLTLNQQQSLFLEWFRVFGRQGTE  461

Query  198  CPNIQKAFQVWWRRAFIKQYVPESQLQ  118
            CPN+ KAFQVWWRR+F++     S LQ
Sbjct  462  CPNLSKAFQVWWRRSFVRTTDARSWLQ  488



>ref|XP_008338977.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At3g50780-like [Malus domestica]
Length=531

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 134/200 (67%), Gaps = 3/200 (2%)
 Frame = -2

Query  726  TISRDMLYNLCHGCLN---SLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILI  556
             +  + LYN C  CL    SL   A+E    D+   ++  V+ +IA  ADN+ W+++IL 
Sbjct  324  NVCNETLYNSCRSCLKLLLSLFKHAAEPESSDKPVDNKEPVVKQIALAADNLSWLLEILA  383

Query  555  ERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLL  376
            +++  DEF  LWA Q+ELA+LH+K+P + R+ +S ITA+L V IGRG LL  KD R  LL
Sbjct  384  DKQAADEFAVLWASQQELAALHTKLPIVSRYHVSCITARLFVGIGRGELLPSKDTRQLLL  443

Query  375  STWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDC  196
             TWL+ L +D+ W++  CRS D  L E+G+ +TILTLPL  QQ+IML+W   FL  GD C
Sbjct  444  QTWLQPLIDDYNWLQHGCRSFDGRLWEEGIGRTILTLPLEDQQSIMLSWLGSFLKAGDSC  503

Query  195  PNIQKAFQVWWRRAFIKQYV  136
            PN+Q+AF+VWWRR F++ YV
Sbjct  504  PNLQRAFEVWWRRTFVRPYV  523



>ref|XP_011099262.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099263.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099264.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099265.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099266.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099268.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
Length=534

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 0/182 (0%)
 Frame = -2

Query  663  ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSK  484
            A+E+   D+S      V+  +A EADN+ W++DIL +R+  DEF  LWA Q+ELAS H+K
Sbjct  340  AAESNFADKSTDTIEPVVKSMALEADNLLWLLDILADRQAADEFAVLWASQQELASHHTK  399

Query  483  IPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKT  304
            +P + RH +S+ITA+L V IGRG LL  +D R  LL TWL+AL +D+ W++  CRS D+ 
Sbjct  400  LPIVSRHHVSKITARLFVGIGRGQLLPCRDTRHLLLQTWLQALIDDYSWLQHGCRSFDRK  459

Query  303  LVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQ  124
            +VE+G+ +TILTLPL  QQ+I+L+W   FL  GD+CPN+Q+AF+VWWRR FI+ YV    
Sbjct  460  VVEEGIGRTILTLPLEDQQSILLSWLGIFLKTGDNCPNLQRAFEVWWRRTFIRPYVEPVS  519

Query  123  LQ  118
            LQ
Sbjct  520  LQ  521



>ref|XP_008440171.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Cucumis 
melo]
 ref|XP_008440172.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Cucumis 
melo]
Length=534

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 145/223 (65%), Gaps = 10/223 (4%)
 Frame = -2

Query  756  RLLRED--VPDNTISRDM----LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  V  N  S D+    +Y+ C  CL SLL     A+E    D S   +  V+ +
Sbjct  300  KLLRENQSVSSNASSTDICNEIIYSSCRSCLASLLFLFQQAAETDFTDRSVDRKEPVLKQ  359

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            I  EADN+ W+++IL +R+  DEF  +W+  +ELA+LH+K+P + R+ IS ITA+L V I
Sbjct  360  ITLEADNLSWLLEILADRQAADEFAVMWSKHQELATLHAKLPIVSRYHISCITARLFVGI  419

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            G+G LL  KD R  LL TWLE L  D+ W++  C S D+ +VE+G+ +TILTLPL  QQ+
Sbjct  420  GKGELLPAKDTRKLLLHTWLEPLINDYSWLKHGCGSFDRKVVEEGIGRTILTLPLEDQQS  479

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQI  115
            I+L W   FL  GD CPN+Q+AF+VWWRR F++ YV E+Q  I
Sbjct  480  ILLTWLGSFLKVGDSCPNLQRAFEVWWRRTFVRPYV-ETQGSI  521



>gb|EMS65337.1| hypothetical protein TRIUR3_32744 [Triticum urartu]
Length=559

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 137/203 (67%), Gaps = 10/203 (5%)
 Frame = -2

Query  723  ISRDMLYNLCHGCL---NSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            I  ++ Y  C GCL     L L ASEA    +       V  +I  E DN+ W+V+IL+ 
Sbjct  364  ICSELFYGSCRGCLERLQPLFLEASEAGFPSQ-------VTRQITLETDNILWLVEILVN  416

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            +++ D+FV +WA Q ELA LH+K+P   RH +S ITA+L V IGRG +L  KD R  LL 
Sbjct  417  QRICDDFVVMWASQSELALLHAKLPIASRHTVSSITARLFVGIGRGEMLPSKDTRLLLLQ  476

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
             WL+AL +D+ W++ +CRS D+ LVE+G+ QTILTLPL  Q++I+L+W  RFL  GD+CP
Sbjct  477  VWLQALIDDYSWLQCSCRSFDRKLVEEGIGQTILTLPLEDQRSILLSWLGRFLKLGDNCP  536

Query  192  NIQKAFQVWWRRAFIKQYVPESQ  124
            N+Q+AF+VWWRR F++ YV +++
Sbjct  537  NLQRAFEVWWRRTFVRPYVNQAR  559



>gb|EAY91984.1| hypothetical protein OsI_13674 [Oryza sativa Indica Group]
Length=522

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 140/214 (65%), Gaps = 7/214 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDM----LYNLCHGCLNSLLLCASEATCVD---ESGKDRGVVMGEIA  598
            +LL+E+    + S D+    LY+ C  CL SLL    +AT  D   +S   +  V  +IA
Sbjct  298  KLLKENSSCTSTSVDIYAETLYSSCQNCLESLLTLFRQATADDFAEQSLDLKEPVFRQIA  357

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
             EADN+ W+ +IL +R    EF  +W++Q ELA LHSK+PT  RH +S +TA+L VAIG+
Sbjct  358  LEADNLLWLTEILADRNAAGEFAVMWSNQGELAELHSKLPTKSRHLVSCVTARLFVAIGK  417

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +L  KD R  LL  WL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ I+
Sbjct  418  GEMLPSKDTRKLLLDVWLQPLMDDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQTIL  477

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            L+W   FL  GD CPN+QKAF+VWW+R F++ YV
Sbjct  478  LSWLGSFLKVGDSCPNLQKAFEVWWKRTFVRPYV  511



>ref|NP_001051395.1| Os03g0769400 [Oryza sativa Japonica Group]
 gb|AAR87334.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAT85043.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99073.1| f13j11 PRLI-interacting factor G, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99074.1| f13j11 PRLI-interacting factor G, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99075.1| f13j11 PRLI-interacting factor G, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13309.1| Os03g0769400 [Oryza sativa Japonica Group]
 gb|EAZ28713.1| hypothetical protein OsJ_12730 [Oryza sativa Japonica Group]
Length=522

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 140/214 (65%), Gaps = 7/214 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDM----LYNLCHGCLNSLLLCASEATCVD---ESGKDRGVVMGEIA  598
            +LL+E+    + S D+    LY+ C  CL SLL    +AT  D   +S   +  V  +IA
Sbjct  298  KLLKENSSCTSTSVDIYAETLYSSCQNCLESLLTLFRQATADDFAEQSLDLKEPVFRQIA  357

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
             EADN+ W+ +IL +R    EF  +W++Q ELA LHSK+PT  RH +S +TA+L VAIG+
Sbjct  358  LEADNLLWLTEILADRNAAGEFAVMWSNQGELAELHSKLPTKSRHLVSCVTARLFVAIGK  417

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +L  KD R  LL  WL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ I+
Sbjct  418  GDMLPSKDTRKLLLDVWLQPLMDDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQTIL  477

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            L+W   FL  GD CPN+QKAF+VWW+R F++ YV
Sbjct  478  LSWLGSFLKVGDSCPNLQKAFEVWWKRTFVRPYV  511



>gb|EEE53535.1| hypothetical protein OsJ_36742 [Oryza sativa Japonica Group]
Length=1123

 Score =   184 bits (467),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 143/202 (71%), Gaps = 6/202 (3%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMG-EIAREADNVQWIVDILIERK  547
            IS ++LY+ C GCL+ L L  SEAT     G++  V +  +I  E DN+ W+V+IL+ ++
Sbjct  315  ISSELLYSSCQGCLDRLRLLFSEAT-----GQEFSVELTRQITLETDNLLWLVEILVNQR  369

Query  546  MGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTW  367
            + D+FV LWA+Q ++A LH K+P   RH +S ITA+L V IGRG +L  K+ R  LL  W
Sbjct  370  ICDDFVALWANQSKIAELHGKLPVASRHTVSCITARLFVGIGRGEMLPSKNTRLLLLQVW  429

Query  366  LEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNI  187
            L+ L +D+ W++ +CRS D+ LVE+G+ QTILTLPL  Q++++L W  RFL  GD+CPN+
Sbjct  430  LQPLIDDYSWLQCSCRSFDRKLVEEGIGQTILTLPLEDQRSMLLAWLGRFLKLGDNCPNL  489

Query  186  QKAFQVWWRRAFIKQYVPESQL  121
            Q+AF+VWWRR F++ YV ++++
Sbjct  490  QRAFEVWWRRTFVRPYVSQARI  511



>ref|XP_010097900.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB72727.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=532

 Score =   179 bits (455),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 135/199 (68%), Gaps = 3/199 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGV---VMGEIAREADNVQWIVDILIE  553
            I  + +Y+ C  C +SLL    +AT  + S K   +   V+ +IA E+DN+ W+++IL +
Sbjct  323  ICNETIYSSCKSCFDSLLSLFKQATEPEFSDKPMDIKEPVLKQIALESDNLSWLLEILAD  382

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            R+  DEF   WA Q+ELA+LH K+  + R+ IS ITA+L V IGRG LL  KD R  LL 
Sbjct  383  RQAADEFALTWASQQELAALHGKLSIVSRYHISCITARLFVGIGRGELLPSKDTRQLLLQ  442

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
            TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+I+L+W   FL  GD+CP
Sbjct  443  TWLQPLINDYSWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQSILLSWLGSFLKAGDNCP  502

Query  192  NIQKAFQVWWRRAFIKQYV  136
            N+Q+AF+VWWRR F++ YV
Sbjct  503  NLQRAFEVWWRRTFVRPYV  521



>ref|XP_004300583.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465450.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Fragaria 
vesca subsp. vesca]
Length=538

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 134/199 (67%), Gaps = 3/199 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGC---LNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            +    LY+ C  C   L SL   A+E    ++S  ++  ++ +IA  +DN+ W++DIL +
Sbjct  324  VCNQTLYDSCGNCSSLLLSLFKQAAEPESPEKSVDNKDPLVKQIALASDNLSWLLDILAD  383

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            R+  DEF  +WA Q+ELA+LH K+P + R+ +S ITA+L V IG+G LL  KD R  LL 
Sbjct  384  RQAADEFAVMWAGQQELAALHMKLPIVSRYHVSIITARLFVGIGKGELLPSKDTRQLLLQ  443

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
            TWL+ L  D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ+IML+W   FL  GD CP
Sbjct  444  TWLQPLINDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQSIMLSWLGSFLKSGDSCP  503

Query  192  NIQKAFQVWWRRAFIKQYV  136
            N+QKAF+VWWRR F++ YV
Sbjct  504  NLQKAFEVWWRRTFVRPYV  522



>ref|XP_010558026.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Tarenaya 
hassleriana]
Length=533

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 147/232 (63%), Gaps = 15/232 (6%)
 Frame = -2

Query  756  RLLREDVPDNTIS-----RDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIARE  592
            +LLRE    N++S      + +Y+ C  CL+S+L    +A    E+G +      +IA E
Sbjct  305  KLLREQ---NSVSSADNFNETIYSSCQNCLDSVLSLFRQAAEA-ETGTEPA--SKQIAVE  358

Query  591  ADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGH  412
            ADN+ W++DIL ER+  +EF   WA+QKEL SLH K+P M R+ ISR+T++L + IGRG 
Sbjct  359  ADNLSWLLDILAERQGAEEFAVTWANQKELISLHEKLPLMLRYHISRVTSRLFIGIGRGE  418

Query  411  LLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            LL  KD R +LL  WL+ L  D+ W++  CR  D  LVE+G+ QTILTLPL  QQ+I+L+
Sbjct  419  LLPSKDTRLALLRMWLQPLINDYNWLQHGCRWFDAKLVEEGIGQTILTLPLEDQQSILLS  478

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV----PESQLQIALCDYTN*W  88
            W   FL+ G+ CPN+Q AF+VWWRR+FI+ Y     P + L  A C   + W
Sbjct  479  WLGSFLSAGNGCPNLQGAFEVWWRRSFIRPYTVTDRPGNGLFQAECSTNSSW  530



>ref|XP_003558813.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Brachypodium 
distachyon]
Length=524

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 142/223 (64%), Gaps = 7/223 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDM----LYNLCHGCLNSLLLCASEATCVDESGKDRGV---VMGEIA  598
            +LL+E+    + S D+    LY  C  CL SLL    +A+  D S K   +   V  +IA
Sbjct  299  KLLKENSSCASSSADLCVETLYASCRNCLESLLTLFRQASDNDFSEKSLELTEPVFRKIA  358

Query  597  READNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGR  418
             EADN+ W+ +IL +R   DEF  +W++Q ELA LHS +PT  RH +S +T +L VAIG+
Sbjct  359  LEADNLLWLTEILADRNSADEFAVMWSNQCELAGLHSNLPTKSRHLVSCVTTRLFVAIGK  418

Query  417  GHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIM  238
            G +L  KD R  LL  WL+ L +D+ W++  CRS D+ + E+G+  TILTLPL  QQAI+
Sbjct  419  GEMLPSKDTRKLLLDVWLQPLMDDYNWLQHGCRSFDRKVAEEGIGSTILTLPLEDQQAIL  478

Query  237  LNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIAL  109
            L+W   FL  G+ CPN+QKAF+VWWRR F++ YV + + Q+ L
Sbjct  479  LSWLGSFLKVGNSCPNLQKAFEVWWRRTFVRPYVEQKRNQLQL  521



>ref|XP_008665486.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Zea mays]
 ref|XP_008665487.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Zea mays]
 tpg|DAA51621.1| TPA: hypothetical protein ZEAMMB73_771347 [Zea mays]
Length=534

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 130/195 (67%), Gaps = 3/195 (2%)
 Frame = -2

Query  711  MLYNLCHGCLNSLLLCASEATCVD---ESGKDRGVVMGEIAREADNVQWIVDILIERKMG  541
            +LY  C  CL+SLL+   +AT  D   ++   +  V  ++A EADN+ W+ +IL +R   
Sbjct  328  VLYRSCRNCLDSLLILFQQATDSDFAEQALNTKEPVFRQVALEADNLLWLAEILADRNAA  387

Query  540  DEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLE  361
            DEF  +WA Q+ELA LHS++P   RH +S +TA+L V IG+G +L  KD R  LL  WL+
Sbjct  388  DEFAVIWASQRELAGLHSRLPVKSRHLVSCVTARLFVGIGKGEMLPSKDTRRLLLDVWLQ  447

Query  360  ALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQK  181
             L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ I+L+W   FL  GD CPN+QK
Sbjct  448  PLMDDYNWLQHGCRSFDRKVVEEGVGRTILTLPLEDQQTILLSWLGSFLKVGDSCPNLQK  507

Query  180  AFQVWWRRAFIKQYV  136
            AF+VWWRR F++ Y 
Sbjct  508  AFEVWWRRTFVRPYA  522



>gb|KHN36167.1| BTB/POZ domain-containing protein [Glycine soja]
Length=522

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 142/213 (67%), Gaps = 7/213 (3%)
 Frame = -2

Query  756  RLLRED--VPDNTIS----RDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAR  595
            +LLRE+  +P ++ S     DM+   C  C++SLL C            ++  V+  IA 
Sbjct  301  KLLRENNSLPSSSGSADLCNDMINKSCRNCMDSLL-CLFNQVAEPSFSDNKEPVVKHIAL  359

Query  594  EADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRG  415
            EADN+ W+++IL++++  ++F  +WA+Q+ELA+LH K+P  +R+ +S I+ +L V IGRG
Sbjct  360  EADNLSWLLEILVDKQAAEDFALMWANQQELAALHGKLPIAFRYHVSCISGRLYVGIGRG  419

Query  414  HLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIML  235
             +L  K+ R  LL TWL+ L  D+ W++  CRS D+ LVE+G+ +TILTLPL  QQ+I+L
Sbjct  420  EVLPSKNTRQFLLQTWLQPLINDYNWLQHGCRSFDRKLVEEGIGRTILTLPLEDQQSILL  479

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            +W   FL  GD CPN+Q+AF+VWWRR FI+ YV
Sbjct  480  SWVGSFLKTGDGCPNLQRAFEVWWRRTFIRPYV  512



>ref|XP_003517262.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Glycine max]
 ref|XP_006573610.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Glycine max]
Length=522

 Score =   177 bits (448),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 142/213 (67%), Gaps = 7/213 (3%)
 Frame = -2

Query  756  RLLRED--VPDNTIS----RDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAR  595
            +LLRE+  +P ++ S     DM+   C  C++SLL C            ++  V+  IA 
Sbjct  301  KLLRENNSLPSSSGSADLCNDMINKSCRNCMDSLL-CLFNQVAEPSFSDNKEPVVKHIAL  359

Query  594  EADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRG  415
            EADN+ W+++IL++++  ++F  +WA+Q+ELA+LH K+P  +R+ +S I+ +L V IGRG
Sbjct  360  EADNLSWLLEILVDKQAAEDFALMWANQQELAALHGKLPIAFRYHVSCISGRLYVGIGRG  419

Query  414  HLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIML  235
             +L  K+ R  LL TWL+ L  D+ W++  CRS D+ LVE+G+ +TILTLPL  QQ+I+L
Sbjct  420  EVLPSKNTRQLLLQTWLQPLINDYNWLQHGCRSFDRKLVEEGIGRTILTLPLEDQQSILL  479

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            +W   FL  GD CPN+Q+AF+VWWRR FI+ YV
Sbjct  480  SWVGSFLKTGDGCPNLQRAFEVWWRRTFIRPYV  512



>ref|XP_007156873.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
 ref|XP_007156874.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
 gb|ESW28867.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
 gb|ESW28868.1| hypothetical protein PHAVU_002G024700g [Phaseolus vulgaris]
Length=521

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 142/216 (66%), Gaps = 9/216 (4%)
 Frame = -2

Query  756  RLLRED--VPDNT----ISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGE  604
            +LLRE+  +P +     I  DM+Y  C  CL+SLL     A+E    D     +  ++  
Sbjct  301  KLLRENNSLPSSAGSADICNDMIYKSCRSCLDSLLCLFNQAAEPDFKDMPSDIKEPIIKH  360

Query  603  IAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAI  424
            IA EADN+ W+++ILI+++  ++F  +WA+ +ELA+LH K+P  +R+ +S I+ +L V I
Sbjct  361  IALEADNLSWLLEILIDKQAAEDFAVMWANHQELAALHGKLPIAFRYHVSCISGRLYVNI  420

Query  423  GRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQA  244
            GRG +L  K+ R  LL TWL+ L  D+ W++  CR+ D  LVE+G+ +TILTLPL  QQ+
Sbjct  421  GRGEVLPSKNTRQLLLQTWLQPLINDYNWLQHGCRTFDGKLVEEGIGRTILTLPLEDQQS  480

Query  243  IMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            I+L+W   FL  GD CPN+Q+AF+VWWRR FI+ YV
Sbjct  481  ILLSWVGSFLKTGDGCPNLQRAFEVWWRRTFIRPYV  516



>ref|XP_004981619.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Setaria italica]
 ref|XP_004981620.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Setaria italica]
 ref|XP_004981621.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X3 [Setaria italica]
Length=526

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 128/196 (65%), Gaps = 3/196 (2%)
 Frame = -2

Query  714  DMLYNLCHGCLNSLLLCASEATCVD---ESGKDRGVVMGEIAREADNVQWIVDILIERKM  544
            + LY     CL SLL    +AT  D   +S   +  V  +IA EADN+ W+ +IL +R  
Sbjct  319  ETLYKSSQNCLESLLTLFQQATGSDFAEQSLNIKEPVFRQIALEADNLLWLAEILADRNA  378

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             DEF  +WA Q++LA LHSK+P   RH +S +TA+L VAIG+G +L  KD R  LL  WL
Sbjct  379  ADEFAVMWASQRDLAGLHSKLPVKSRHLVSCVTARLYVAIGKGEILPSKDTRRLLLDIWL  438

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
            + L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ I+L+W   FL  GD CPN+Q
Sbjct  439  QPLMDDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQTILLSWLGSFLKVGDSCPNLQ  498

Query  183  KAFQVWWRRAFIKQYV  136
            KAF+VWWRR FI+ Y 
Sbjct  499  KAFEVWWRRTFIRPYA  514



>ref|XP_010547478.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547479.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547480.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Tarenaya hassleriana]
Length=512

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 135/208 (65%), Gaps = 5/208 (2%)
 Frame = -2

Query  756  RLLREDVPDNTISR--DMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADN  583
            +LLRE    N+     + +Y+ C  CL+++L    +A  V+   +       +IA E+DN
Sbjct  302  KLLREQNSANSADNFNETIYSSCQNCLDTVLSLFRQAAEVEPRTES---ASKQIAIESDN  358

Query  582  VQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLV  403
            + W++D+L ER+  +EF   WA QKELASLH  +P M R  ISR++++L + IGRG +L 
Sbjct  359  LSWLLDMLAERRAAEEFAVRWASQKELASLHENLPLMTRFHISRVSSRLFIGIGRGEVLP  418

Query  402  PKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
             K+ R  LL  WL+ L  D+ W++  CRS D  LVE+G+ +TILTLPL  QQ+I+L+W  
Sbjct  419  SKETRLELLRRWLQPLINDYNWLQHGCRSFDGKLVEEGIGRTILTLPLEDQQSILLSWMA  478

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
             FL  GD CPN+Q+AF+VWWRR+FI+ Y
Sbjct  479  SFLTTGDGCPNLQRAFEVWWRRSFIRPY  506



>ref|XP_008808496.1| PREDICTED: BTB/POZ domain-containing protein At2g13690-like [Phoenix 
dactylifera]
Length=324

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 135/198 (68%), Gaps = 5/198 (3%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATC---VD--ESGKDRGVVMGEIAREADNVQWIVDIL  559
            I +D LY++C  CLNSL+    EA+    VD  E+   R  ++ +I+++ +N+ W+++IL
Sbjct  123  IYKDSLYSICRSCLNSLVGLFQEASASIPVDRTETVGGRKTLIEQISKQVENINWLLEIL  182

Query  558  IERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSL  379
            I++ + ++FV+LWADQKEL  LH K   M R+E+SRI+A + + IGRG L   +D RFS+
Sbjct  183  IDKHIAEDFVELWADQKELIRLHEKASPMIRYELSRISASVFIVIGRGKLHCCRDKRFSV  242

Query  378  LSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDD  199
            L  W   +  DFGW++R  + +D  ++E+GL Q ILTL L QQQ++ L WF  F  +G +
Sbjct  243  LRAWFSPILMDFGWLQRCSKGLDMRVLEEGLGQAILTLTLNQQQSLFLEWFGVFGRQGIE  302

Query  198  CPNIQKAFQVWWRRAFIK  145
            CPN+ KAFQVWWRR+F++
Sbjct  303  CPNLSKAFQVWWRRSFVR  320



>ref|XP_009419041.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419043.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=526

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 130/199 (65%), Gaps = 3/199 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            I  + LY+ C  CL SLL     ASE    D S + +  V+ +I  EADN+ W+++IL++
Sbjct  316  ICTESLYSSCQRCLESLLNLFRQASEPGFSDRSLESKDPVVRQITLEADNLIWLLEILVD  375

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            R   DEF  +WA Q ELA LH+K+PTM RH +S IT +L V IG G +L  K+ R  LL 
Sbjct  376  RNAADEFTLMWASQNELAELHTKVPTMSRHLVSCITCRLFVGIGNGEMLPSKETRKLLLH  435

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
             WL+ L  D+ W++   RS D+ +VE+G+ +TILTL L  QQ+I+L+W   FL   D+CP
Sbjct  436  VWLQPLINDYSWLQHGSRSFDRKVVEEGIGRTILTLSLEDQQSILLSWLGCFLKASDNCP  495

Query  192  NIQKAFQVWWRRAFIKQYV  136
            N+Q+AF+VWWRR FI+ YV
Sbjct  496  NLQRAFEVWWRRTFIRPYV  514



>ref|XP_009397738.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397739.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397740.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 132/193 (68%), Gaps = 7/193 (4%)
 Frame = -2

Query  708  LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKMGD  538
            LY+LC  CL SL+     AS++T ++   KD  V   +IA EA+N+ W+V+IL  R   D
Sbjct  321  LYSLCQSCLASLIELFRQASKSTRIE--SKDPTV--RKIALEAENLLWLVEILAVRHTAD  376

Query  537  EFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLEA  358
            EF  +WA Q ELA LHSK+P M RH +S ITA+L V IGRG +L  K+ R  LL  WL+ 
Sbjct  377  EFALMWASQNELAQLHSKLPVMSRHRVSCITARLFVGIGRGEMLPSKETRQLLLHVWLQP  436

Query  357  LYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQKA  178
            L +D+ W++  CR  D+ +VE+G+ QTILTLPL  QQ+++L+W + FL  G +CPN+Q+A
Sbjct  437  LVDDYSWLQHGCRQFDRKVVEEGIGQTILTLPLEDQQSVLLSWLESFLKVGSNCPNLQRA  496

Query  177  FQVWWRRAFIKQY  139
            F+VWWRR FI+ Y
Sbjct  497  FEVWWRRTFIRPY  509



>ref|XP_002461387.1| hypothetical protein SORBIDRAFT_02g001910 [Sorghum bicolor]
 gb|EER97908.1| hypothetical protein SORBIDRAFT_02g001910 [Sorghum bicolor]
Length=543

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 127/197 (64%), Gaps = 6/197 (3%)
 Frame = -2

Query  708  LYNLCHGCLNSLLLCASEATCVDE------SGKDRGVVMGEIAREADNVQWIVDILIERK  547
            LY+    CL+SLL  + +A+  +E      SG  +     +IA EADN+ W+ +IL +R 
Sbjct  328  LYSCFQNCLDSLLALSRQASNPEELAGEESSGSSKEQTFRKIALEADNLLWLAEILSDRN  387

Query  546  MGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTW  367
              DE   +WA Q ELA LH KIP M+RH +S +TA+L VAIG+G  L  K+ R  LL  W
Sbjct  388  AADELTVIWASQAELAELHPKIPVMHRHLVSCVTARLLVAIGKGEALPSKETRRRLLDVW  447

Query  366  LEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNI  187
            L+ L +D+ W++  CR  D+ +VEDG+ Q ILTLPL  QQA++L W  RFL  GD CPN+
Sbjct  448  LQPLMDDYRWLQHGCRWFDRAVVEDGIGQAILTLPLEDQQAVLLAWLGRFLKAGDGCPNL  507

Query  186  QKAFQVWWRRAFIKQYV  136
            Q+AF+VWWRR F++ Y 
Sbjct  508  QRAFEVWWRRTFVRPYA  524



>gb|KHN42029.1| BTB/POZ domain-containing protein [Glycine soja]
Length=515

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 142/213 (67%), Gaps = 7/213 (3%)
 Frame = -2

Query  756  RLLRED--VPDNTIS----RDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAR  595
            +LLRE+  +P ++ S     DM+   C  C++SLL C            ++  V+  IA 
Sbjct  293  KLLRENNSLPSSSGSADLCNDMINKSCRRCMDSLL-CLFNQVAEPSFSDNKEPVVKHIAL  351

Query  594  EADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRG  415
            EADN+ W+++IL++++  ++F  +WA+Q+ELA+LH K+P ++R+ +S I+ +L V IGRG
Sbjct  352  EADNLSWLLEILVDKQAAEDFALMWANQQELAALHGKLPIVFRYHVSCISGRLYVGIGRG  411

Query  414  HLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIML  235
             +L  K+ R  LL TWL+ L  D+ W++  C S D+ LVE+G+ +TILTLPL  QQ+I+L
Sbjct  412  EVLPSKNTRQFLLQTWLQPLINDYNWLQHGCGSFDRKLVEEGIGRTILTLPLEDQQSILL  471

Query  234  NWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            +W   FL  GD CPN+Q+AF+VWWRR FI+ YV
Sbjct  472  SWVGSFLKTGDGCPNLQRAFEVWWRRTFIRPYV  504



>ref|XP_009407431.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407432.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407433.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   174 bits (440),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 135/212 (64%), Gaps = 6/212 (3%)
 Frame = -2

Query  753  LLREDVPDNTIS--RDMLYNLCHGCLNSLL---LCASEATCVDESGKDRGVVMGEIAREA  589
            LL+E   D ++    + LY  C  CL SLL    CASE     E    R  V+  I+ E 
Sbjct  304  LLKESDRDGSVGICTETLYGSCRHCLESLLNLFRCASEPGFSHEPLGSRDRVVRRISLEV  363

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W+V+IL  R   DEF  +WA Q ELA LHSK+PTM RH++S +T++L VAIG   +
Sbjct  364  DNLLWLVEILAVRHAADEFASIWASQDELAELHSKLPTMARHQVSCVTSRLFVAIGNREM  423

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRR-ACRSIDKTLVEDGlsqtiltlplpqqQAIMLN  232
            L  K+ R  LL  WL+ L +D+GW+RR + RS D+  VE+G+ +TI TLPL +QQ+++L+
Sbjct  424  LPSKETRKLLLRVWLQPLIDDYGWLRRGSSRSFDRHAVEEGIDRTITTLPLEEQQSVLLS  483

Query  231  WFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            W   FL  GDDCPN++ AF+VWWRR F   YV
Sbjct  484  WLRSFLKVGDDCPNLRGAFEVWWRRTFTMPYV  515



>ref|XP_003537445.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Glycine max]
 ref|XP_006590671.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Glycine max]
Length=515

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 146/215 (68%), Gaps = 11/215 (5%)
 Frame = -2

Query  756  RLLRED--VPDNTIS----RDMLYNLCHGCLNSLLLCASEATCVDESG--KDRGVVMGEI  601
            +LLRE+  +P ++ S     DM+   C  C++SLL   ++   V E G   ++  V+  I
Sbjct  293  KLLRENNSLPSSSGSADLCNDMINKSCRRCMDSLLCLFNQ---VAEPGFSDNKEPVVKHI  349

Query  600  AREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIG  421
            A EADN+ W+++IL++++  ++F  +WA+Q+ELA+LH K+P ++R+ +S I+ +L V IG
Sbjct  350  ALEADNLSWLLEILVDKQAAEDFALMWANQQELAALHGKLPIVFRYHVSCISGRLYVGIG  409

Query  420  RGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAI  241
            RG +L  K+ R  LL TWL+ L  D+ W++  C S D+ LVE+G+ +TILTLPL  QQ+I
Sbjct  410  RGEVLPSKNTRQFLLQTWLQPLINDYNWLQHGCGSFDRKLVEEGIGRTILTLPLEDQQSI  469

Query  240  MLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYV  136
            +L+W   FL  GD CPN+Q+AF+VWWRR FI+ YV
Sbjct  470  LLSWVGSFLKTGDGCPNLQRAFEVWWRRTFIRPYV  504



>ref|XP_006657417.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=524

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 126/194 (65%), Gaps = 3/194 (2%)
 Frame = -2

Query  708  LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKMGD  538
             Y+ C  CL SLL     AS+    ++S   + ++  +I  EADN+ W+ +IL +R   D
Sbjct  320  FYSSCRNCLESLLNLFHRASDPEFSEQSSDKKDMIFRQITVEADNLLWLAEILADRNAAD  379

Query  537  EFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLEA  358
            E   +WA Q ELA LH ++P M+RH IS +TA+L VA+G+G  L  K+ R  LL  WL+ 
Sbjct  380  ELTSIWASQGELAKLHCRVPVMHRHLISCLTARLFVAVGKGEALPSKETRQLLLDVWLQP  439

Query  357  LYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQKA  178
            L +D+ W++  CRS D+ +VE+G+ QTILTLPL  QQ I+L W  RFL  GD CPN+Q+A
Sbjct  440  LMDDYNWLQHGCRSFDRKVVEEGIGQTILTLPLEDQQTILLAWLGRFLKVGDSCPNLQRA  499

Query  177  FQVWWRRAFIKQYV  136
            F+VWWRR F++ Y 
Sbjct  500  FEVWWRRTFVRPYT  513



>ref|NP_190647.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SVM0.1|Y3078_ARATH RecName: Full=BTB/POZ domain-containing protein At3g50780 [Arabidopsis 
thaliana]
 emb|CAB42907.1| putative protein [Arabidopsis thaliana]
 gb|AAO22779.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50646.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78709.1| uncharacterized protein AT3G50780 [Arabidopsis thaliana]
Length=520

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 143/210 (68%), Gaps = 10/210 (5%)
 Frame = -2

Query  756  RLLRE----DVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREA  589
            +LLRE    +V DN    D +Y+ C  CL+S+L    +A+     G+       +IA EA
Sbjct  299  KLLREQNGANVADNF--NDTIYSSCQTCLDSVLSLFKQAS----EGEKPETDTKQIAVEA  352

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++D+L ER+  +EF   WA+QKELA LH K+P M R+ ISR+T++L + IGRG L
Sbjct  353  DNLTWLLDVLAERQAAEEFSVTWANQKELALLHEKLPLMSRYHISRVTSRLFIGIGRGEL  412

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KD R  LL+TWL+ L+ D+ W++  CRS D  LVE+G+ +TILTLPL  QQ+I+L+W
Sbjct  413  LPSKDTRLLLLTTWLQPLFNDYNWLQHGCRSFDGKLVEEGIGRTILTLPLEDQQSILLSW  472

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
               FLN GD CPN+Q+AF+VWWRR+FI+ Y
Sbjct  473  LGSFLNGGDGCPNLQRAFEVWWRRSFIRPY  502



>ref|XP_002877770.1| hypothetical protein ARALYDRAFT_323639 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54029.1| hypothetical protein ARALYDRAFT_323639 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 144/210 (69%), Gaps = 10/210 (5%)
 Frame = -2

Query  756  RLLRE----DVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREA  589
            +LLRE    +V DN    + +Y+ C  CL+S+L    +A+     G+       +IA EA
Sbjct  298  KLLREQNGANVADNF--NETIYSSCQNCLDSVLSLFKQAS----EGEKPETDTKQIAVEA  351

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++D+L ER+  +EF   WA+QKELA LH K+P M R+ ISR+T++L + IGRG L
Sbjct  352  DNLTWLLDVLAERQAAEEFSITWANQKELALLHEKLPLMSRYHISRVTSRLFIGIGRGEL  411

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KD R  LL+TWL+ L+ D+ W++  CRS D  LVE+G+ +TILTLPL  QQ+I+L+W
Sbjct  412  LPSKDTRLLLLTTWLQPLFNDYNWLQHGCRSFDGKLVEEGIGRTILTLPLEDQQSILLSW  471

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
               FLN+GD CPN+Q+AF+VWWRR+FI+ Y
Sbjct  472  LGSFLNRGDGCPNLQRAFEVWWRRSFIRPY  501



>ref|NP_001058798.2| Os07g0123500 [Oryza sativa Japonica Group]
 dbj|BAC83795.1| PRLI-interacting factor G-like protein [Oryza sativa Japonica 
Group]
 dbj|BAH00971.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81446.1| hypothetical protein OsI_24731 [Oryza sativa Indica Group]
 gb|EEE66492.1| hypothetical protein OsJ_22937 [Oryza sativa Japonica Group]
 dbj|BAF20712.2| Os07g0123500 [Oryza sativa Japonica Group]
Length=527

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 125/194 (64%), Gaps = 3/194 (2%)
 Frame = -2

Query  708  LYNLCHGCLNSL---LLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKMGD  538
             Y+ C  CL SL      ASE    ++S   + V+  +I  EADN+ W+ +IL +R   D
Sbjct  321  FYSSCRNCLESLSNLFRQASEPEFSEQSSDSKEVIFRQITLEADNLLWLAEILADRNAAD  380

Query  537  EFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLEA  358
            E   +WA Q ELA LH +IP M+RH IS +TA+L VA+G+G  L  K+ R  LL  WL+ 
Sbjct  381  ELTSIWASQGELAKLHCRIPVMHRHLISCVTARLFVAVGKGEALPSKETRQLLLDVWLQP  440

Query  357  LYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQKA  178
            L +D+ W++  CR  D+ ++E+G+ QTILTLPL  QQ+I+L W  RFL  GD CPN+Q+A
Sbjct  441  LMDDYNWLQHGCRWFDRKVIEEGIGQTILTLPLEDQQSILLTWLGRFLKVGDSCPNLQRA  500

Query  177  FQVWWRRAFIKQYV  136
            F+VWWRR F++ Y 
Sbjct  501  FEVWWRRTFVRPYT  514



>ref|XP_002968764.1| hypothetical protein SELMODRAFT_90136 [Selaginella moellendorffii]
 gb|EFJ29880.1| hypothetical protein SELMODRAFT_90136 [Selaginella moellendorffii]
Length=464

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 131/197 (66%), Gaps = 7/197 (4%)
 Frame = -2

Query  720  SRDMLYNLCHGCLNSLLLCASEAT----CVDESGKDRGVVMGEIAREADNVQWIVDILIE  553
            S++ LY+ C  CL  L    S  T        S +   +V   IAR  DN+QW+ ++LI+
Sbjct  259  SKESLYDACKECLQELSDAFSRLTEQQQQPASSAQAPSLVSAAIARHVDNIQWLAELLID  318

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            R + +E V +W+ + +LA++H  +P M RHE+SRITA+LC+ IGRG ++ P+  R  LL+
Sbjct  319  RGVAEELVHIWSRESQLAAMHRLLPAMQRHEVSRITARLCIGIGRGQIMAPQQVRALLLA  378

Query  372  TWLEALYEDFGWMRRACRSI---DKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGD  202
            TWLE L +DF WM+R    I   DK  VE+GL QTILTL L +Q++I+++WF++F   GD
Sbjct  379  TWLEPLMDDFSWMQRLGSKITFLDKKTVEEGLCQTILTLSLEEQRSILMSWFEKFSRDGD  438

Query  201  DCPNIQKAFQVWWRRAF  151
            +CPN+Q+AF+VWWRR F
Sbjct  439  NCPNLQRAFEVWWRRTF  455



>ref|XP_006419030.1| hypothetical protein EUTSA_v10003115mg [Eutrema salsugineum]
 gb|ESQ37466.1| hypothetical protein EUTSA_v10003115mg [Eutrema salsugineum]
Length=380

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 5/150 (3%)
 Frame = -2

Query  756  RLLREDVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQ  577
            RL+RE+  D+ +S+D LY+LCH CL SL+LC S+ T    +  D G  +GE AREA N+ 
Sbjct  229  RLIREEA-DHDVSKDALYSLCHRCLLSLILCLSDITS---NMNDPGDFIGETAREASNLL  284

Query  576  WIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPK  397
            WIVDILIE+K+ DEFV LWADQKELA+LHSKIP MYRHEIS+ITAQ+CV IGRG +LV  
Sbjct  285  WIVDILIEKKICDEFVQLWADQKELANLHSKIPAMYRHEISKITAQICVGIGRGKILVKM  344

Query  396  DARFSLLSTWLEALYEDFGWMRRA-CRSID  310
            D RFS L TWLE +Y  F WMRRA  RS+D
Sbjct  345  DNRFSALKTWLEVMYNGFWWMRRASTRSVD  374



>ref|XP_006856144.1| hypothetical protein AMTR_s00059p00166010 [Amborella trichopoda]
 gb|ERN17611.1| hypothetical protein AMTR_s00059p00166010 [Amborella trichopoda]
Length=618

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = -2

Query  624  RGVVMGEIAREADNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRIT  445
            +G V+ +I+ +ADN+ W+V+ILI+R   DEFV +W  Q  LA LH ++P   RH  S IT
Sbjct  439  KGSVVQQISLQADNLLWLVEILIDRLAADEFVVMWTSQHHLADLHPRLPIASRHLASHIT  498

Query  444  AQLCVAIGRGHLLVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltl  265
            A++C+AIG+G ++  ++AR SL  TW + L ED+GW++ ACRS D+  VE+G+ +TILTL
Sbjct  499  ARICIAIGKGEVVASREARCSLFDTWFQPLIEDYGWLKHACRSFDRRAVEEGVGRTILTL  558

Query  264  plpqqQAIMLNWFDRFLNKGDDCPNIQKAFQVWWRRAFIKQYVPE  130
            PL  Q+ I ++W + FL  GD CPN+Q AF+VWWRRAF++ YV E
Sbjct  559  PLEDQRRIFVSWLNSFLKFGDSCPNLQGAFEVWWRRAFVRPYVGE  603



>gb|KFK34324.1| hypothetical protein AALP_AA5G130100 [Arabis alpina]
Length=529

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 144/210 (69%), Gaps = 10/210 (5%)
 Frame = -2

Query  756  RLLRE----DVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREA  589
            +LLRE    +V DN    + +Y+ C  CL+S+L    +A+  ++   D      +IA EA
Sbjct  309  KLLREQNGANVSDNL--NETIYSSCQNCLDSVLSLFRQASEGEKPEPD----TKQIAVEA  362

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++D+L ER+  +EF   WA+QKELA LH K+P M R+ ISR+T++L + IGRG L
Sbjct  363  DNLTWLLDVLSERQAAEEFSITWANQKELALLHEKLPLMSRYHISRVTSRLFIGIGRGEL  422

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KD R  LL+TWL+ L+ D+ W++  CRS D  LVE+G+ +TILTLPL  QQ+I+L+W
Sbjct  423  LPSKDTRLLLLTTWLQPLFNDYNWLQHGCRSFDGKLVEEGIGRTILTLPLEDQQSILLSW  482

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
               FLN GD CPN+Q+AF+VWWRR+FI+ Y
Sbjct  483  LGSFLNGGDGCPNLQRAFEVWWRRSFIRPY  512



>ref|XP_006650658.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=521

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 128/199 (64%), Gaps = 3/199 (2%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEATCVD---ESGKDRGVVMGEIAREADNVQWIVDILIE  553
            I  + LY     CL SL     + T  D   +S   +  V  +IA EADN+ W+V+IL +
Sbjct  312  IYAETLYRSSQNCLESLSTLFRQVTADDFAEQSSDLKEPVFRQIALEADNLLWLVEILAD  371

Query  552  RKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLS  373
            R    EF  +W++Q ELA LHS++PT  RH +S +TA+L VAIG+G +L  KD R  LL 
Sbjct  372  RNAAGEFAVIWSNQGELAELHSRLPTKSRHLVSCVTARLFVAIGKGEMLPSKDTRKLLLD  431

Query  372  TWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCP  193
             WL+ L +D+ W++  CRS D+ +VE+G+ +TILTLPL  QQ I+L+W   FL  GD CP
Sbjct  432  VWLQPLMDDYNWLQHGCRSFDRKVVEEGIGRTILTLPLEDQQTILLSWLGSFLKVGDSCP  491

Query  192  NIQKAFQVWWRRAFIKQYV  136
            N+ KAF+VWWRR F++ YV
Sbjct  492  NLLKAFEVWWRRTFVRPYV  510



>ref|XP_003557600.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Brachypodium 
distachyon]
Length=534

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 126/193 (65%), Gaps = 3/193 (2%)
 Frame = -2

Query  708  LYNLCHGCLNSLLLC---ASEATCVDESGKDRGVVMGEIAREADNVQWIVDILIERKMGD  538
            LY+ C  CL SLL     AS+    ++S   +  V  +I  +ADN+ W+ +IL + K  +
Sbjct  321  LYSSCRNCLESLLTLFRQASDPEFAEQSSDKKDPVFRQITLQADNLLWLAEILADMKDAE  380

Query  537  EFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLEA  358
            E   +WA Q+ELA LHS +P M+RH +S +TA+L +AIGRG  L PK  R  LL  WL+ 
Sbjct  381  ELASIWASQEELARLHSTVPVMHRHLVSCVTARLFIAIGRGEALPPKCTRRLLLDVWLQP  440

Query  357  LYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQKA  178
            L +D+ W++  CR  D+ +VE+G+ QTILTLPL  QQ ++L W  +FL  GD CPN+Q+A
Sbjct  441  LMDDYNWLQHGCRWFDRGVVEEGIGQTILTLPLEDQQTVLLAWLGKFLKTGDGCPNLQRA  500

Query  177  FQVWWRRAFIKQY  139
            F+VWWRR F++ Y
Sbjct  501  FEVWWRRTFVRPY  513



>ref|XP_006290909.1| hypothetical protein CARUB_v10017022mg [Capsella rubella]
 gb|EOA23807.1| hypothetical protein CARUB_v10017022mg [Capsella rubella]
Length=520

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 142/210 (68%), Gaps = 10/210 (5%)
 Frame = -2

Query  756  RLLRE----DVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREA  589
            +LLRE    +V DN    + +Y+ C  CL+S+L    +A      G+       +IA EA
Sbjct  300  KLLREQNGANVADNF--NETIYSSCQNCLDSVLSLFRQAC----EGEKPETDTKQIAVEA  353

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++D+L ER+  +EF   WA+QKELA LH K+P M R+ ISR+T++L + IGRG L
Sbjct  354  DNLTWLLDVLAERQAAEEFSITWANQKELALLHEKLPLMSRYHISRVTSRLFIGIGRGEL  413

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KD R  LL+TWL+ L+ D+ W++  CRS D  LVE+G+ +TILTLPL  QQ+I+L+W
Sbjct  414  LPSKDTRLLLLTTWLQPLFNDYNWLQHGCRSFDGKLVEEGIGRTILTLPLEDQQSILLSW  473

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
               FLN GD CPN+Q+AF+VWWRR+FI+ Y
Sbjct  474  LGSFLNGGDGCPNLQRAFEVWWRRSFIRPY  503



>ref|XP_010515449.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Camelina 
sativa]
Length=522

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 142/210 (68%), Gaps = 10/210 (5%)
 Frame = -2

Query  756  RLLRE----DVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREA  589
            +LLRE    +V DN    + +Y+ C  CL+S+L    +A      G+       +IA EA
Sbjct  302  KLLREQNGANVADNF--NETIYSSCQNCLDSVLSLFRQAC----EGEKPETDTKQIAVEA  355

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++D+L+ER+  +EF   W +QKELA LH K+P M R+ ISR+T++L + IGRG L
Sbjct  356  DNLTWLLDVLVERQAAEEFSVTWGNQKELALLHEKLPLMSRYHISRVTSRLFIGIGRGEL  415

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KD R  LL+TWL+ L+ D+ W++  CRS D  LVE+G+ +TILTLPL  QQ+I+L+W
Sbjct  416  LPAKDTRLLLLTTWLQPLFNDYNWLQHGCRSFDGKLVEEGIGRTILTLPLKDQQSILLSW  475

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
               FLN GD CPN+Q+AF+VWWRR+FI+ Y
Sbjct  476  LGSFLNGGDGCPNLQRAFEVWWRRSFIRPY  505



>ref|XP_010426621.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Camelina 
sativa]
Length=521

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 142/210 (68%), Gaps = 10/210 (5%)
 Frame = -2

Query  756  RLLRE----DVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREA  589
            +LLRE    +V DN    + +Y+ C  CL+S+L    +A      G+       +IA EA
Sbjct  301  KLLREQNGANVADNF--NETIYSSCQNCLDSVLSLFRQAC----EGEKPETDTKQIAVEA  354

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++D+L+ER+  +EF   W +QKELA LH K+P M R+ ISR+T++L + IGRG L
Sbjct  355  DNLTWLLDVLVERQAAEEFSVTWGNQKELALLHEKLPLMSRYHISRVTSRLFIGIGRGEL  414

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KD R  LL+TWL+ L+ D+ W++  CRS D  LVE+G+ +TILTLPL  QQ+I+L+W
Sbjct  415  LPSKDTRLLLLTTWLQPLFNDYNWLQHGCRSFDGKLVEEGIGRTILTLPLEDQQSILLSW  474

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
               FLN GD CPN+Q+AF+VWWRR+FI+ Y
Sbjct  475  LGSFLNGGDGCPNLQRAFEVWWRRSFIRPY  504



>ref|XP_010503746.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Camelina 
sativa]
Length=524

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 143/210 (68%), Gaps = 10/210 (5%)
 Frame = -2

Query  756  RLLRE----DVPDNTISRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREA  589
            +LLRE    +V DN    + +Y+ C  CL+S+L    +A      G+       +IA EA
Sbjct  304  KLLREQNGANVADNF--NETIYSSCQNCLDSVLSLFRQAC----EGEKPETDTKQIAVEA  357

Query  588  DNVQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHL  409
            DN+ W++D+L+ER+  +EF  +W +QKELA LH K+P M R+ ISR+T++L + IGRG L
Sbjct  358  DNLTWLLDVLVERQAAEEFSVIWGNQKELALLHEKLPLMSRYHISRVTSRLFIGIGRGEL  417

Query  408  LVPKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNW  229
            L  KD R  LL+TWL+ L+ D+ W++  CRS D  LVE+G+ +TILTLPL  QQ+I+L+W
Sbjct  418  LPSKDTRLLLLTTWLQPLFIDYNWLQHGCRSFDGKLVEEGIGRTILTLPLEDQQSILLSW  477

Query  228  FDRFLNKGDDCPNIQKAFQVWWRRAFIKQY  139
               FLN GD CPN+Q+AF+VWWRR+FI+ Y
Sbjct  478  LGSFLNGGDGCPNLQRAFEVWWRRSFIRPY  507



>ref|XP_009123089.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Brassica 
rapa]
Length=327

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 144/223 (65%), Gaps = 12/223 (5%)
 Frame = -2

Query  756  RLLREDVPDNTISR--DMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADN  583
            +LLRE   +N      + +Y+ C  CL+S+L    +    DES         +I  EADN
Sbjct  113  KLLREQNGNNVAENFNETIYSSCQSCLDSVLSLFRQ----DESDAK------QIGVEADN  162

Query  582  VQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLV  403
            + W++D+L ER+  +EF   WA+QKELA LH K+P + R+ ISR+T++L V IGRG LL 
Sbjct  163  LTWLLDVLAERQAAEEFSVTWANQKELALLHEKVPLVSRYHISRVTSRLFVGIGRGELLP  222

Query  402  PKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
             KD R  LL+TWL+ L++D+ W++  CRS D  LVE+G+ +TILTLPL  QQ I+++W  
Sbjct  223  SKDTRLLLLTTWLQPLFKDYNWLQHGCRSFDGKLVEEGIGRTILTLPLEDQQRILMSWLG  282

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYTN  94
             FLN GD CPN+Q+AF+VWWRR+F++ Y       ++  D T+
Sbjct  283  SFLNGGDGCPNLQRAFEVWWRRSFVRPYSDRQGSGVSQTDSTS  325



>ref|XP_002990647.1| hypothetical protein SELMODRAFT_185507 [Selaginella moellendorffii]
 gb|EFJ08279.1| hypothetical protein SELMODRAFT_185507 [Selaginella moellendorffii]
Length=551

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 134/213 (63%), Gaps = 22/213 (10%)
 Frame = -2

Query  723  ISRDMLYNLCHGCLNSLLLCASEAT----CVDESGKDRGVVMGEIAREADNVQWIVDILI  556
            +S++ LY+ C  CL  L    S  T        S +   +V   IAR  DN+QW+ ++LI
Sbjct  330  VSKESLYDACKECLQELSDAFSRLTEQQQQPASSAQAPSLVSAAIARHVDNIQWLAELLI  389

Query  555  ERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLL  376
            +R + +E V +W+ + +LA++H  +P M RHE+SRITA+LCV IGRG ++ P+  R  LL
Sbjct  390  DRGVAEELVHIWSRESQLAAMHRLLPAMQRHEVSRITARLCVGIGRGQIMAPQQVRALLL  449

Query  375  STWLEALYEDFGWMRR-----ACRS-------------IDKTLVEDGlsqtiltlplpqq  250
            +TWLE L +DF WM+R      C S             +DK  VE+GL QTILTL L +Q
Sbjct  450  ATWLEPLMDDFSWMQRLASKMTCSSLCYAGGNGGGFLVLDKKTVEEGLCQTILTLSLEEQ  509

Query  249  QAIMLNWFDRFLNKGDDCPNIQKAFQVWWRRAF  151
            ++I+++WF++F   GD+CPN+Q+AF+VWWRR F
Sbjct  510  RSILMSWFEKFSRDGDNCPNLQRAFEVWWRRTF  542



>ref|XP_003578818.1| PREDICTED: BTB/POZ domain-containing protein At2g13690-like [Brachypodium 
distachyon]
Length=512

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 132/203 (65%), Gaps = 4/203 (2%)
 Frame = -2

Query  732  DNTISRDMLYNLCHGCLNSLLLCASEAT---CVDESGKDRGV-VMGEIAREADNVQWIVD  565
            D  + +  +Y  CH CLN L+    EA+     D++    G   +  I ++ +++ W++ 
Sbjct  308  DKELDKMNIYRTCHSCLNCLVELFEEASDLGPADQTAISVGKGPLERIYKQVEDLNWLLQ  367

Query  564  ILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARF  385
            ILIER+MG++FVDLWA QK LAS+H ++  M R+E+SRI+A + +A+G G L    + RF
Sbjct  368  ILIERQMGEDFVDLWASQKILASMHGRVSPMVRYELSRISATIFIAVGSGKLHCTGEKRF  427

Query  384  SLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKG  205
            S+  TW   +  DFGW+RR  + ++ T +E+G+ Q +LTL L QQQA+ + WF+ F  +G
Sbjct  428  SIFHTWFRPMLADFGWLRRCPKGLNMTTLEEGIGQALLTLSLMQQQALFMEWFEAFGQQG  487

Query  204  DDCPNIQKAFQVWWRRAFIKQYV  136
             +CPN+ +AFQ+WWRR+FI+  V
Sbjct  488  RECPNLMRAFQIWWRRSFIRPIV  510



>emb|CDX77944.1| BnaA09g31390D [Brassica napus]
Length=512

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 144/223 (65%), Gaps = 12/223 (5%)
 Frame = -2

Query  756  RLLREDVPDNTISR--DMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADN  583
            +LLRE   +N      + +Y+ C  CL+S+L    +    DES         +I  EADN
Sbjct  298  KLLREQNGNNVAENFNETIYSSCQSCLDSVLSLFRQ----DESDAK------QIGVEADN  347

Query  582  VQWIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLV  403
            + W++D+L ER+  +EF   WA+QKELA LH K+P + R+ ISR+T++L V IGRG LL 
Sbjct  348  LTWLLDVLAERQAAEEFSVTWANQKELALLHEKVPLVSRYHISRVTSRLFVGIGRGELLP  407

Query  402  PKDARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFD  223
             KD R  LL+TWL+ L++D+ W++  CRS D  LVE+G+ +TILTLPL  QQ I+++W  
Sbjct  408  SKDTRLLLLTTWLQPLFKDYNWLQHGCRSFDGKLVEEGIGRTILTLPLEDQQRILMSWLG  467

Query  222  RFLNKGDDCPNIQKAFQVWWRRAFIKQYVPESQLQIALCDYTN  94
             FLN GD CPN+Q+AF+VWWRR+F++ Y       ++  D T+
Sbjct  468  SFLNGGDGCPNLQRAFEVWWRRSFVRPYSDRQGSGVSQTDSTS  510



>ref|XP_004955396.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Setaria 
italica]
Length=543

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 123/195 (63%), Gaps = 4/195 (2%)
 Frame = -2

Query  708  LYNLCHGCLNSLLLCASEAT----CVDESGKDRGVVMGEIAREADNVQWIVDILIERKMG  541
            LY+    CL+SLL     A+       +S  D+  +  +I  EADN+ W+ +IL +R   
Sbjct  335  LYSSFQNCLDSLLALFRRASDPEVLAGQSSDDKEQMFRKITLEADNLLWLAEILSDRHAA  394

Query  540  DEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWLE  361
            DE   +WA Q ELA LH +IP M+RH +S ++A+L VA+GRG  L  +  R  LL  WL+
Sbjct  395  DELTVIWAGQGELAELHPRIPVMHRHLVSCVSARLLVAVGRGEALPSEGTRRRLLDVWLQ  454

Query  360  ALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQK  181
             L +D+ W++  CR  D+ +VEDG+ Q ILTLPL  Q+A+++ W  RFL  GD CPN+Q+
Sbjct  455  PLMDDYRWLQHGCRWFDRAVVEDGVGQAILTLPLEDQRAVLMAWLGRFLKAGDGCPNLQR  514

Query  180  AFQVWWRRAFIKQYV  136
            AF+VWWRR F++ Y 
Sbjct  515  AFEVWWRRTFVRPYA  529



>gb|ACR38622.1| unknown [Zea mays]
Length=389

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 131/204 (64%), Gaps = 8/204 (4%)
 Frame = -2

Query  720  SRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILI-ERKM  544
            S + LY  C GCL+ L    +EA+           V   IA EADN+ W+V++L+  ++ 
Sbjct  188  SSETLYGSCRGCLDRLRRLLAEAS---SEPAYSAAVARRIALEADNLVWLVEMLVASQRA  244

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             D FV LW+ Q ELA+ H+  P   RH +SR+TA+L V +GRG +L P+DAR  LL  WL
Sbjct  245  CDGFVALWSGQAELAASHAGAPAASRHAVSRVTARLFVGVGRGEMLPPRDARLRLLQVWL  304

Query  363  EALYEDFGWMRRACRS----IDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDC  196
            + L +D+ W++RA  S     D+ LVEDG+ QTILTLPL  Q++++L WF RFL  GDDC
Sbjct  305  QPLIDDYAWLQRAGGSRPAAFDRRLVEDGIGQTILTLPLEDQRSLLLAWFGRFLKLGDDC  364

Query  195  PNIQKAFQVWWRRAFIKQYVPESQ  124
            PN+Q+AF+VWWRR F++ Y   S 
Sbjct  365  PNLQRAFEVWWRRTFVRPYACSSS  388



>ref|NP_001168062.1| hypothetical protein [Zea mays]
 ref|XP_008671020.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Zea 
mays]
 gb|ACN26975.1| unknown [Zea mays]
 tpg|DAA42716.1| TPA: hypothetical protein ZEAMMB73_494397 [Zea mays]
 tpg|DAA53077.1| TPA: hypothetical protein ZEAMMB73_512829 [Zea mays]
Length=545

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 126/201 (63%), Gaps = 10/201 (5%)
 Frame = -2

Query  708  LYNLCHGCLNSLLLCASEATCVDE-SGKDRGVVMG-------EIAREADNVQWIVDILIE  553
            LY     CL+SLL  + +A   DE +G++     G       +I  EADN+ W+ +IL E
Sbjct  328  LYGCFQNCLDSLLALSRQAAGADELAGEEESSSAGSKEQAFRKIGLEADNLLWLAEILSE  387

Query  552  RKMGDEFVDLWADQKELAS-LHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLL  376
            R   DE   +WA Q ELA+ LH +IP M+RH +S +TA+L VA+G+G  L  ++ R  LL
Sbjct  388  RHAADELTAIWASQTELAAELHPRIPVMHRHLVSCVTARLLVAVGKGEALPSRETRRRLL  447

Query  375  STWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNK-GDD  199
              WL  L +D+ W++  CR  D+  VEDG+ Q +LTLPL +QQA++L W  RFL   GD 
Sbjct  448  DVWLPPLMDDYRWLQHGCRWFDRAAVEDGIGQAVLTLPLEEQQAVLLAWLGRFLRAGGDG  507

Query  198  CPNIQKAFQVWWRRAFIKQYV  136
            CPN+Q+AF+VWWRR F++ Y 
Sbjct  508  CPNLQRAFEVWWRRTFVRPYA  528



>gb|EEC68972.1| hypothetical protein OsI_37717 [Oryza sativa Indica Group]
Length=527

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 125/193 (65%), Gaps = 6/193 (3%)
 Frame = -2

Query  708  LYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGE-----IAREADNVQWIVDILIERKM  544
            +Y++CH CLN L+    EA+ +  SG+   + +G+     I ++ +N+ W++ ILI+R+M
Sbjct  330  IYSICHTCLNCLVELFGEASDLGPSGQTT-ISVGKGPHERICKQVENLTWLLQILIDRQM  388

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
            G+EFVDLWA Q  L+++H +   M R+E+SRI+A + +A+G G L     +R  +   W 
Sbjct  389  GEEFVDLWASQNTLSTMHERFSPMVRYELSRISATIFIAMGSGKLHCTSTSRLGIFEAWF  448

Query  363  EALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDCPNIQ  184
              L  DFGW+RR  + ++   +EDG+ Q +LTL L  QQ + + WF+ F  +G +CPN+ 
Sbjct  449  RPLLVDFGWLRRCPKGLNMATLEDGIGQALLTLTLKHQQVLFMEWFETFSGQGRECPNLM  508

Query  183  KAFQVWWRRAFIK  145
            +AFQVWWRR+F++
Sbjct  509  RAFQVWWRRSFVR  521



>ref|XP_008661718.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Zea 
mays]
 tpg|DAA47352.1| TPA: hypothetical protein ZEAMMB73_722672 [Zea mays]
Length=530

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 130/200 (65%), Gaps = 8/200 (4%)
 Frame = -2

Query  720  SRDMLYNLCHGCLNSLLLCASEATCVDESGKDRGVVMGEIAREADNVQWIVDILI-ERKM  544
            S + LY  C GCL+ L    +EA+           V   IA EADN+ W+V++L+  ++ 
Sbjct  329  SSETLYGSCRGCLDRLRRLLAEAS---SEPAYSAAVARRIALEADNLVWLVEMLVASQRA  385

Query  543  GDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPKDARFSLLSTWL  364
             D FV LW+ Q ELA+ H+  P   RH +SR+TA+L V +GRG +L P+DAR  LL  WL
Sbjct  386  CDGFVALWSGQAELAASHAGAPAASRHAVSRVTARLFVGVGRGEMLPPRDARLRLLQVWL  445

Query  363  EALYEDFGWMRRACRS----IDKTLVEDGlsqtiltlplpqqQAIMLNWFDRFLNKGDDC  196
            + L +D+ W++RA  S     D+ LVEDG+ QTILTLPL  Q++++L WF RFL  GDDC
Sbjct  446  QPLIDDYAWLQRAGGSRPAAFDRRLVEDGIGQTILTLPLEDQRSLLLAWFGRFLKLGDDC  505

Query  195  PNIQKAFQVWWRRAFIKQYV  136
            PN+Q+AF+VWWRR F++ Y 
Sbjct  506  PNLQRAFEVWWRRTFVRPYA  525



>ref|XP_004977185.1| PREDICTED: BTB/POZ domain-containing protein At2g13690-like [Setaria 
italica]
Length=516

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 128/204 (63%), Gaps = 11/204 (5%)
 Frame = -2

Query  732  DNTISRDMLYNLCHGCLNSLL--------LCASEATCVDESGKDRGVVMGEIAREADNVQ  577
            D  + +  +Y +CH CLNSL+        L  ++   +   GK     +  I +  +++ 
Sbjct  310  DKELDKRSIYCICHSCLNSLVGLFEESSDLVHADERSISSVGKG---PLERIYKLVEDIN  366

Query  576  WIVDILIERKMGDEFVDLWADQKELASLHSKIPTMYRHEISRITAQLCVAIGRGHLLVPK  397
            W++ ILI+R+MG+EFVD+WA++K L+S+  ++  M RHE+SRI+A + +A+G G L    
Sbjct  367  WLLQILIDRQMGEEFVDVWANKKTLSSMQERVSPMIRHELSRISATIFIAMGSGKLHCTG  426

Query  396  DARFSLLSTWLEALYEDFGWMRRACRSIDKTLVEDGlsqtiltlplpqqQAIMLNWFDRF  217
            D RFS    W   +  DFGW+RR  + ++ T +E+G+ Q +LTL L QQQ + + WF+ F
Sbjct  427  DKRFSFFQAWFRPMLVDFGWLRRYPKGLNVTTLEEGIGQALLTLTLAQQQVLFMEWFEAF  486

Query  216  LNKGDDCPNIQKAFQVWWRRAFIK  145
              +G +CPN+ +AFQVWWRR+F++
Sbjct  487  SGQGRECPNLMRAFQVWWRRSFVR  510



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470