BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF021A03

Length=784
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362325.1|  PREDICTED: uncharacterized protein LOC102585892    276   1e-88   Solanum tuberosum [potatoes]
ref|XP_009804785.1|  PREDICTED: uncharacterized protein LOC104249949    272   5e-88   Nicotiana sylvestris
ref|XP_009615227.1|  PREDICTED: uncharacterized protein LOC104107982    271   1e-87   Nicotiana tomentosiformis
ref|XP_004249013.1|  PREDICTED: uncharacterized protein LOC101255446    270   8e-87   Solanum lycopersicum
ref|XP_002264842.2|  PREDICTED: uncharacterized protein LOC100243...    275   3e-86   Vitis vinifera
ref|XP_011101977.1|  PREDICTED: uncharacterized protein LOC105180...    266   2e-85   Sesamum indicum [beniseed]
emb|CDP06352.1|  unnamed protein product                                269   4e-85   Coffea canephora [robusta coffee]
ref|XP_010113031.1|  hypothetical protein L484_022756                   271   1e-84   
ref|XP_011101978.1|  PREDICTED: uncharacterized protein LOC105180...    259   2e-83   Sesamum indicum [beniseed]
ref|XP_002519981.1|  conserved hypothetical protein                     264   4e-83   Ricinus communis
gb|KDP21813.1|  hypothetical protein JCGZ_00600                         265   1e-82   Jatropha curcas
gb|EYU42067.1|  hypothetical protein MIMGU_mgv1a006657mg                264   9e-82   Erythranthe guttata [common monkey flower]
ref|XP_011006222.1|  PREDICTED: uncharacterized protein LOC105112277    263   3e-81   Populus euphratica
ref|XP_007032238.1|  Uncharacterized protein isoform 1                  255   3e-81   
gb|KJB27581.1|  hypothetical protein B456_005G0011001                   253   6e-81   Gossypium raimondii
gb|KJB27583.1|  hypothetical protein B456_005G0011001                   253   6e-81   Gossypium raimondii
gb|KHG16695.1|  Retinal-binding                                         252   1e-80   Gossypium arboreum [tree cotton]
ref|XP_004302492.1|  PREDICTED: uncharacterized protein LOC101292427    259   5e-80   Fragaria vesca subsp. vesca
gb|EYU42068.1|  hypothetical protein MIMGU_mgv1a006657mg                257   2e-79   Erythranthe guttata [common monkey flower]
gb|KHN24577.1|  hypothetical protein glysoja_014181                     246   2e-79   Glycine soja [wild soybean]
ref|XP_003521546.1|  PREDICTED: uncharacterized protein LOC100778...    245   4e-79   Glycine max [soybeans]
ref|XP_008370316.1|  PREDICTED: uncharacterized protein LOC103433803    248   5e-79   
ref|XP_008244213.1|  PREDICTED: uncharacterized protein LOC103342365    252   8e-79   Prunus mume [ume]
ref|XP_007205211.1|  hypothetical protein PRUPE_ppa005889mg             251   1e-78   
ref|XP_009370848.1|  PREDICTED: uncharacterized protein LOC103960157    247   1e-78   Pyrus x bretschneideri [bai li]
ref|XP_003548341.1|  PREDICTED: uncharacterized protein LOC100795...    242   3e-78   Glycine max [soybeans]
ref|XP_006429679.1|  hypothetical protein CICLE_v10011748mg             246   4e-78   Citrus clementina [clementine]
ref|XP_009337845.1|  PREDICTED: uncharacterized protein LOC103930264    254   5e-78   Pyrus x bretschneideri [bai li]
ref|XP_010653095.1|  PREDICTED: uncharacterized protein LOC100243...    245   4e-77   Vitis vinifera
ref|XP_004510081.1|  PREDICTED: uncharacterized protein LOC101493...    240   5e-77   Cicer arietinum [garbanzo]
ref|XP_003626627.1|  hypothetical protein MTR_8g005040                  239   6e-77   Medicago truncatula
ref|XP_010278895.1|  PREDICTED: uncharacterized protein LOC104612935    244   6e-76   Nelumbo nucifera [Indian lotus]
gb|KDO37186.1|  hypothetical protein CISIN_1g030723mg                   239   8e-76   Citrus sinensis [apfelsine]
ref|XP_007134600.1|  hypothetical protein PHAVU_010G060400g             237   8e-76   Phaseolus vulgaris [French bean]
ref|XP_008793389.1|  PREDICTED: uncharacterized protein LOC103709...    234   2e-75   Phoenix dactylifera
gb|EPS68255.1|  hypothetical protein M569_06516                         238   4e-75   Genlisea aurea
ref|XP_002323111.2|  hypothetical protein POPTR_0016s15030g             241   7e-75   
ref|XP_010673452.1|  PREDICTED: uncharacterized protein LOC104889827    231   3e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009125386.1|  PREDICTED: uncharacterized protein LOC103850397    227   7e-74   Brassica rapa
ref|XP_010496822.1|  PREDICTED: uncharacterized protein LOC104773850    228   1e-73   Camelina sativa [gold-of-pleasure]
gb|KFK24699.1|  hypothetical protein AALP_AA8G013300                    228   2e-73   Arabis alpina [alpine rockcress]
ref|XP_010490477.1|  PREDICTED: uncharacterized protein LOC104768...    226   2e-73   Camelina sativa [gold-of-pleasure]
ref|NP_195721.5|  uncharacterized protein                               226   3e-73   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43433.1|  unknown protein                                        226   4e-73   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43927.1|  unnamed protein product                                226   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007032241.1|  Uncharacterized protein isoform 4                  228   4e-73   
ref|XP_010490476.1|  PREDICTED: uncharacterized protein LOC104768...    226   6e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006279346.1|  hypothetical protein CARUB_v10012733mg             229   6e-73   Capsella rubella
ref|XP_006599750.1|  PREDICTED: uncharacterized protein LOC100795...    240   6e-73   Glycine max [soybeans]
dbj|BAD43795.1|  unknown protein                                        226   7e-73   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43397.1|  unnamed protein product                                224   8e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398547.1|  hypothetical protein EUTSA_v10013603mg             226   9e-73   Eutrema salsugineum [saltwater cress]
gb|KJB27580.1|  hypothetical protein B456_005G0011001                   225   2e-72   Gossypium raimondii
ref|XP_010036049.1|  PREDICTED: uncharacterized protein LOC104425150    239   3e-72   Eucalyptus grandis [rose gum]
ref|XP_008649464.1|  PREDICTED: uncharacterized protein LOC103630...    237   4e-72   Zea mays [maize]
ref|XP_010921251.1|  PREDICTED: uncharacterized protein LOC105044...    234   5e-72   Elaeis guineensis
ref|XP_008649463.1|  PREDICTED: uncharacterized protein LOC103630...    236   6e-72   Zea mays [maize]
ref|XP_010938084.1|  PREDICTED: uncharacterized protein LOC105057...    230   8e-72   Elaeis guineensis
ref|XP_007032239.1|  Uncharacterized protein isoform 2                  223   1e-71   
ref|XP_010921253.1|  PREDICTED: uncharacterized protein LOC105044...    231   2e-71   
ref|XP_009130613.1|  PREDICTED: uncharacterized protein LOC103855...    230   2e-71   Brassica rapa
ref|XP_010921254.1|  PREDICTED: uncharacterized protein LOC105044...    231   3e-71   
ref|XP_010921250.1|  PREDICTED: uncharacterized protein LOC105044...    231   4e-71   Elaeis guineensis
dbj|BAH57023.1|  AT5G01010                                              218   8e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782731.1|  PREDICTED: uncharacterized protein LOC103702...    229   9e-71   Phoenix dactylifera
ref|XP_008782734.1|  PREDICTED: uncharacterized protein LOC103702...    228   9e-71   
ref|XP_004147520.1|  PREDICTED: uncharacterized protein LOC101218161    232   2e-70   Cucumis sativus [cucumbers]
ref|XP_009391656.1|  PREDICTED: uncharacterized protein LOC103977773    221   3e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006429676.1|  hypothetical protein CICLE_v10011748mg             219   5e-70   
ref|XP_006429677.1|  hypothetical protein CICLE_v10011748mg             219   6e-70   
ref|XP_006654248.1|  PREDICTED: uncharacterized protein LOC102707586    228   1e-69   Oryza brachyantha
ref|NP_001154687.1|  uncharacterized protein                            212   6e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008463316.1|  PREDICTED: uncharacterized protein LOC103501...    231   6e-69   Cucumis melo [Oriental melon]
ref|NP_001190197.1|  uncharacterized protein                            211   8e-69   
ref|NP_001055152.1|  Os05g0306000                                       225   2e-68   
ref|XP_006429678.1|  hypothetical protein CICLE_v10011748mg             214   2e-68   
ref|XP_011101979.1|  PREDICTED: uncharacterized protein LOC105180...    207   1e-67   Sesamum indicum [beniseed]
ref|XP_010543127.1|  PREDICTED: uncharacterized protein LOC104816...    224   2e-67   Tarenaya hassleriana [spider flower]
ref|NP_001154688.1|  uncharacterized protein                            204   8e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11168.1|  BnaA03g00040D                                          214   2e-66   Brassica napus [oilseed rape]
ref|XP_004962482.1|  PREDICTED: uncharacterized protein LOC101772...    218   2e-66   Setaria italica
ref|XP_004962483.1|  PREDICTED: uncharacterized protein LOC101772...    218   2e-66   
ref|XP_004962481.1|  PREDICTED: uncharacterized protein LOC101772...    217   4e-66   Setaria italica
gb|KDO37187.1|  hypothetical protein CISIN_1g030723mg                   213   1e-65   Citrus sinensis [apfelsine]
ref|XP_003568677.1|  PREDICTED: uncharacterized protein LOC100826...    218   7e-65   Brachypodium distachyon [annual false brome]
ref|XP_010543126.1|  PREDICTED: uncharacterized protein LOC104816...    215   9e-65   Tarenaya hassleriana [spider flower]
dbj|BAJ93195.1|  predicted protein                                      217   1e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW77521.1|  hypothetical protein ZEAMMB73_436424                    211   2e-64   
ref|XP_008793390.1|  PREDICTED: uncharacterized protein LOC103709...    161   7e-62   
gb|EEE63181.1|  hypothetical protein OsJ_17990                          202   1e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002872981.1|  hypothetical protein ARALYDRAFT_486867             202   6e-61   
ref|XP_008793391.1|  PREDICTED: uncharacterized protein LOC103709...    186   6e-61   
ref|XP_006842639.1|  hypothetical protein AMTR_s00077p00188630          206   2e-60   Amborella trichopoda
ref|XP_010231533.1|  PREDICTED: uncharacterized protein LOC100826...    193   1e-57   
ref|XP_010938085.1|  PREDICTED: uncharacterized protein LOC105057...    181   3e-57   Elaeis guineensis
ref|XP_002980642.1|  hypothetical protein SELMODRAFT_154057             162   5e-51   
ref|XP_002991009.1|  hypothetical protein SELMODRAFT_161364             162   5e-51   
ref|XP_001765571.1|  predicted protein                                  168   6e-51   
ref|XP_006398545.1|  hypothetical protein EUTSA_v10013603mg             152   1e-50   
ref|XP_008463317.1|  PREDICTED: uncharacterized protein LOC103501...    178   4e-49   Cucumis melo [Oriental melon]
ref|XP_007032243.1|  Uncharacterized protein isoform 6                  142   3e-47   
gb|EYU42069.1|  hypothetical protein MIMGU_mgv1a006657mg                144   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_006398546.1|  hypothetical protein EUTSA_v10013603mg             129   7e-44   
ref|XP_009130614.1|  PREDICTED: uncharacterized protein LOC103855...    134   9e-43   Brassica rapa
dbj|BAH57287.1|  AT5G01010                                              145   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496718.1|  PREDICTED: uncharacterized protein LOC104773766    113   1e-39   
gb|KDO37188.1|  hypothetical protein CISIN_1g030723mg                   140   7e-38   Citrus sinensis [apfelsine]
ref|XP_010543129.1|  PREDICTED: uncharacterized protein LOC104816...    117   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_007032240.1|  Uncharacterized protein isoform 3                93.6    9e-33   
ref|XP_010543128.1|  PREDICTED: uncharacterized protein LOC104816...    108   9e-33   Tarenaya hassleriana [spider flower]
gb|EMS49914.1|  hypothetical protein TRIUR3_19770                       110   1e-32   Triticum urartu
gb|KDO37189.1|  hypothetical protein CISIN_1g030723mg                   122   5e-31   Citrus sinensis [apfelsine]
ref|XP_004169546.1|  PREDICTED: uncharacterized protein LOC101223675    119   2e-30   
ref|XP_010231534.1|  PREDICTED: uncharacterized protein LOC100826...  76.3    2e-22   
ref|XP_006296412.1|  hypothetical protein CARUB_v10025590mg           92.4    2e-20   
ref|XP_007032242.1|  Uncharacterized protein isoform 5                74.3    1e-16   
ref|XP_004353064.1|  serpin, putative                                 70.1    3e-14   Acanthamoeba castellanii str. Neff
gb|EMT26757.1|  hypothetical protein F775_30139                       57.0    2e-12   
gb|EFN84723.1|  SEC14-like protein 2                                  68.6    3e-11   Harpegnathos saltator
ref|XP_011139122.1|  PREDICTED: SEC14-like protein 2                  67.4    3e-10   
gb|AAF89109.1|AC074299_3  TEL1S.2                                     60.8    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001702453.1|  predicted protein                                45.1    2e-08   Chlamydomonas reinhardtii
ref|XP_004163944.1|  PREDICTED: uncharacterized LOC101218161          62.0    1e-07   
ref|XP_001121498.2|  PREDICTED: SEC14-like protein 2-like             60.8    2e-07   
ref|XP_002602154.1|  hypothetical protein BRAFLDRAFT_234283           58.2    2e-07   Branchiostoma floridae
ref|XP_624865.3|  PREDICTED: SEC14-like protein 2-like                60.8    3e-07   Apis mellifera [bee]
gb|EFZ20476.1|  hypothetical protein SINV_14001                       60.5    3e-07   
ref|XP_011155993.1|  PREDICTED: SEC14-like protein 2                  60.1    4e-07   Solenopsis invicta [imported red fire ant]
ref|XP_003706144.1|  PREDICTED: SEC14-like protein 2-like             60.1    5e-07   Megachile rotundata
ref|XP_003698581.1|  PREDICTED: SEC14-like protein 2-like             59.7    5e-07   Apis florea [dwarf honeybee]
gb|KJE98138.1|  SEC14-like protein, variant                           59.3    9e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_006609824.1|  PREDICTED: SEC14-like protein 2-like isoform X1  59.3    9e-07   Apis dorsata [rock honeybee]
ref|XP_011049938.1|  PREDICTED: SEC14-like protein 2                  59.3    9e-07   Acromyrmex echinatior
gb|EGI68383.1|  SEC14-like protein 2                                  58.9    9e-07   Acromyrmex echinatior
ref|XP_004342753.1|  SEC14-like protein                               59.3    1e-06   Capsaspora owczarzaki ATCC 30864
gb|KJE98137.1|  SEC14-like protein                                    59.3    1e-06   Capsaspora owczarzaki ATCC 30864
ref|XP_011334815.1|  PREDICTED: SEC14-like protein 2 isoform X2       58.2    2e-06   
ref|XP_011334812.1|  PREDICTED: SEC14-like protein 2 isoform X1       57.8    3e-06   Ooceraea biroi
gb|EFX85554.1|  hypothetical protein DAPPUDRAFT_300280                56.6    6e-06   Daphnia pulex
ref|XP_003394555.1|  PREDICTED: LOW QUALITY PROTEIN: SEC14-like p...  56.2    8e-06   
emb|CDW51773.1|  CRAL TRIO domain containing protein                  54.3    3e-05   Trichuris trichiura
ref|XP_003486550.1|  PREDICTED: SEC14-like protein 2-like             54.3    4e-05   Bombus impatiens
ref|XP_011307420.1|  PREDICTED: SEC14-like protein 2                  52.8    7e-05   Fopius arisanus
gb|EFN74196.1|  SEC14-like protein 2                                  53.1    9e-05   Camponotus floridanus
ref|XP_008201186.1|  PREDICTED: SEC14-like protein 3                  53.1    1e-04   
gb|EFA12792.1|  hypothetical protein TcasGA2_TC002162                 53.1    1e-04   
ref|XP_011259189.1|  PREDICTED: SEC14-like protein 2 isoform X1       53.1    1e-04   Camponotus floridanus
ref|XP_011259195.1|  PREDICTED: SEC14-like protein 2 isoform X2       52.8    1e-04   Camponotus floridanus
gb|KFD58027.1|  hypothetical protein M513_01260                       52.8    1e-04   Trichuris suis
ref|XP_003724076.1|  PREDICTED: FYVE and coiled-coil domain-conta...  53.1    1e-04   Strongylocentrotus purpuratus [purple urchin]
ref|XP_780082.3|  PREDICTED: FYVE and coiled-coil domain-containi...  53.1    1e-04   Strongylocentrotus purpuratus [purple urchin]
ref|XP_002116332.1|  hypothetical protein TRIADDRAFT_60316            51.2    4e-04   Trichoplax adhaerens
ref|XP_003747619.1|  PREDICTED: SEC14-like protein 2-like             50.8    5e-04   Galendromus occidentalis



>ref|XP_006362325.1| PREDICTED: uncharacterized protein LOC102585892 [Solanum tuberosum]
Length=439

 Score =   276 bits (706),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 152/172 (88%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EAGKL  +QI VLE+AVD+Y SEF+RFI FI +VF N+PFFITAE+AG +EA K++EY+E
Sbjct  268  EAGKLSRSQITVLEEAVDIYTSEFQRFITFIRDVFANSPFFITAEEAGTLEARKSDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            VSV AGKTHEVSLTV+ INSYIAWDFSL+QGR+++ DIGFSMEY D SG+KT ILPYRRY
Sbjct  328  VSVPAGKTHEVSLTVDAINSYIAWDFSLVQGRVDM-DIGFSMEYTDPSGQKTQILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
             +DQGNFCTC++GNYKL+WDNSYS+FF KVLRYKVDCIPPVVE   S++Q++
Sbjct  387  GADQGNFCTCLSGNYKLIWDNSYSTFFKKVLRYKVDCIPPVVEPELSSDQVD  438


 Score = 78.6 bits (192),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            ++INDD+GPMEEQR RYGPPLYSLTKM LNIRLFLSLLW+  +
Sbjct  226  QKINDDDGPMEEQRQRYGPPLYSLTKMVLNIRLFLSLLWRRFE  268



>ref|XP_009804785.1| PREDICTED: uncharacterized protein LOC104249949 [Nicotiana sylvestris]
Length=439

 Score =   272 bits (696),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +Q+ VLE+AVDVY SEF+RFIKFIG+VF N+PFFITAE+AGA++A K++EY+E
Sbjct  268  EARKLSKDQMTVLEEAVDVYTSEFQRFIKFIGDVFANSPFFITAEEAGALDARKSDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            VSV AGKTHEVSLTV+ INSYIAWDF+L+QGR+++ DIGFSME+ D SG+KT ILPYRRY
Sbjct  328  VSVPAGKTHEVSLTVDAINSYIAWDFALVQGRVDM-DIGFSMEFTDLSGQKTQILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ++DQGNFCT +AG+YKL+WDN+YS+FF KVLRYKVDCIPPVVE + S++Q++
Sbjct  387  DADQGNFCTVLAGHYKLIWDNAYSTFFKKVLRYKVDCIPPVVEPALSSDQVD  438


 Score = 80.5 bits (197),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            R+INDD+GPMEEQR RYGPPLYSLTKM LNIRLFLSLLW+  +
Sbjct  226  RKINDDDGPMEEQRQRYGPPLYSLTKMVLNIRLFLSLLWRRFE  268



>ref|XP_009615227.1| PREDICTED: uncharacterized protein LOC104107982 [Nicotiana tomentosiformis]
Length=439

 Score =   271 bits (693),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +Q+ VLE+AVDVY SEF+RFIKFIG+VF N+PFFITAE+AGA++A K++EY+E
Sbjct  268  EARKLSKDQMAVLEEAVDVYTSEFQRFIKFIGDVFANSPFFITAEEAGALDARKSDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            VSV AGKTHEVSLTV+ INSYIAWDF+L+QGR+++ DIGFSME+ + SG+KT ILPYRRY
Sbjct  328  VSVPAGKTHEVSLTVDAINSYIAWDFALVQGRVDM-DIGFSMEFTNLSGQKTQILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ++DQGNFCT +AG+YKL+WDNSYS+FF KVLRYKVDCIPPVVE + S++Q++
Sbjct  387  DADQGNFCTVLAGHYKLIWDNSYSTFFKKVLRYKVDCIPPVVEPALSSDQVD  438


 Score = 80.5 bits (197),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            R+INDD+GPMEEQR RYGPPLYSLTKM LNIRLFLSLLW+  +
Sbjct  226  RKINDDDGPMEEQRQRYGPPLYSLTKMVLNIRLFLSLLWRRFE  268



>ref|XP_004249013.1| PREDICTED: uncharacterized protein LOC101255446 [Solanum lycopersicum]
Length=435

 Score =   270 bits (690),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EAGKL  +QI VLE+AVD+Y SEF+RFI FI +VF N+PFFITAE+AG +EA K++EY+E
Sbjct  268  EAGKLSRSQITVLEEAVDIYTSEFQRFITFIRDVFANSPFFITAEEAGTLEARKSDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            VSV AGK+HEVSLTV+ INSYIAWDFSL+QGR+++ DIGFSMEY D SG+KT ILPYRRY
Sbjct  328  VSVPAGKSHEVSLTVDAINSYIAWDFSLVQGRVDM-DIGFSMEYTDPSGQKTQILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASAN  153
             +DQGNFCTC++GNYKL+WDNSYS+FF KVLR+KVDCIPPVVE   S++
Sbjct  387  GADQGNFCTCLSGNYKLIWDNSYSTFFKKVLRFKVDCIPPVVEPVLSSD  435


 Score = 79.0 bits (193),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            ++INDD+GPMEEQR RYGPPLYSLTKM LNIRLFLSLLW+  +
Sbjct  226  QKINDDDGPMEEQRQRYGPPLYSLTKMVLNIRLFLSLLWRRFE  268



>ref|XP_002264842.2| PREDICTED: uncharacterized protein LOC100243295 isoform X1 [Vitis 
vinifera]
 emb|CBI31130.3| unnamed protein product [Vitis vinifera]
Length=439

 Score =   275 bits (703),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL   Q+ VL +AVDVY SEFERFIKFI  VF N+PFFI+AEDAG IEA KN+EY+E
Sbjct  268  EARKLTKEQLTVLGQAVDVYTSEFERFIKFISEVFANSPFFISAEDAGPIEARKNDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +S+ AGKTHEVSL VE INSYIAWDFSL QG++N+ DIGFSMEY ++SG KT ILPYRRY
Sbjct  328  ISIPAGKTHEVSLMVESINSYIAWDFSLAQGKMNV-DIGFSMEYTNASGDKTLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ESDQGNFCTCMAGNYKL+WDNSYS+FF KVLRYKVDCIPPVVE  A+A  ++
Sbjct  387  ESDQGNFCTCMAGNYKLIWDNSYSTFFKKVLRYKVDCIPPVVEPVAAATDVK  438


 Score = 71.6 bits (174),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQ+NDDEGPMEEQR RYGPPLYSLT + L+IRLFL L W+  +
Sbjct  226  RQLNDDEGPMEEQRQRYGPPLYSLTTLVLSIRLFLFLSWRRFE  268



>ref|XP_011101977.1| PREDICTED: uncharacterized protein LOC105180011 isoform X1 [Sesamum 
indicum]
Length=437

 Score =   266 bits (680),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KLQ NQ+ +LE+A +VY SEFERFI FI  VF N+PFFITAEDAG + A K+++Y+E+++
Sbjct  271  KLQKNQLSILEEAANVYTSEFERFITFIREVFTNSPFFITAEDAGTLAARKDDDYKEINI  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+THEVSLTVE INSYIAWDFSL+QG+++LQDIGFS+E  D SGKKT ILPYRRYESD
Sbjct  331  PAGETHEVSLTVESINSYIAWDFSLVQGKMSLQDIGFSVECTDLSGKKTLILPYRRYESD  390

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASA  156
            QGNFCTC++G+YKL+WDNSYSSFF KV+RYKVDCIPPV ES+  A
Sbjct  391  QGNFCTCVSGSYKLIWDNSYSSFFKKVMRYKVDCIPPVAESATHA  435


 Score = 77.8 bits (190),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHL  659
            RQINDD+GPMEEQR RYGPPLY LT+M  NIRLFLSLLW  L
Sbjct  226  RQINDDQGPMEEQRQRYGPPLYCLTRMVHNIRLFLSLLWARL  267



>emb|CDP06352.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   269 bits (687),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA K+QGNQI VLE AVDVY SEFERFI FIG VF N+PFFITAEDAGA+EA  N++++E
Sbjct  268  EAQKVQGNQISVLEAAVDVYTSEFERFISFIGEVFANSPFFITAEDAGALEARNNDDFKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +++ AGK +EVSL+V+ INSYI WDFSL+QGR+N+ DIGFS+EY D++G+KT ILPY RY
Sbjct  328  INIPAGKIYEVSLSVDSINSYIGWDFSLVQGRMNM-DIGFSVEYTDAAGQKTLILPYGRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS  159
            ESDQGNFCTCMAGNY+LVWDNS+S+FF KVLRYKVDCIPPVVE  +S
Sbjct  387  ESDQGNFCTCMAGNYRLVWDNSFSAFFGKVLRYKVDCIPPVVEPVSS  433


 Score = 74.3 bits (181),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYKG  638
            RQINDD+GPMEEQRHRYGPPLY+LT M LNIRLFL LLW H + +  +G
Sbjct  226  RQINDDQGPMEEQRHRYGPPLYALTTMVLNIRLFLLLLWGHFEAQKVQG  274



>ref|XP_010113031.1| hypothetical protein L484_022756 [Morus notabilis]
 gb|EXC35202.1| hypothetical protein L484_022756 [Morus notabilis]
Length=503

 Score =   271 bits (693),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -3

Query  686  FSISAMAAPEAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIE  507
            F + A    EAGKL   ++ VLE+AVDVY +EFERF+KFIG VF N+PFFI+AE AGA+E
Sbjct  323  FLVLAWGRFEAGKLNRQKVAVLEQAVDVYTTEFERFLKFIGEVFANSPFFISAEVAGALE  382

Query  506  ASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKK  327
              KN++Y+E+SV AGK+HEV L+V+ +NSYIAWDFS++QG+++L DIGFS+EY +SSG+K
Sbjct  383  GRKNDDYKEISVPAGKSHEVLLSVDSLNSYIAWDFSVVQGKISL-DIGFSVEYTNSSGEK  441

Query  326  TPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQL  147
            T ILPYRRYE+DQGNFCTCMAGNYKL+WDNSY+SFF KVLR+KVDCIPPVVES  S NQ+
Sbjct  442  TLILPYRRYEADQGNFCTCMAGNYKLIWDNSYASFFKKVLRFKVDCIPPVVESPPSDNQV  501

Query  146  E  144
            E
Sbjct  502  E  502


 Score = 70.5 bits (171),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQR RYGPPLY+LT M L IRLFL L W
Sbjct  290  RQINDDDGPMEEQRQRYGPPLYNLTAMVLFIRLFLVLAW  328



>ref|XP_011101978.1| PREDICTED: uncharacterized protein LOC105180011 isoform X2 [Sesamum 
indicum]
Length=436

 Score =   259 bits (663),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 143/165 (87%), Gaps = 1/165 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KLQ NQ+ +LE+A +VY SEFERFI FI  VF N+PFFITAEDAG + A K+++Y+E+++
Sbjct  271  KLQKNQLSILEEAANVYTSEFERFITFIREVFTNSPFFITAEDAGTLAARKDDDYKEINI  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+THEVSLTVE INSYIAWDFSL+QG+++L DIGFS+E  D SGKKT ILPYRRYESD
Sbjct  331  PAGETHEVSLTVESINSYIAWDFSLVQGKMSL-DIGFSVECTDLSGKKTLILPYRRYESD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASA  156
            QGNFCTC++G+YKL+WDNSYSSFF KV+RYKVDCIPPV ES+  A
Sbjct  390  QGNFCTCVSGSYKLIWDNSYSSFFKKVMRYKVDCIPPVAESATHA  434


 Score = 77.8 bits (190),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHL  659
            RQINDD+GPMEEQR RYGPPLY LT+M  NIRLFLSLLW  L
Sbjct  226  RQINDDQGPMEEQRQRYGPPLYCLTRMVHNIRLFLSLLWARL  267



>ref|XP_002519981.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42305.1| conserved hypothetical protein [Ricinus communis]
Length=439

 Score =   264 bits (674),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KL+G+Q+ VLE+AVDVY  EFERFI FIG VF NAPFFI+AE AGA+    N+E++E
Sbjct  268  EDRKLKGHQVVVLEQAVDVYTREFERFIIFIGEVFANAPFFISAEVAGALAGRTNDEFKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AGKTHEVSL V+ +NSYIAWDFSLIQG++N+ DIGFS+EY D SGK++ ILPYRRY
Sbjct  328  ISVPAGKTHEVSLVVDSVNSYIAWDFSLIQGKMNV-DIGFSVEYMDPSGKRSLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLEG  141
            ESDQGNF T  AGNYKL+WDNSYS+FF KVLRYKVDCIPPVVE   S +Q+EG
Sbjct  387  ESDQGNFSTVTAGNYKLIWDNSYSAFFKKVLRYKVDCIPPVVEPLQSTDQVEG  439


 Score = 72.4 bits (176),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYKG  638
            R INDD+GPMEEQR RYGPPLYSLT M L+IR+ LSL W   +    KG
Sbjct  226  RTINDDDGPMEEQRQRYGPPLYSLTAMVLSIRVLLSLSWAMFEDRKLKG  274



>gb|KDP21813.1| hypothetical protein JCGZ_00600 [Jatropha curcas]
Length=439

 Score =   265 bits (678),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +Q+ VL++AVDVY  EF RFI F+  VF N+PFFI+AE AG ++A  N+E++E
Sbjct  268  EASKLNRDQVAVLKQAVDVYTHEFVRFITFLSEVFANSPFFISAEVAGTLDARTNDEFKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AGKTHEVSL V+ INSYIAWDFSLIQG++N+ DIGFS+EY D SGKKT ILPY+RY
Sbjct  328  ISVPAGKTHEVSLAVDSINSYIAWDFSLIQGKINM-DIGFSVEYVDPSGKKTLILPYQRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLEG  141
            ESDQGNFCT MAGNYKL+WDNSYSSFF KV+RYKVDCIPPVVE   S NQ+EG
Sbjct  387  ESDQGNFCTVMAGNYKLIWDNSYSSFFKKVIRYKVDCIPPVVEPMQSTNQVEG  439


 Score = 69.3 bits (168),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            R INDD+GPMEEQR RYGP LYSLT M L+IRLFLSL W
Sbjct  226  RTINDDDGPMEEQRKRYGPTLYSLTAMVLSIRLFLSLSW  264



>gb|EYU42067.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=436

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KLQ NQ+ +LE+A DVY SEF+RFIKFIG VF N+PFFITAEDAG +   K+++Y+E
Sbjct  269  ETSKLQKNQVVILEEAADVYTSEFQRFIKFIGEVFTNSPFFITAEDAGTLSIRKDDDYKE  328

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AG  HEVSLTVE +NSYIAWDFSL+QG+LN+QDIGFS+E  + SG+KT ILPY+RY
Sbjct  329  ISVPAGSAHEVSLTVESVNSYIAWDFSLVQGKLNVQDIGFSVECTNLSGEKTLILPYQRY  388

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
            E++QGNFCTC+ GNYKL+WDNSYSSFF KVLRYKVDCIPPVV+S
Sbjct  389  EANQGNFCTCVPGNYKLIWDNSYSSFFKKVLRYKVDCIPPVVDS  432


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLYSLTKMA +IRL LSLLW  L+
Sbjct  227  RQINDDQGPMEEQRQRYGPPLYSLTKMAHSIRLLLSLLWGRLE  269



>ref|XP_011006222.1| PREDICTED: uncharacterized protein LOC105112277 [Populus euphratica]
Length=435

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +Q+ VLEKAVDVY  EF RFI FI  VF N+PFFI+AE AGA+EA  N++Y+E
Sbjct  264  EAKKLTRDQVAVLEKAVDVYTYEFRRFITFISEVFANSPFFISAEAAGALEARNNDDYKE  323

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGKTHEVSL+VE +NSYIAWDFSLIQG++N+ DIGFS+E  D SGKKT ILPYRRY
Sbjct  324  INVPAGKTHEVSLSVESVNSYIAWDFSLIQGKINM-DIGFSVECTDPSGKKTLILPYRRY  382

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ESDQGNF TC++GNYKL+WDNSYS+FF KVLRYKVDCIPPVVE   SA ++E
Sbjct  383  ESDQGNFSTCVSGNYKLIWDNSYSAFFKKVLRYKVDCIPPVVEPVQSAGEME  434


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD GPMEEQR RYGP LYSLT M L IRLF+ L W
Sbjct  222  RQINDDNGPMEEQRQRYGPSLYSLTAMVLLIRLFIQLAW  260



>ref|XP_007032238.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY03164.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   255 bits (652),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 146/173 (84%), Gaps = 2/173 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +QI VLE+AVDVY SEFERFI FI  VF N+PFFI+AEDA   E  K++EY E
Sbjct  268  EAFKLNRHQISVLEEAVDVYTSEFERFINFISEVFANSPFFISAEDASMFETRKSDEYNE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGK++EVSL VE INSYIAWDFSL+QG++N+ DIGFS+EY ++ G+KT ILPYRRY
Sbjct  328  ITVPAGKSYEVSLAVESINSYIAWDFSLVQGKMNM-DIGFSVEYTNTVGEKTLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLEG  141
            ESDQGNF TCMAG+YKL+WDNSYS+FF K LRYKVDCIPPV++ SA +N++EG
Sbjct  387  ESDQGNFSTCMAGHYKLIWDNSYSTFFKKALRYKVDCIPPVLD-SAESNEVEG  438


 Score = 75.1 bits (183),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLY+LTK  L IRLFLSL WQ  +
Sbjct  226  RQINDDDGPMEEQRQRYGPPLYNLTKTVLIIRLFLSLAWQRFE  268



>gb|KJB27581.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
 gb|KJB27582.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
Length=301

 Score =   253 bits (647),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL   QI VLE+AVDVY +E +RFI FI  VF N+PFFI+AEDA  +E  KN+EY+E
Sbjct  127  EAFKLNRLQISVLEEAVDVYTTELQRFINFISEVFANSPFFISAEDASMLEMGKNDEYKE  186

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGK++EVSLTVE INSYIAWDFSL+QG++N+ DIGFS+EY ++ G+KT ILPYRRY
Sbjct  187  ITVPAGKSYEVSLTVESINSYIAWDFSLVQGKMNM-DIGFSVEYTNNGGEKTLILPYRRY  245

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQ  150
            ESDQGNF TCMAGNYKL+WDNSYS+FF K LRYKVDCIPPV+E S   ++
Sbjct  246  ESDQGNFSTCMAGNYKLIWDNSYSAFFKKALRYKVDCIPPVLEESEKGSE  295


 Score = 75.5 bits (184),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLYSLT+M L I LFLSL WQ  +
Sbjct  85   RQINDDDGPMEEQRQRYGPPLYSLTRMVLFIHLFLSLAWQRFE  127



>gb|KJB27583.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
Length=294

 Score =   253 bits (647),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL   QI VLE+AVDVY +E +RFI FI  VF N+PFFI+AEDA  +E  KN+EY+E
Sbjct  120  EAFKLNRLQISVLEEAVDVYTTELQRFINFISEVFANSPFFISAEDASMLEMGKNDEYKE  179

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGK++EVSLTVE INSYIAWDFSL+QG++N+ DIGFS+EY ++ G+KT ILPYRRY
Sbjct  180  ITVPAGKSYEVSLTVESINSYIAWDFSLVQGKMNM-DIGFSVEYTNNGGEKTLILPYRRY  238

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQ  150
            ESDQGNF TCMAGNYKL+WDNSYS+FF K LRYKVDCIPPV+E S   ++
Sbjct  239  ESDQGNFSTCMAGNYKLIWDNSYSAFFKKALRYKVDCIPPVLEESEKGSE  288


 Score = 75.5 bits (184),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLYSLT+M L I LFLSL WQ  +
Sbjct  78   RQINDDDGPMEEQRQRYGPPLYSLTRMVLFIHLFLSLAWQRFE  120



>gb|KHG16695.1| Retinal-binding [Gossypium arboreum]
Length=442

 Score =   252 bits (644),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL   QI VLE+AVDVY +E +RFI FI  VF N+PFFI+AEDA  +E  KN+EY+E
Sbjct  268  EAFKLNRLQISVLEEAVDVYTTELQRFINFISEVFANSPFFISAEDASMLEMRKNDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGK++EVSLTVE INSYIAWDFSL+QG++++ DIGFS+EY ++ G+KT ILPYRRY
Sbjct  328  ITVPAGKSYEVSLTVESINSYIAWDFSLVQGKMSM-DIGFSVEYTNNGGEKTLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQ  150
            ESDQGNF TCMAGNYKL+WDNSYS+FF K LRYKVDCIPPV+E S   ++
Sbjct  387  ESDQGNFSTCMAGNYKLIWDNSYSAFFKKALRYKVDCIPPVLEESEKGSE  436


 Score = 75.5 bits (184),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYK  641
            RQINDD+GPMEEQR RYGPPLYSLT+M L IRLFLSL W  L+ E +K
Sbjct  226  RQINDDDGPMEEQRQRYGPPLYSLTRMVLFIRLFLSLAW--LRFEAFK  271



>ref|XP_004302492.1| PREDICTED: uncharacterized protein LOC101292427 [Fragaria vesca 
subsp. vesca]
Length=440

 Score =   259 bits (662),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KL   ++ +LE+AVDVY +EFERFIKFI  VF N+PFFI+AE AGA +   N++Y+E
Sbjct  269  ETRKLNKQEVALLEQAVDVYTTEFERFIKFISEVFANSPFFISAEVAGASDGGNNDDYKE  328

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SVAAGKTHEVSLTV+ INSYIAWDFSL+QG++NL DIGFS+EY ++SG+K+ ILPY+RY
Sbjct  329  ISVAAGKTHEVSLTVDSINSYIAWDFSLVQGKMNL-DIGFSVEYTNASGEKSLILPYKRY  387

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ESDQGNFCTC AG YKLVWDNSYSSFF KVLR+KVDCIPPVVE+   A + E
Sbjct  388  ESDQGNFCTCEAGKYKLVWDNSYSSFFKKVLRFKVDCIPPVVETVPRATEAE  439


 Score = 67.0 bits (162),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQR RYGPPLYSLT M L IRL + L W
Sbjct  227  RQINDDDGPMEEQRQRYGPPLYSLTTMVLLIRLAILLSW  265



>gb|EYU42068.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=435

 Score =   257 bits (656),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KLQ NQ+ +LE+A DVY SEF+RFIKFIG VF N+PFFITAEDAG +   K+++Y+E
Sbjct  269  ETSKLQKNQVVILEEAADVYTSEFQRFIKFIGEVFTNSPFFITAEDAGTLSIRKDDDYKE  328

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AG  HEVSLTVE +NSYIAWDFSL+QG+LN+ DIGFS+E  + SG+KT ILPY+RY
Sbjct  329  ISVPAGSAHEVSLTVESVNSYIAWDFSLVQGKLNV-DIGFSVECTNLSGEKTLILPYQRY  387

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
            E++QGNFCTC+ GNYKL+WDNSYSSFF KVLRYKVDCIPPVV+S
Sbjct  388  EANQGNFCTCVPGNYKLIWDNSYSSFFKKVLRYKVDCIPPVVDS  431


 Score = 66.6 bits (161),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLYSLTKMA +IRL LSLLW  L+
Sbjct  227  RQINDDQGPMEEQRQRYGPPLYSLTKMAHSIRLLLSLLWGRLE  269



>gb|KHN24577.1| hypothetical protein glysoja_014181 [Glycine soja]
Length=434

 Score =   246 bits (628),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A  L+  QI VLE+AVDVY  E ERF+ FI  VF NAPFFI+AE AGA+EA KN++Y+E
Sbjct  268  DANNLKMEQITVLEQAVDVYTMELERFLTFISEVFANAPFFISAEVAGALEARKNDDYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGKT+EV L+V+ +NSYIAWDFSL+QG++N+ DIGFS+E+   +G+KT +LPYRRY
Sbjct  328  INVPAGKTYEVLLSVDAVNSYIAWDFSLVQGKINM-DIGFSLEFVSPTGEKTLMLPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS  159
            ESDQGNFCT MAG+YKL+WDN+YS+FF KVLRYK+DCIPPV ES  S
Sbjct  387  ESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRYKIDCIPPVTESVQS  433


 Score = 77.8 bits (190),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYK  641
            RQINDD+GPMEEQRHRYGPPLYSLT M L+I+LFLSL W      N K
Sbjct  226  RQINDDDGPMEEQRHRYGPPLYSLTSMILSIQLFLSLSWARYDANNLK  273



>ref|XP_003521546.1| PREDICTED: uncharacterized protein LOC100778827 isoform 1 [Glycine 
max]
 gb|KHN42120.1| hypothetical protein glysoja_021610 [Glycine soja]
Length=434

 Score =   245 bits (625),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A KL+  QI VLE+AVDVY  E ERF+ FI  VF NAPFFI+AE AGA+EA KN++Y+E
Sbjct  268  DANKLKMEQIAVLEQAVDVYTMELERFLTFISEVFANAPFFISAEVAGALEARKNDDYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGKT+EV L+V+ +NSYIAWDFSL+QG +N+ DIGFS+E+   +G+KT +LPYRRY
Sbjct  328  INVPAGKTYEVLLSVDAVNSYIAWDFSLVQGTINM-DIGFSLEFLSPTGEKTLMLPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS  159
            ESDQGNFCT MAG+YKL+WDN+YS+FF KVLRYK+DCIPPV +S  S
Sbjct  387  ESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRYKIDCIPPVTDSVQS  433


 Score = 77.8 bits (190),  Expect(2) = 4e-79, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQRHRYGPPLYSLT M L+IRLFLSL W
Sbjct  226  RQINDDDGPMEEQRHRYGPPLYSLTSMILSIRLFLSLSW  264



>ref|XP_008370316.1| PREDICTED: uncharacterized protein LOC103433803 [Malus domestica]
Length=440

 Score =   248 bits (633),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 136/172 (79%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KL   ++ VLE+ VDVY +EF RFI FI  VF N+PFFI AE AGA++   N++YQE
Sbjct  269  ETRKLSKQELAVLEEVVDVYTTEFVRFITFISEVFANSPFFIPAEVAGALQGRNNDDYQE  328

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
             SV AGK HEVSL V+ INSYIAWDFSL+QG++NL DIGFS+EY + SG+K+ ILPYRR+
Sbjct  329  TSVPAGKIHEVSLAVDAINSYIAWDFSLVQGKINL-DIGFSVEYTNPSGQKSLILPYRRF  387

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ESDQGNFCTC AGNYKL+WDNSYSSFF KVLRYKVDCIPPV E    A + E
Sbjct  388  ESDQGNFCTCEAGNYKLIWDNSYSSFFKKVLRYKVDCIPPVTEPVEPATEAE  439


 Score = 74.3 bits (181),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQR RYGPPLYSLT MAL IRLF+SL W
Sbjct  227  RQINDDDGPMEEQRQRYGPPLYSLTTMALLIRLFISLSW  265



>ref|XP_008244213.1| PREDICTED: uncharacterized protein LOC103342365 [Prunus mume]
Length=440

 Score =   252 bits (643),  Expect(2) = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KL+  ++ VLE+A DVY +EFERFI FI  VF N+PFFI+AE AGA+E   N++Y+E
Sbjct  269  ETRKLKKEEVAVLEQAADVYTTEFERFITFISEVFANSPFFISAEVAGALEGRNNDDYKE  328

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AGKTHEVSL+V+ +NSYIAWDFSL+QG++NL DIGFS+EY + SG+K+ ILPYRR+
Sbjct  329  ISVPAGKTHEVSLSVDAVNSYIAWDFSLVQGKINL-DIGFSVEYTNPSGEKSLILPYRRF  387

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQ  150
            ESDQGNFCTC  GNYKL+WDNSYSSFF K LRYKVDCIPPV E  A A +
Sbjct  388  ESDQGNFCTCEVGNYKLLWDNSYSSFFKKALRYKVDCIPPVAEPVAPATE  437


 Score = 69.7 bits (169),  Expect(2) = 8e-79, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQR RYGPPLY LT M L IR+F+SL W
Sbjct  227  RQINDDDGPMEEQRQRYGPPLYRLTTMVLLIRVFISLSW  265



>ref|XP_007205211.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
 gb|EMJ06410.1| hypothetical protein PRUPE_ppa005889mg [Prunus persica]
Length=438

 Score =   251 bits (642),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KL+  ++ VLE+A DVY +EFERFI FI  VF N+PFFI+AE AGA+E   N++Y+E
Sbjct  266  ETRKLKKEEVAVLEQAADVYTTEFERFITFISEVFANSPFFISAEVAGALEGRNNDDYKE  325

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AGKTHEVSL+V+ INSYIAWDFSL+QG++NL DIGFS+EY + SG+K+ ILPYRR+
Sbjct  326  ISVPAGKTHEVSLSVDAINSYIAWDFSLVQGKINL-DIGFSVEYTNPSGEKSLILPYRRF  384

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASA  156
            ESDQGNFCTC  GNYKL+WDNSYSSFF K LRYKVDCIPPV E  A A
Sbjct  385  ESDQGNFCTCEVGNYKLLWDNSYSSFFKKALRYKVDCIPPVAEPVAPA  432


 Score = 70.1 bits (170),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQR RYGPPLY LT M L IR+F+SL W
Sbjct  224  RQINDDDGPMEEQRQRYGPPLYRLTTMVLLIRVFISLSW  262



>ref|XP_009370848.1| PREDICTED: uncharacterized protein LOC103960157 [Pyrus x bretschneideri]
Length=440

 Score =   247 bits (630),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 136/172 (79%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KL   ++ V E+AVDVY +EF RFI FI  VF N+PFFI AE AGA++   N++YQE
Sbjct  269  ETRKLSKQELVVFEEAVDVYTTEFVRFITFISEVFANSPFFIPAEVAGALQGRNNDDYQE  328

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
             SV AGK HEVSL V+ INSYIAWDFSL+QG++NL DIGFS+EY + SG+K+ ILPYRR+
Sbjct  329  TSVPAGKIHEVSLAVDAINSYIAWDFSLVQGKINL-DIGFSVEYTNPSGQKSLILPYRRF  387

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ESDQGNFCTC  GNYKL+WDNSYSSFF KVLRYKVDCIPPV E    A ++E
Sbjct  388  ESDQGNFCTCEVGNYKLIWDNSYSSFFKKVLRYKVDCIPPVTEPVEPATEVE  439


 Score = 74.3 bits (181),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQR RYGPPLYSLT MAL IRLF+SL W
Sbjct  227  RQINDDDGPMEEQRQRYGPPLYSLTTMALLIRLFISLSW  265



>ref|XP_003548341.1| PREDICTED: uncharacterized protein LOC100795582 isoform X1 [Glycine 
max]
Length=434

 Score =   242 bits (618),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A  L+  QI VLE+AVDVY  E ERF+ FI  VF NAPFFI+AE AGA+EA KN++Y+E
Sbjct  268  DANNLKMEQITVLEQAVDVYTMELERFLTFISEVFANAPFFISAEVAGALEARKNDDYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGKT+EV L+V+ +NSYIAWDFSL+QG++N+ DIGFS+E+   +G+KT +LPY RY
Sbjct  328  INVPAGKTYEVLLSVDAVNSYIAWDFSLVQGKINM-DIGFSLEFVSPTGEKTLMLPYGRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS  159
            ESDQGNFCT MAG+YKL+WDN+YS+FF KVLRYK+DCIPPV ES  S
Sbjct  387  ESDQGNFCTLMAGSYKLIWDNTYSTFFKKVLRYKIDCIPPVTESVQS  433


 Score = 77.8 bits (190),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYK  641
            RQINDD+GPMEEQRHRYGPPLYSLT M L+I+LFLSL W      N K
Sbjct  226  RQINDDDGPMEEQRHRYGPPLYSLTSMILSIQLFLSLSWARYDANNLK  273



>ref|XP_006429679.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 ref|XP_006481275.1| PREDICTED: uncharacterized protein LOC102624894 [Citrus sinensis]
 gb|ESR42919.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=438

 Score =   246 bits (629),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 142/172 (83%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A KL+ +Q+ +LE+AVDVY SEFE FIKFI  VF N+PFFI+AE AGA+E  KN+EY+E
Sbjct  268  DANKLKRHQVAILEQAVDVYTSEFESFIKFISGVFANSPFFISAEAAGALETRKNDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +++ AGK  EVS +V+ +NSYIAWDFS++QG+++  DIGFS+EY + SG+KT ILPYRR+
Sbjct  328  ITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKIS-TDIGFSLEYTNESGEKTLILPYRRH  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ESDQGNFCT + GNYKL+WDN+YS+FF KVLRY+VDCIPPVVE     N+ E
Sbjct  387  ESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLRYRVDCIPPVVEPMQPTNEAE  438


 Score = 73.2 bits (178),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQRHRYGPPLYSLT M + IRLFL L W
Sbjct  226  RQINDDDGPMEEQRHRYGPPLYSLTAMVIFIRLFLFLSW  264



>ref|XP_009337845.1| PREDICTED: uncharacterized protein LOC103930264 [Pyrus x bretschneideri]
Length=440

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ KL   ++ VLE+AVDVY +EFERFI FI  VF N+PFFI AE AGA+E   N++YQE
Sbjct  269  ESRKLNKQELAVLEEAVDVYTTEFERFITFISEVFANSPFFIPAEVAGALEGRNNDDYQE  328

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
             SV AGKTHEV L V+ INSYIAWDF+L+QG++NL DIGFS+EY +SSG+K+ ILPY+RY
Sbjct  329  TSVPAGKTHEVLLAVDAINSYIAWDFALVQGKINL-DIGFSVEYTNSSGEKSLILPYQRY  387

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            +SDQGNFCTC AGNYKL+WDNSYS+FF KVLR+KVDCIPPV ES   AN++E
Sbjct  388  DSDQGNFCTCEAGNYKLIWDNSYSNFFKKVLRFKVDCIPPVAESVQPANEVE  439


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMA  701
            RQINDD+GPMEEQR RYGPPLYSLT M 
Sbjct  227  RQINDDDGPMEEQRQRYGPPLYSLTTMV  254



>ref|XP_010653095.1| PREDICTED: uncharacterized protein LOC100243295 isoform X2 [Vitis 
vinifera]
 emb|CAQ58613.1| Unknown gene [Vitis vinifera]
Length=432

 Score =   245 bits (625),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL   Q+ VL +AVDVY SEFERFIKFI  VF N+PFFI+AEDAG IEA KN+EY+E
Sbjct  268  EARKLTKEQLTVLGQAVDVYTSEFERFIKFISEVFANSPFFISAEDAGPIEARKNDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +S+ AGKTHEVSL VE INSYIAWDFSL QG++N+ DIGFSMEY ++SG KT ILPYRRY
Sbjct  328  ISIPAGKTHEVSLMVESINSYIAWDFSLAQGKMNV-DIGFSMEYTNASGDKTLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDC  189
            ESDQGNFCTCMAGNYKL+WDNSYS+FF K L   +DC
Sbjct  387  ESDQGNFCTCMAGNYKLIWDNSYSTFFKKNLVVFLDC  423


 Score = 71.2 bits (173),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQ+NDDEGPMEEQR RYGPPLYSLT + L+IRLFL L W+  +
Sbjct  226  RQLNDDEGPMEEQRQRYGPPLYSLTTLVLSIRLFLFLSWRRFE  268



>ref|XP_004510081.1| PREDICTED: uncharacterized protein LOC101493369 isoform X1 [Cicer 
arietinum]
Length=434

 Score =   240 bits (612),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%), Gaps = 1/162 (1%)
 Frame = -3

Query  656  AGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEV  477
            A  LQ  Q+ VLE+AVDVY  EFERFI FI  VF N+PFFI A+ AGA+E  KN++Y+E 
Sbjct  269  AKTLQREQLAVLEQAVDVYTMEFERFITFISAVFANSPFFIPADVAGAMEVRKNDDYKET  328

Query  476  SVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYE  297
            SV AGKT+EV L+V+ +NSYIAWDFSL+QG++N+ DIGFS+E+   +G+KT +LPYRRYE
Sbjct  329  SVPAGKTYEVILSVDSVNSYIAWDFSLVQGKINM-DIGFSLEFSSPTGEKTLMLPYRRYE  387

Query  296  SDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            SDQGNFCT MAG+YKL+WDN++S+FF KVLRYKVDCIPPV E
Sbjct  388  SDQGNFCTLMAGSYKLIWDNTHSTFFRKVLRYKVDCIPPVTE  429


 Score = 75.9 bits (185),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQRHRYGPPLYSLT M L+IR FLSL W
Sbjct  226  RQINDDDGPMEEQRHRYGPPLYSLTSMILSIRFFLSLSW  264



>ref|XP_003626627.1| hypothetical protein MTR_8g005040 [Medicago truncatula]
 gb|ABE93045.1| Proteinase inhibitor I4, serpin; emp24/gp25L/p24 [Medicago truncatula]
 gb|AET01103.1| serpin, putative [Medicago truncatula]
Length=428

 Score =   239 bits (609),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ KL+G Q+ VLE+AVDVY  EFERFI F+  VF N+PFFI A+ AGA+E  KN++Y+E
Sbjct  262  ESKKLKGEQLAVLEQAVDVYTMEFERFITFLSGVFANSPFFIPADVAGAVEIRKNDDYKE  321

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AGKT EV L+V+ +NSYIAWDFSL+QG++N+ DIGFS+E+   +G+K  +LPYRRY
Sbjct  322  ISVPAGKTFEVILSVDSVNSYIAWDFSLVQGKINM-DIGFSLEFASPTGEKILMLPYRRY  380

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            ES+QGNFCT MAG+YKL+WDN++S+FF KVLRYKVDCIPPV E
Sbjct  381  ESEQGNFCTLMAGSYKLIWDNTHSTFFRKVLRYKVDCIPPVAE  423


 Score = 76.6 bits (187),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYKG  638
            RQINDD+GPMEEQRHRYGPPLY+LT M L++R FLSL W   + +  KG
Sbjct  220  RQINDDDGPMEEQRHRYGPPLYNLTSMILSVRFFLSLSWARYESKKLKG  268



>ref|XP_010278895.1| PREDICTED: uncharacterized protein LOC104612935 [Nelumbo nucifera]
Length=432

 Score =   244 bits (624),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 139/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KLQ NQ+ +LE+AV++Y SE ERFIKFIG VF N+PFFI+A+DAG+ EA ++++Y+E
Sbjct  268  EAKKLQKNQVAILEEAVNLYASELERFIKFIGEVFANSPFFISAQDAGSAEARRSDDYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
              + AGKT+EVSL VE INSYIAWDFSL QG+  + DIGFS+EY + SG+KT ILPYRRY
Sbjct  328  TIIPAGKTYEVSLMVESINSYIAWDFSLGQGKTAM-DIGFSVEYINPSGEKTMILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESS  165
            ESDQGNFCTCMAG YKL+WDNSYS+FF KVL YKVDCIPPV + +
Sbjct  387  ESDQGNFCTCMAGCYKLIWDNSYSTFFKKVLCYKVDCIPPVADPT  431


 Score = 67.4 bits (163),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQR RYGP LY LT M L+IRLFL L W
Sbjct  226  RQINDDQGPMEEQRQRYGPSLYCLTTMVLSIRLFLLLSW  264



>gb|KDO37186.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=172

 Score =   239 bits (611),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            + + +Q+ +LE+AVDVY SEFE FIKFI  VF N+PFFI+AE AGA+E  KN+EY+E+++
Sbjct  5    RRKRHQVAILEQAVDVYTSEFESFIKFISGVFANSPFFISAEAAGALETRKNDEYKEITI  64

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AGK  EVS +V+ +NSYIAWDFS++QG+++  DIGFS+EY + SG+KT ILPYRR+ESD
Sbjct  65   PAGKNFEVSFSVDSVNSYIAWDFSVVQGKIS-TDIGFSLEYTNESGEKTLILPYRRHESD  123

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            QGNFCT + GNYKL+WDN+YS+FF KVLRY+VDCIPPVVE     N+ E
Sbjct  124  QGNFCTVLVGNYKLLWDNTYSTFFKKVLRYRVDCIPPVVEPMQPTNEAE  172



>ref|XP_007134600.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
 gb|ESW06594.1| hypothetical protein PHAVU_010G060400g [Phaseolus vulgaris]
Length=445

 Score =   237 bits (605),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +  KL+  QI +LE+AVDVY +E +RF+ FI  VF NAPFFI+AE  GA+EA KN++Y+E
Sbjct  268  DTKKLKREQIAILEQAVDVYTTELKRFLTFISEVFANAPFFISAEVVGALEARKNDDYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +++ AGKT+EV L+V+ +NSYIAWDFSL+QG++N+ DIGFS+E+   +G+KT +LP RRY
Sbjct  328  INIPAGKTYEVLLSVDVVNSYIAWDFSLVQGKINM-DIGFSLEFVSPTGEKTLMLPSRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS-ANQLEG  141
            ESDQGNFCT MAG+YKL+WDN+YS+FF KV+RYK+DCIPPV E   S +N+ EG
Sbjct  387  ESDQGNFCTLMAGSYKLIWDNTYSTFFKKVIRYKIDCIPPVTEPVQSDSNKNEG  440


 Score = 74.7 bits (182),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 5/50 (10%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW-----QHLKRE  650
            RQINDD+GPMEEQR RYGPPLYSLT M L++RLFLS+ W     + LKRE
Sbjct  226  RQINDDDGPMEEQRQRYGPPLYSLTSMILSVRLFLSISWARYDTKKLKRE  275



>ref|XP_008793389.1| PREDICTED: uncharacterized protein LOC103709697 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   234 bits (598),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ KL+ +Q+ ++++AV VY SE E+FIKFIG VF N+PF I+AEDAGA E+ K++EY+E
Sbjct  268  ESRKLEMDQVSIIQQAVHVYTSELEKFIKFIGEVFANSPFLISAEDAGAAESRKSDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
              +  GKTHEV LTVE +NSYIAWDF+LIQG L+L DIGF +EY   SG+ T ILPY+RY
Sbjct  328  TMIPPGKTHEVILTVESVNSYIAWDFALIQGTLSL-DIGFRVEYVSPSGEITMILPYQRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
            ESDQGNFCT +AG+YKL+WDNSYS+FF K LRYKVD IPPVVES
Sbjct  387  ESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRYKVDAIPPVVES  430


 Score = 76.3 bits (186),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQRHRYGPPLYSLTKM L+IRLFL L W
Sbjct  226  RQINDDKGPMEEQRHRYGPPLYSLTKMVLSIRLFLLLSW  264



>gb|EPS68255.1| hypothetical protein M569_06516, partial [Genlisea aurea]
Length=463

 Score =   238 bits (607),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 140/196 (71%), Gaps = 34/196 (17%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E   L+ N   VLE+A ++Y +EFER+IKFIG VF+N+PFFITA++AGA+ A KNEEY+E
Sbjct  268  ENKALESNHFSVLEEASNLYTTEFERYIKFIGEVFLNSPFFITADEAGALAARKNEEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL-------------------------  375
            +S+AAG+THEV+L V+ INSY+AWDFSL+QG+++L                         
Sbjct  328  ISIAAGETHEVTLNVDSINSYVAWDFSLVQGKMSLVCFFFFFGFPIFAEVLFWDHCVLAS  387

Query  374  ---------QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSF  222
                     QD+GFS+E  D SGK T ILPYRRYE+DQGNFC C+ GNYKL+WDNSY++F
Sbjct  388  FGNEYYFFRQDVGFSIECTDLSGKTTKILPYRRYEADQGNFCACLLGNYKLIWDNSYAAF  447

Query  221  FSKVLRYKVDCIPPVV  174
            F KVLRYKVDCIPPVV
Sbjct  448  FRKVLRYKVDCIPPVV  463


 Score = 71.6 bits (174),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD GPMEEQR RYGPPLYSLT+ A  IRLF+ LLW  L+
Sbjct  226  RQINDDHGPMEEQRQRYGPPLYSLTRTAHIIRLFIFLLWSQLE  268



>ref|XP_002323111.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
 gb|EEF04872.2| hypothetical protein POPTR_0016s15030g [Populus trichocarpa]
Length=435

 Score =   241 bits (616),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +Q+ VLE+AVDVY  EF RFI FI  VF N+PFFI+AE AGA+EA  N++Y+E
Sbjct  264  EAKKLTRDQVAVLEQAVDVYTYEFRRFITFISEVFANSPFFISAEAAGALEAGNNDDYKE  323

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGKT+EVSL+VE +NSYIAWDFSLIQG++N+ DIGFS+E  D +GKKT ILPYRRY
Sbjct  324  INVPAGKTYEVSLSVESVNSYIAWDFSLIQGKINM-DIGFSVECTDPTGKKTLILPYRRY  382

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ESDQGNF TC++GNYKL+WDNSYS+FF KVLRYKVDCIPPVVE   SA ++E
Sbjct  383  ESDQGNFSTCVSGNYKLIWDNSYSAFFKKVLRYKVDCIPPVVEPVQSAGEME  434


 Score = 67.0 bits (162),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD GPMEEQR RYGP LYSLT M L IRLF+ L W
Sbjct  222  RQINDDNGPMEEQRQRYGPSLYSLTAMVLLIRLFIQLAW  260



>ref|XP_010673452.1| PREDICTED: uncharacterized protein LOC104889827 [Beta vulgaris 
subsp. vulgaris]
Length=428

 Score =   231 bits (589),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A K+  +++ +LE+AV++Y +EFERFIKF+G VF N+PFFI+A++ GAI+ S+N++Y+E
Sbjct  264  DANKITADELIILEQAVNIYTTEFERFIKFMGEVFANSPFFISADEVGAID-SRNDDYKE  322

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            + + AG THEV L+V+ +NSYIAWDF+L Q ++ L DIGFS+E  +SSG+KT ILPYRR 
Sbjct  323  IGIPAGTTHEVVLSVDSVNSYIAWDFTLEQSKMKL-DIGFSVECTNSSGEKTLILPYRRC  381

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESS  165
            ESDQGNFCTCMAG YKL+WDNSYS+FF K L YKVDCIPPVVE +
Sbjct  382  ESDQGNFCTCMAGTYKLIWDNSYSTFFRKALLYKVDCIPPVVEPA  426


 Score = 75.9 bits (185),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQ  665
            RQINDD+GPMEEQR RYGPPLYSLTKM L IR+F+ L+W+
Sbjct  222  RQINDDDGPMEEQRQRYGPPLYSLTKMVLTIRIFIFLMWE  261



>ref|XP_009125386.1| PREDICTED: uncharacterized protein LOC103850397 [Brassica rapa]
 emb|CDY04819.1| BnaAnng00010D [Brassica napus]
Length=440

 Score =   227 bits (579),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL   Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + + +NEEY+E+ V
Sbjct  271  KLNKEQMNLLSEAAIVYTSEFERFVAFISDVFANSPFFISADAAGILGSRENEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+EVSL VE  NSYI WDFSL+QG++++ DIGFS+EY  +SG+KT ILPYRRYE+D
Sbjct  331  QAGRTYEVSLMVESENSYIGWDFSLMQGKISM-DIGFSVEYISASGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCIPPVVE
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIPPVVE  429


 Score = 78.6 bits (192),  Expect(2) = 7e-74, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLY+LTKMA  IR+FL+LLWQ 
Sbjct  226  RQINDDDGPMEEQRQRYGPPLYTLTKMATAIRVFLTLLWQR  266



>ref|XP_010496822.1| PREDICTED: uncharacterized protein LOC104773850 [Camelina sativa]
Length=434

 Score =   228 bits (580),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  271  KLSRDQMNLLSEASIVYTSEFERFVTFISDVFANSPFFISADTAGILGSRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+EVSL VE  NSYIAWDFSL+QG++++ DIGFS+EY  +SG+KT ILPYRRYE+D
Sbjct  331  QAGRTYEVSLMVESENSYIAWDFSLMQGKISM-DIGFSVEYIGASGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNF T MAGNYKLVWDNSYS+FF+K LRYKVDCIPPVVE
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFNKTLRYKVDCIPPVVE  429


 Score = 77.0 bits (188),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FLSLLW  
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVMAIRVFLSLLWDR  266



>gb|KFK24699.1| hypothetical protein AALP_AA8G013300 [Arabis alpina]
Length=427

 Score =   228 bits (581),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + + +NEEY+E+ V
Sbjct  266  KLNRDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILGSRENEEYKEIIV  325

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+EVSL VE  NSYIAWDFSL+QG++++ DIGFS+EY  ++G+KT ILPYRRYE+D
Sbjct  326  QAGRTYEVSLMVESENSYIAWDFSLMQGKMSM-DIGFSVEYISATGEKTLILPYRRYEAD  384

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESS  165
            QGNF T MAGNYKLVWDNS+S+FF K LRYKVDCIPPVVE S
Sbjct  385  QGNFSTLMAGNYKLVWDNSFSTFFKKTLRYKVDCIPPVVEPS  426


 Score = 76.3 bits (186),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTK+ + IR+FL+LLW+ 
Sbjct  221  RQINDDDGPMEEQRERYGPPLYSLTKLVMTIRVFLTLLWER  261



>ref|XP_010490477.1| PREDICTED: uncharacterized protein LOC104768250 isoform X2 [Camelina 
sativa]
Length=434

 Score =   226 bits (577),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  271  KLSRDQMNLLSEASIVYTSEFERFVTFISDVFANSPFFISADTAGILGSRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+EVSL VE  NSYIAWDFSL+QG++++ DIGFS+EY  +SG++T ILPYRRYE+D
Sbjct  331  QAGRTYEVSLMVESENSYIAWDFSLMQGKISM-DIGFSVEYISASGEQTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCIPPVVE
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIPPVVE  429


 Score = 77.0 bits (188),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FLSLLW  
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVMAIRVFLSLLWDR  266



>ref|NP_195721.5| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42982.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43305.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43143.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43301.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43345.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43526.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43539.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43565.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43716.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43767.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43772.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43786.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43808.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44005.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44013.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44023.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44099.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44270.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44410.1| unknown protein [Arabidopsis thaliana]
 gb|AED90282.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=438

 Score =   226 bits (575),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  271  KLSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+E+SL VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT ILPYRRYE+D
Sbjct  331  QAGRTYEISLMVESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCI PVVE
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIAPVVE  429


 Score = 77.4 bits (189),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FL+LLW+ 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWER  266



>dbj|BAD43433.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43633.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43683.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43717.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43821.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   226 bits (575),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  271  KLSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+E+SL VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT ILPYRRYE+D
Sbjct  331  QAGRTYEISLMVESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCI PVVE
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIAPVVE  429


 Score = 77.0 bits (188),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FL+LLW+ 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWER  266



>dbj|BAD43927.1| unnamed protein product [Arabidopsis thaliana]
Length=358

 Score =   226 bits (575),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  191  KLSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIV  250

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+E+SL VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT ILPYRRYE+D
Sbjct  251  QAGRTYEISLMVESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTLILPYRRYEAD  309

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCI PVVE
Sbjct  310  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIAPVVE  349


 Score = 77.4 bits (189),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FL+LLW+ 
Sbjct  146  RQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWER  186



>ref|XP_007032241.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY03167.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=422

 Score =   228 bits (581),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 132/173 (76%), Gaps = 18/173 (10%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +QI VLE+AVDVY SEFERFI FI  VF N+PFFI+AEDA   E  K++EY E
Sbjct  268  EAFKLNRHQISVLEEAVDVYTSEFERFINFISEVFANSPFFISAEDASMFETRKSDEYNE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGK++EVSL VE INSYIAWDFSL+QG++N+                  ILPYRRY
Sbjct  328  ITVPAGKSYEVSLAVESINSYIAWDFSLVQGKMNML-----------------ILPYRRY  370

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLEG  141
            ESDQGNF TCMAG+YKL+WDNSYS+FF K LRYKVDCIPPV++ SA +N++EG
Sbjct  371  ESDQGNFSTCMAGHYKLIWDNSYSTFFKKALRYKVDCIPPVLD-SAESNEVEG  422


 Score = 74.7 bits (182),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLY+LTK  L IRLFLSL WQ  +
Sbjct  226  RQINDDDGPMEEQRQRYGPPLYNLTKTVLIIRLFLSLAWQRFE  268



>ref|XP_010490476.1| PREDICTED: uncharacterized protein LOC104768250 isoform X1 [Camelina 
sativa]
 ref|XP_010490478.1| PREDICTED: uncharacterized protein LOC104768250 isoform X3 [Camelina 
sativa]
Length=434

 Score =   226 bits (577),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  271  KLSRDQMNLLSEASIVYTSEFERFVTFISDVFANSPFFISADTAGILGSRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+EVSL VE  NSYIAWDFSL+QG++++ DIGFS+EY  +SG++T ILPYRRYE+D
Sbjct  331  QAGRTYEVSLMVESENSYIAWDFSLMQGKISM-DIGFSVEYISASGEQTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCIPPVVE
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIPPVVE  429


 Score = 75.9 bits (185),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTK+ + IR+FLSLLW  
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKLVMAIRVFLSLLWDR  266



>ref|XP_006279346.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
 gb|EOA12244.1| hypothetical protein CARUB_v10012733mg [Capsella rubella]
Length=434

 Score =   229 bits (583),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG +    NEEY+E+ V
Sbjct  271  KLSRDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILGPRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+EVSL VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT ILPYRR+E+D
Sbjct  331  QAGRTYEVSLMVESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTLILPYRRFEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS  159
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCIPPVVE   S
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIPPVVEPEPS  433


 Score = 73.6 bits (179),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+ L+L+W+ 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVMAIRVLLTLMWER  266



>ref|XP_006599750.1| PREDICTED: uncharacterized protein LOC100795582 isoform X2 [Glycine 
max]
Length=408

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -3

Query  647  LQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSVA  468
            L+  QI VLE+AVDVY  E ERF+ FI  VF NAPFFI+AE AGA+EA KN++Y+E++V 
Sbjct  246  LKMEQITVLEQAVDVYTMELERFLTFISEVFANAPFFISAEVAGALEARKNDDYKEINVP  305

Query  467  AGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESDQ  288
            AGKT+EV L+V+ +NSYIAWDFSL+QG++N+ DIGFS+E+   +G+KT +LPY RYESDQ
Sbjct  306  AGKTYEVLLSVDAVNSYIAWDFSLVQGKINM-DIGFSLEFVSPTGEKTLMLPYGRYESDQ  364

Query  287  GNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS  159
            GNFCT MAG+YKL+WDN+YS+FF KVLRYK+DCIPPV ES  S
Sbjct  365  GNFCTLMAGSYKLIWDNTYSTFFKKVLRYKIDCIPPVTESVQS  407


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPL  722
            RQINDD+GPMEEQRHRYGPPL
Sbjct  226  RQINDDDGPMEEQRHRYGPPL  246



>dbj|BAD43795.1| unknown protein [Arabidopsis thaliana]
Length=438

 Score =   226 bits (575),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  271  KLSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+E+SL VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT ILPYRRYE+D
Sbjct  331  QAGRTYEISLMVESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCI PVVE
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIAPVVE  429


 Score = 76.6 bits (187),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FL++LW+ 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTVLWER  266



>dbj|BAD43397.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43553.1| unnamed protein product, partial [Arabidopsis thaliana]
Length=282

 Score =   224 bits (572),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  115  KLSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIV  174

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+E+SL VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT ILPYRRYE+D
Sbjct  175  QAGRTYEISLMVESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTLILPYRRYEAD  233

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCI PVVE
Sbjct  234  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIAPVVE  273


 Score = 77.4 bits (189),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FL+LLW+ 
Sbjct  70   RQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWER  110



>ref|XP_006398547.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ40000.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=432

 Score =   226 bits (575),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL   Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + + +NEEY+E+ V
Sbjct  271  KLNKEQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILGSRENEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+EVSL VE  NSYI WDFSL+QG++++ DIGFS+EY  +SG+KT ILPYRRYE+D
Sbjct  331  QAGRTYEVSLMVESENSYIGWDFSLMQGKISM-DIGFSVEYISASGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESS  165
            QGNF T MAGNYKLVWDN+YS+FF K LRYKVDCIPPVV+ +
Sbjct  390  QGNFSTLMAGNYKLVWDNAYSTFFKKTLRYKVDCIPPVVQPT  431


 Score = 76.3 bits (186),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM   IR+FL+LLW+ 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVTAIRVFLTLLWER  266



>gb|KJB27580.1| hypothetical protein B456_005G0011001, partial [Gossypium raimondii]
Length=279

 Score =   225 bits (573),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL   QI VLE+AVDVY +E +RFI FI  VF N+PFFI+AEDA  +E  KN+EY+E
Sbjct  127  EAFKLNRLQISVLEEAVDVYTTELQRFINFISEVFANSPFFISAEDASMLEMGKNDEYKE  186

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGK++EVSLTVE INSYIAWDFSL+QG++N+ DIGFS+EY ++ G+KT ILPYRRY
Sbjct  187  ITVPAGKSYEVSLTVESINSYIAWDFSLVQGKMNM-DIGFSVEYTNNGGEKTLILPYRRY  245

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKV  210
            ESDQGNF TCMAGNYKL+WDNSYS+FF KV
Sbjct  246  ESDQGNFSTCMAGNYKLIWDNSYSAFFKKV  275


 Score = 75.9 bits (185),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLYSLT+M L I LFLSL WQ  +
Sbjct  85   RQINDDDGPMEEQRQRYGPPLYSLTRMVLFIHLFLSLAWQRFE  127



>ref|XP_010036049.1| PREDICTED: uncharacterized protein LOC104425150 [Eucalyptus grandis]
 gb|KCW47571.1| hypothetical protein EUGRSUZ_K01318 [Eucalyptus grandis]
Length=439

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KL+G+++  LE+A++VY SEFERFIKF+  VFVN+PFFI+A +AGA+EA +N++Y+E
Sbjct  268  ETRKLKGDELSALEQALNVYTSEFERFIKFLSEVFVNSPFFISAAEAGALEAGQNDDYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +S+ AGK HEVS  V+ +NSYIAWDFSL+QG++NL DIGFS+E    SG+KT ILPYRRY
Sbjct  328  ISIPAGKIHEVSFMVDSLNSYIAWDFSLVQGKINL-DIGFSVECISPSGEKTLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLEG  141
            ESDQGNFCTC+AGNYKLVWDNSYS+FF K LRYKVDCIPPVVE   S ++ E 
Sbjct  387  ESDQGNFCTCIAGNYKLVWDNSYSTFFKKALRYKVDCIPPVVEPVQSMSEEEA  439


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYKGIKYLFWKKQWM  605
            +QINDD+GPMEEQR RYGPPLYSLT + L IRLFLSL W   +    KG + L   +Q +
Sbjct  226  KQINDDDGPMEEQRQRYGPPLYSLTSLVLFIRLFLSLSWGRFETRKLKGDE-LSALEQAL  284

Query  604  SMYLS  590
            ++Y S
Sbjct  285  NVYTS  289



>ref|XP_008649464.1| PREDICTED: uncharacterized protein LOC103630158 isoform X2 [Zea 
mays]
Length=499

 Score =   237 bits (604),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K++ +   VL++AV +Y  EF +F +FIG VFVNAPFFI+AEDAGA++A K++EY+E  +
Sbjct  333  KIEKDDAAVLQQAVVIYTKEFLKFTEFIGEVFVNAPFFISAEDAGAVDARKSDEYKETII  392

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AGKTHEV L+VE +NSYIAWDFSL QG LN+ DIGF +EY   SG+KT ILPYRRYE+D
Sbjct  393  PAGKTHEVILSVEAVNSYIAWDFSLQQGALNM-DIGFHVEYISPSGEKTLILPYRRYEAD  451

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQL  147
            QGNFCT  +G+YKLVWDNSYSSFF KVLRYKVD +PPVVE + SA +L
Sbjct  452  QGNFCTVSSGSYKLVWDNSYSSFFKKVLRYKVDAVPPVVEPALSATEL  499


 Score = 62.8 bits (151),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQINDD GPMEEQR RYGP LY+LTK+ L IRL+L +
Sbjct  288  RQINDDNGPMEEQRERYGPALYTLTKLVLAIRLYLHV  324



>ref|XP_010921251.1| PREDICTED: uncharacterized protein LOC105044884 isoform X2 [Elaeis 
guineensis]
Length=438

 Score =   234 bits (596),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ +LQ +Q+ V+++AV VY SEFE+FIKFIG VF N+PF ++AED GA E+ K++EY+E
Sbjct  268  ESRELQMDQLSVVQQAVHVYNSEFEKFIKFIGEVFANSPFLMSAEDVGAAESRKSDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            + +  GKTHEV LTVE +NSYIAWDF+LIQG LNL DIGF +EY   SG+ T ILPYRRY
Sbjct  328  IIIPPGKTHEVVLTVESVNSYIAWDFALIQGTLNL-DIGFHVEYLSPSGEITLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
            ESDQGNFCT + G+YKL+WDNSYS+FF K LRYKVD +PPVVE+
Sbjct  387  ESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYKVDAVPPVVET  430


 Score = 65.5 bits (158),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GP+EEQR RYGP L SLTKM L+IRLF+ L W
Sbjct  226  RQINDDQGPLEEQRERYGPALCSLTKMVLSIRLFILLSW  264



>ref|XP_008649463.1| PREDICTED: uncharacterized protein LOC103630158 isoform X1 [Zea 
mays]
Length=501

 Score =   236 bits (603),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K++ +   VL++AV +Y  EF +F +FIG VFVNAPFFI+AEDAGA++A K++EY+E  +
Sbjct  333  KIEKDDAAVLQQAVVIYTKEFLKFTEFIGEVFVNAPFFISAEDAGAVDARKSDEYKETII  392

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL-QDIGFSMEYEDSSGKKTPILPYRRYES  294
             AGKTHEV L+VE +NSYIAWDFSL QG LN+  DIGF +EY   SG+KT ILPYRRYE+
Sbjct  393  PAGKTHEVILSVEAVNSYIAWDFSLQQGALNMVLDIGFHVEYISPSGEKTLILPYRRYEA  452

Query  293  DQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQL  147
            DQGNFCT  +G+YKLVWDNSYSSFF KVLRYKVD +PPVVE + SA +L
Sbjct  453  DQGNFCTVSSGSYKLVWDNSYSSFFKKVLRYKVDAVPPVVEPALSATEL  501


 Score = 62.8 bits (151),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFL  680
            RQINDD GPMEEQR RYGP LY+LTK+ L IRL+L
Sbjct  288  RQINDDNGPMEEQRERYGPALYTLTKLVLAIRLYL  322



>ref|XP_010938084.1| PREDICTED: uncharacterized protein LOC105057244 isoform X1 [Elaeis 
guineensis]
Length=438

 Score =   230 bits (586),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 131/163 (80%), Gaps = 1/163 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ K Q +Q+ VL++AV VY SE E+FI+FIG V  N+PF I+AEDAGA ++ K+ EY+E
Sbjct  268  ESRKPQMDQVSVLQQAVHVYTSELEKFIQFIGEVVANSPFLISAEDAGAADSRKSVEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
              +  GKTHEV LTVE +NSYIAWDF+LIQG L+L DIGF MEY   SG+ T ILPYRRY
Sbjct  328  TIIPPGKTHEVILTVESVNSYIAWDFALIQGTLSL-DIGFRMEYVSPSGEVTLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            ESDQGNFCT +AG+YKL+WDNSYS+FF K LRYKVD IPPVVE
Sbjct  387  ESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRYKVDAIPPVVE  429


 Score = 68.6 bits (166),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGP LY LTKM L IRLFL L W+  +
Sbjct  226  RQINDDDGPMEEQRQRYGPALYGLTKMVLFIRLFLLLSWERFE  268



>ref|XP_007032239.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY03165.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score =   223 bits (568),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 129/158 (82%), Gaps = 2/158 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +QI VLE+AVDVY SEFERFI FI  VF N+PFFI+AEDA   E  K++EY E
Sbjct  268  EAFKLNRHQISVLEEAVDVYTSEFERFINFISEVFANSPFFISAEDASMFETRKSDEYNE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGK++EVSL VE INSYIAWDFSL+QG++N+ DIGFS+EY ++ G+KT ILPYRRY
Sbjct  328  ITVPAGKSYEVSLAVESINSYIAWDFSLVQGKMNM-DIGFSVEYTNTVGEKTLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCI  186
            ESDQGNF TCMAG+YKL+WDNSYS+FF K LR    C+
Sbjct  387  ESDQGNFSTCMAGHYKLIWDNSYSTFFKK-LRTFCGCL  423


 Score = 75.1 bits (183),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLY+LTK  L IRLFLSL WQ  +
Sbjct  226  RQINDDDGPMEEQRQRYGPPLYNLTKTVLIIRLFLSLAWQRFE  268



>ref|XP_010921253.1| PREDICTED: uncharacterized protein LOC105044884 isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   231 bits (589),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 136/174 (78%), Gaps = 10/174 (6%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ +LQ +Q+ V+++AV VY SEFE+FIKFIG VF N+PF ++AED GA E+ K++EY+E
Sbjct  215  ESRELQMDQLSVVQQAVHVYNSEFEKFIKFIGEVFANSPFLMSAEDVGAAESRKSDEYKE  274

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL----------QDIGFSMEYEDSSGK  330
            + +  GKTHEV LTVE +NSYIAWDF+LIQG LNL          +DIGF +EY   SG+
Sbjct  275  IIIPPGKTHEVVLTVESVNSYIAWDFALIQGTLNLVISETPGEIIRDIGFHVEYLSPSGE  334

Query  329  KTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
             T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRYKVD +PPVVE+
Sbjct  335  ITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYKVDAVPPVVET  388


 Score = 66.2 bits (160),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GP+EEQR RYGP L SLTKM L+IRLF+ L W
Sbjct  173  RQINDDQGPLEEQRERYGPALCSLTKMVLSIRLFILLSW  211



>ref|XP_009130613.1| PREDICTED: uncharacterized protein LOC103855392 isoform X1 [Brassica 
rapa]
Length=432

 Score =   230 bits (586),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  NQ+ +L +AV VY SEFERFI FI +VF N+PFFI+A+ AG + + +NEEY+E+ V
Sbjct  271  KLNKNQMNLLSEAVIVYTSEFERFITFISDVFANSPFFISADTAGTLGSRENEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+EVSL VE  NSYIAWDFSL+QG++++ DIGF +EY  +SG+KT ILPY RYE+D
Sbjct  331  QAGRTYEVSLMVESENSYIAWDFSLVQGKISM-DIGFCVEYISASGEKTLILPYHRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESS  165
            QGNF T MAGNYKLVWDNSYS+FF K LRYKVDCIPPVVE +
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIPPVVEPT  431


 Score = 67.0 bits (162),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQ  665
            RQINDD+GPMEEQR RYGP LY+LTKM   IR+ L+LLW+
Sbjct  226  RQINDDDGPMEEQRERYGPHLYNLTKMVTAIRVSLTLLWE  265



>ref|XP_010921254.1| PREDICTED: uncharacterized protein LOC105044884 isoform X4 [Elaeis 
guineensis]
Length=362

 Score =   231 bits (588),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 136/174 (78%), Gaps = 10/174 (6%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ +LQ +Q+ V+++AV VY SEFE+FIKFIG VF N+PF ++AED GA E+ K++EY+E
Sbjct  181  ESRELQMDQLSVVQQAVHVYNSEFEKFIKFIGEVFANSPFLMSAEDVGAAESRKSDEYKE  240

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL----------QDIGFSMEYEDSSGK  330
            + +  GKTHEV LTVE +NSYIAWDF+LIQG LNL          +DIGF +EY   SG+
Sbjct  241  IIIPPGKTHEVVLTVESVNSYIAWDFALIQGTLNLVISETPGEIIRDIGFHVEYLSPSGE  300

Query  329  KTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
             T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRYKVD +PPVVE+
Sbjct  301  ITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYKVDAVPPVVET  354


 Score = 65.9 bits (159),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GP+EEQR RYGP L SLTKM L+IRLF+ L W
Sbjct  139  RQINDDQGPLEEQRERYGPALCSLTKMVLSIRLFILLSW  177



>ref|XP_010921250.1| PREDICTED: uncharacterized protein LOC105044884 isoform X1 [Elaeis 
guineensis]
Length=449

 Score =   231 bits (588),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 136/174 (78%), Gaps = 10/174 (6%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ +LQ +Q+ V+++AV VY SEFE+FIKFIG VF N+PF ++AED GA E+ K++EY+E
Sbjct  268  ESRELQMDQLSVVQQAVHVYNSEFEKFIKFIGEVFANSPFLMSAEDVGAAESRKSDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL----------QDIGFSMEYEDSSGK  330
            + +  GKTHEV LTVE +NSYIAWDF+LIQG LNL          +DIGF +EY   SG+
Sbjct  328  IIIPPGKTHEVVLTVESVNSYIAWDFALIQGTLNLVISETPGEIIRDIGFHVEYLSPSGE  387

Query  329  KTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
             T ILPYRRYESDQGNFCT + G+YKL+WDNSYS+FF K LRYKVD +PPVVE+
Sbjct  388  ITLILPYRRYESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYKVDAVPPVVET  441


 Score = 65.9 bits (159),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GP+EEQR RYGP L SLTKM L+IRLF+ L W
Sbjct  226  RQINDDQGPLEEQRERYGPALCSLTKMVLSIRLFILLSW  264



>dbj|BAH57023.1| AT5G01010 [Arabidopsis thaliana]
Length=448

 Score =   218 bits (555),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 132/170 (78%), Gaps = 11/170 (6%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  271  KLSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTP----------  321
             AG+T+E+SL VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT           
Sbjct  331  QAGRTYEISLMVESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTVSLLINFQTLL  389

Query  320  ILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF K LRYKVDCI PVVE
Sbjct  390  ILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCIAPVVE  439


 Score = 77.4 bits (189),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FL+LLW+ 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWER  266



>ref|XP_008782731.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782732.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782733.1| PREDICTED: uncharacterized protein LOC103702180 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   229 bits (583),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ KLQ +Q+ V+++AV VY SEFE+FIK I  VF N+PF ++AED G  E+ K++EY+E
Sbjct  268  ESRKLQMDQVSVVQQAVHVYNSEFEKFIKVISEVFANSPFLVSAEDVGTAESRKSDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
              +  GKTHEV LTVE +NSYIAWDF+LIQG LNL DIGF +EY   SG+ T ILPYRRY
Sbjct  328  TIIPPGKTHEVVLTVESVNSYIAWDFALIQGTLNL-DIGFHVEYVSPSGEITLILPYRRY  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
            ESDQGNFCT + G+YKL+WDNSYS+FF K LRYKVD +PPVVE+
Sbjct  387  ESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYKVDAVPPVVET  430


 Score = 66.2 bits (160),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GP+EEQR RYGP L SLTK+AL+IRLF+ L W
Sbjct  226  RQINDDQGPLEEQRQRYGPALCSLTKLALSIRLFMLLSW  264



>ref|XP_008782734.1| PREDICTED: uncharacterized protein LOC103702180 isoform X2 [Phoenix 
dactylifera]
Length=312

 Score =   228 bits (582),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ KLQ +Q+ V+++AV VY SEFE+FIK I  VF N+PF ++AED G  E+ K++EY+E
Sbjct  142  ESRKLQMDQVSVVQQAVHVYNSEFEKFIKVISEVFANSPFLVSAEDVGTAESRKSDEYKE  201

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
              +  GKTHEV LTVE +NSYIAWDF+LIQG LNL DIGF +EY   SG+ T ILPYRRY
Sbjct  202  TIIPPGKTHEVVLTVESVNSYIAWDFALIQGTLNL-DIGFHVEYVSPSGEITLILPYRRY  260

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
            ESDQGNFCT + G+YKL+WDNSYS+FF K LRYKVD +PPVVE+
Sbjct  261  ESDQGNFCTILVGSYKLIWDNSYSTFFKKSLRYKVDAVPPVVET  304


 Score = 66.6 bits (161),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GP+EEQR RYGP L SLTK+AL+IRLF+ L W
Sbjct  100  RQINDDQGPLEEQRQRYGPALCSLTKLALSIRLFMLLSW  138



>ref|XP_004147520.1| PREDICTED: uncharacterized protein LOC101218161 [Cucumis sativus]
 gb|KGN53967.1| hypothetical protein Csa_4G197820 [Cucumis sativus]
Length=436

 Score =   232 bits (591),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +AGKL+   + +LE+AVDVY SE ERF+ FI  VF NAPFFI+A+ A A    K++ Y+E
Sbjct  268  DAGKLR-EHLGILEQAVDVYTSEIERFLGFIREVFNNAPFFISADVACAANERKSDSYKE  326

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AGKT+EVSL+VE INSYIAWDFSL+QG++N+ DIGFS+E E   G K  ILP++RY
Sbjct  327  ISVPAGKTYEVSLSVESINSYIAWDFSLVQGKMNM-DIGFSVECESPGGVKRLILPHKRY  385

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASA  156
            ESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRYKVDCIPPVVE    A
Sbjct  386  ESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRYKVDCIPPVVEPVQPA  433


 Score = 62.0 bits (149),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHL  659
            ++INDD+GPMEEQR RYGPPLY LT M   IRL +SL W+  
Sbjct  226  QKINDDDGPMEEQRQRYGPPLYKLTTMVRLIRLCISLSWRRF  267



>ref|XP_009391656.1| PREDICTED: uncharacterized protein LOC103977773 [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   221 bits (562),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKN-EEYQ  483
            E  K+Q +QI +++ AVD+Y  EFE+FIKFI  V+ N+PFFI AEDAGA E+ K+ ++Y+
Sbjct  269  EEKKIQMDQISLMQHAVDLYTHEFEKFIKFISKVYANSPFFIRAEDAGATESRKSYDDYK  328

Query  482  EVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRR  303
            E  +  GKTHE++LTVE INSYIAWDFSLIQG L+  DIGF +EY + SG  T ILPYRR
Sbjct  329  ETIIPPGKTHEITLTVESINSYIAWDFSLIQGTLS-HDIGFHVEYVNPSGDVTLILPYRR  387

Query  302  YESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
            Y SDQGNFCT +AG+YKL WDNSYS+F  K LRYKVD +PPVV++
Sbjct  388  YVSDQGNFCTILAGSYKLKWDNSYSTFSKKSLRYKVDAVPPVVDT  432


 Score = 73.2 bits (178),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQR RYGP LYSLTKM LNIRLFL L W
Sbjct  227  RQINDDQGPMEEQRQRYGPSLYSLTKMVLNIRLFLLLTW  265



>ref|XP_006429676.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42916.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=424

 Score =   219 bits (558),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A KL+ +Q+ +LE+AVDVY SEFE FIKFI  VF N+PFFI+AE AGA+E  KN+EY+E
Sbjct  268  DANKLKRHQVAILEQAVDVYTSEFESFIKFISGVFANSPFFISAEAAGALETRKNDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +++ AGK  EVS +V+ +NSYIAWDFS++QG+++  DIGFS+EY + SG+KT ILPYRR+
Sbjct  328  ITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKIS-TDIGFSLEYTNESGEKTLILPYRRH  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLR  204
            ESDQGNFCT + GNYKL+WDN+YS+FF KVLR
Sbjct  387  ESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLR  418


 Score = 73.2 bits (178),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQRHRYGPPLYSLT M + IRLFL L W
Sbjct  226  RQINDDDGPMEEQRHRYGPPLYSLTAMVIFIRLFLFLSW  264



>ref|XP_006429677.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42917.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=422

 Score =   219 bits (558),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 129/172 (75%), Gaps = 17/172 (10%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A KL+ +Q+ +LE+AVDVY SEFE FIKFI  VF N+PFFI+AE AGA+E  KN+EY+E
Sbjct  268  DANKLKRHQVAILEQAVDVYTSEFESFIKFISGVFANSPFFISAEAAGALETRKNDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +++ AGK  EVS +V+ +NSYIAWDFS++QG+++                 T ILPYRR+
Sbjct  328  ITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKIS-----------------TLILPYRRH  370

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
            ESDQGNFCT + GNYKL+WDN+YS+FF KVLRY+VDCIPPVVE     N+ E
Sbjct  371  ESDQGNFCTVLVGNYKLLWDNTYSTFFKKVLRYRVDCIPPVVEPMQPTNEAE  422


 Score = 73.2 bits (178),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQRHRYGPPLYSLT M + IRLFL L W
Sbjct  226  RQINDDDGPMEEQRHRYGPPLYSLTAMVIFIRLFLFLSW  264



>ref|XP_006654248.1| PREDICTED: uncharacterized protein LOC102707586 [Oryza brachyantha]
Length=437

 Score =   228 bits (582),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K++ + I VL++AV +Y  EFE+F KFIG VFVNAPFFI+AEDAGA E+  ++EY+E  +
Sbjct  270  KIEKDDIAVLQQAVVIYTEEFEKFTKFIGEVFVNAPFFISAEDAGA-ESRNSDEYKETII  328

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL-QDIGFSMEYEDSSGKKTPILPYRRYES  294
             AGKTHEV L+VE INSYIAWDFSL QG LN+  DIGF +EY   SG+KT ILPYRRYE+
Sbjct  329  PAGKTHEVILSVEAINSYIAWDFSLQQGALNMVLDIGFHVEYISPSGEKTLILPYRRYEA  388

Query  293  DQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASA  156
            DQGNFCT  AG+YKLVWDNSYSSFF K LRYKVD +PPVV  + +A
Sbjct  389  DQGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVDAVPPVVTPAEAA  434


 Score = 62.8 bits (151),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFL  680
            RQINDD GPMEEQR RYGP LY+LTK+ L IRL+L
Sbjct  225  RQINDDNGPMEEQRERYGPALYTLTKLVLAIRLYL  259



>ref|NP_001154687.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90283.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=479

 Score =   212 bits (539),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 133/200 (67%), Gaps = 40/200 (20%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  271  KLSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL----------------------------  375
             AG+T+E+SL VE  NSYIAWDFSL+QG++++                            
Sbjct  331  QAGRTYEISLMVESENSYIAWDFSLMQGKISMLPYIRFLLLYLLLFLPDSGYLCFHTYFC  390

Query  374  ------------QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSY  231
                        QDIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSY
Sbjct  391  CLSSVYISVVFYQDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSY  450

Query  230  SSFFSKVLRYKVDCIPPVVE  171
            S+FF K LRYKVDCI PVVE
Sbjct  451  STFFKKTLRYKVDCIAPVVE  470


 Score = 77.0 bits (188),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FL+LLW+ 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWER  266



>ref|XP_008463316.1| PREDICTED: uncharacterized protein LOC103501503 isoform X1 [Cucumis 
melo]
Length=436

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A KL+   + +LE+AVDVY SE ERF+ FI  VF NAPFFI+A+ A A    K++ Y+E
Sbjct  268  DAVKLR-EHLGILEQAVDVYTSEIERFLGFIREVFNNAPFFISADVACAANERKSDSYKE  326

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AGKT+EVSL+VE INSYIAWDFSL+QG++N+ DIGFS+E E   G KT ILP++RY
Sbjct  327  ISVPAGKTYEVSLSVESINSYIAWDFSLVQGKMNM-DIGFSVECESPGGVKTLILPHKRY  385

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASA  156
            ESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRYKVDCIPPVVE    A
Sbjct  386  ESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRYKVDCIPPVVEPVQPA  433


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYKGIKYLFWKKQWM  605
            ++INDD+GPMEEQR RYGPPLY LT M   IRL +SL W+    +  K  ++L   +Q +
Sbjct  226  QKINDDDGPMEEQRQRYGPPLYKLTTMVRLIRLCISLSWRRF--DAVKLREHLGILEQAV  283

Query  604  SMYLS  590
             +Y S
Sbjct  284  DVYTS  288



>ref|NP_001190197.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED90285.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=472

 Score =   211 bits (538),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 133/200 (67%), Gaps = 40/200 (20%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  264  KLSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIV  323

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL----------------------------  375
             AG+T+E+SL VE  NSYIAWDFSL+QG++++                            
Sbjct  324  QAGRTYEISLMVESENSYIAWDFSLMQGKISMLPYIRFLLLYLLLFLPDSGYLCFHTYFC  383

Query  374  ------------QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSY  231
                        QDIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSY
Sbjct  384  CLSSVYISVVFYQDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSY  443

Query  230  SSFFSKVLRYKVDCIPPVVE  171
            S+FF K LRYKVDCI PVVE
Sbjct  444  STFFKKTLRYKVDCIAPVVE  463


 Score = 77.0 bits (188),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FL+LLW+ 
Sbjct  219  RQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWER  259



>ref|NP_001055152.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAF17066.1| Os05g0306000 [Oryza sativa Japonica Group]
 dbj|BAG92466.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78947.1| hypothetical protein OsI_19396 [Oryza sativa Indica Group]
Length=439

 Score =   225 bits (573),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K++ + I VL++AV +Y  EFE+F +FIG VFVNAPFFI+AEDAGA E+  +++Y+E  +
Sbjct  272  KIEKDDIAVLQQAVAIYTEEFEKFTEFIGEVFVNAPFFISAEDAGA-ESRNSDDYKETII  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL-QDIGFSMEYEDSSGKKTPILPYRRYES  294
             AGKTHEV L+VE +NSYIAWDFSL QG LN+  DIGF +EY   SG+KT ILPYRRYE+
Sbjct  331  PAGKTHEVILSVEAVNSYIAWDFSLQQGALNMVLDIGFHVEYISPSGQKTLILPYRRYEA  390

Query  293  DQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASA  156
            DQGNFCT  AG+YKLVWDNSYSSFF K LRYKVD +PPVV  +  A
Sbjct  391  DQGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVDAVPPVVAPAEPA  436


 Score = 62.8 bits (151),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQINDD GPMEEQR RYGP LY+LTK+ L IRL+L +
Sbjct  227  RQINDDNGPMEEQRERYGPALYTLTKLVLAIRLYLHV  263



>ref|XP_006429678.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
 gb|ESR42918.1| hypothetical protein CICLE_v10011748mg [Citrus clementina]
Length=437

 Score =   214 bits (544),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A KL+ +Q+ +LE+AVDVY SEFE FIKFI  VF N+PFFI+AE AGA+E  KN+EY+E
Sbjct  268  DANKLKRHQVAILEQAVDVYTSEFESFIKFISGVFANSPFFISAEAAGALETRKNDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +++ AGK  EVS +V+ +NSYIAWDFS++QG+++  DIGFS+EY + SG+KT ILPYRR+
Sbjct  328  ITIPAGKNFEVSFSVDSVNSYIAWDFSVVQGKIS-TDIGFSLEYTNESGEKTLILPYRRH  386

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSK  213
            ESDQGNFCT + GNYKL+WDN+YS+FF K
Sbjct  387  ESDQGNFCTVLVGNYKLLWDNTYSTFFKK  415


 Score = 73.6 bits (179),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQRHRYGPPLYSLT M + IRLFL L W
Sbjct  226  RQINDDDGPMEEQRHRYGPPLYSLTAMVIFIRLFLFLSW  264



>ref|XP_011101979.1| PREDICTED: uncharacterized protein LOC105180011 isoform X3 [Sesamum 
indicum]
Length=411

 Score =   207 bits (526),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 119/165 (72%), Gaps = 26/165 (16%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KLQ NQ+ +LE+A +VY SEFERFI FI  VF N+PFFITAEDAG + A K+++Y+E+++
Sbjct  271  KLQKNQLSILEEAANVYTSEFERFITFIREVFTNSPFFITAEDAGTLAARKDDDYKEINI  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+THE                          DIGFS+E  D SGKKT ILPYRRYESD
Sbjct  331  PAGETHE--------------------------DIGFSVECTDLSGKKTLILPYRRYESD  364

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASA  156
            QGNFCTC++G+YKL+WDNSYSSFF KV+RYKVDCIPPV ES+  A
Sbjct  365  QGNFCTCVSGSYKLIWDNSYSSFFKKVMRYKVDCIPPVAESATHA  409


 Score = 77.4 bits (189),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHL  659
            RQINDD+GPMEEQR RYGPPLY LT+M  NIRLFLSLLW  L
Sbjct  226  RQINDDQGPMEEQRQRYGPPLYCLTRMVHNIRLFLSLLWARL  267



>ref|XP_010543127.1| PREDICTED: uncharacterized protein LOC104816146 isoform X2 [Tarenaya 
hassleriana]
Length=437

 Score =   224 bits (571),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 136/170 (80%), Gaps = 5/170 (3%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ VL +A  VY SEFE FI FI NVF N+PFFI+A+ AGA  + +NEEY+E+ V
Sbjct  271  KLNRDQMNVLYEAAIVYTSEFETFITFISNVFANSPFFISADVAGASGSRENEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T EVSLTVE +NSYIAWDFS++QG++++ DIGF +E   +SG+KT ILPY+RYE+D
Sbjct  331  QAGRTCEVSLTVESVNSYIAWDFSVVQGKISM-DIGFRVECIGASGEKTLILPYQRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLEG  141
            QGNF TCM GNYKLVWDNSYS+FF K LRYKVDCIPPVVE    A +L+G
Sbjct  390  QGNFSTCMPGNYKLVWDNSYSTFFKKTLRYKVDCIPPVVE----ATELKG  435


 Score = 59.7 bits (143),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMA  701
            RQINDD+GPMEEQR RYGPPLYSLTKM 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMV  253



>ref|NP_001154688.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH56815.1| AT5G01010 [Arabidopsis thaliana]
 gb|AED90284.1| uncharacterized protein AT5G01010 [Arabidopsis thaliana]
Length=429

 Score =   204 bits (520),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  271  KLSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+E+SL VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT ILPYRRYE+D
Sbjct  331  QAGRTYEISLMVESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRY  201
            QGNF T MAGNYKLVWDNSYS+FF KV RY
Sbjct  390  QGNFSTLMAGNYKLVWDNSYSTFFKKVGRY  419


 Score = 77.4 bits (189),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FL+LLW+ 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWER  266



>emb|CDY11168.1| BnaA03g00040D [Brassica napus]
Length=474

 Score =   214 bits (545),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 133/203 (66%), Gaps = 41/203 (20%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  NQ+ +L +AV VY SEFERFI FI +VF N+PFFI+A+ AG + + +NEEY+E+ V
Sbjct  271  KLNKNQMNLLSEAVIVYTSEFERFITFISDVFANSPFFISADTAGTLGSRENEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL----------------------------  375
             AG+T+EVSL VE  NSYIAWDFSL+QG++++                            
Sbjct  331  QAGRTYEVSLMVESENSYIAWDFSLVQGKISMVLLFEPQFVSPLYNLKSFDCFSCLYHRL  390

Query  374  -------------QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNS  234
                          DIGF +EY  +SG+KT ILPY RYE+DQGNF T MAGNYKLVWDNS
Sbjct  391  SLSAYYRYNIVYADDIGFCVEYISASGEKTLILPYHRYEADQGNFSTLMAGNYKLVWDNS  450

Query  233  YSSFFSKVLRYKVDCIPPVVESS  165
            YS+FF K LRYKVDCIPPVVE +
Sbjct  451  YSTFFKKTLRYKVDCIPPVVEPT  473


 Score = 67.0 bits (162),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQ  665
            RQINDD+GPMEEQR RYGP LY+LTKM   IR+ L+LLW+
Sbjct  226  RQINDDDGPMEEQRERYGPHLYNLTKMVTAIRVSLTLLWE  265



>ref|XP_004962482.1| PREDICTED: uncharacterized protein LOC101772803 isoform X2 [Setaria 
italica]
Length=437

 Score =   218 bits (554),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K+  + I VL+ AV +Y  EF +F +FIG VFVNAPFFI+AEDAGA +A K++EY+E  +
Sbjct  271  KIDKDDIAVLQHAVIIYTEEFVKFTEFIGEVFVNAPFFISAEDAGAADARKSDEYKETII  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AGKTHEV L+VE INSYIAWDFSL QG LN+ DIGF +EY   SG+KT ILPYRRYE+D
Sbjct  331  PAGKTHEVILSVEAINSYIAWDFSLQQGALNM-DIGFHVEYISPSGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  192
            QGNFCT  AG+YKLVWDNSYSSFF K LRYKVD
Sbjct  390  QGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVD  422


 Score = 62.8 bits (151),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQINDD GPMEEQR RYGP LY+LTK+ L IRL+L +
Sbjct  226  RQINDDNGPMEEQRERYGPALYTLTKLVLAIRLYLHV  262



>ref|XP_004962483.1| PREDICTED: uncharacterized protein LOC101772803 isoform X3 [Setaria 
italica]
Length=437

 Score =   218 bits (554),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K+  + I VL+ AV +Y  EF +F +FIG VFVNAPFFI+AEDAGA +A K++EY+E  +
Sbjct  271  KIDKDDIAVLQHAVIIYTEEFVKFTEFIGEVFVNAPFFISAEDAGAADARKSDEYKETII  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AGKTHEV L+VE INSYIAWDFSL QG LN+ DIGF +EY   SG+KT ILPYRRYE+D
Sbjct  331  PAGKTHEVILSVEAINSYIAWDFSLQQGALNM-DIGFHVEYISPSGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  192
            QGNFCT  AG+YKLVWDNSYSSFF K LRYKVD
Sbjct  390  QGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVD  422


 Score = 62.8 bits (151),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQINDD GPMEEQR RYGP LY+LTK+ L IRL+L +
Sbjct  226  RQINDDNGPMEEQRERYGPALYTLTKLVLAIRLYLHV  262



>ref|XP_004962481.1| PREDICTED: uncharacterized protein LOC101772803 isoform X1 [Setaria 
italica]
Length=439

 Score =   217 bits (552),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K+  + I VL+ AV +Y  EF +F +FIG VFVNAPFFI+AEDAGA +A K++EY+E  +
Sbjct  271  KIDKDDIAVLQHAVIIYTEEFVKFTEFIGEVFVNAPFFISAEDAGAADARKSDEYKETII  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL-QDIGFSMEYEDSSGKKTPILPYRRYES  294
             AGKTHEV L+VE INSYIAWDFSL QG LN+  DIGF +EY   SG+KT ILPYRRYE+
Sbjct  331  PAGKTHEVILSVEAINSYIAWDFSLQQGALNMVLDIGFHVEYISPSGEKTLILPYRRYEA  390

Query  293  DQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  192
            DQGNFCT  AG+YKLVWDNSYSSFF K LRYKVD
Sbjct  391  DQGNFCTVSAGSYKLVWDNSYSSFFKKSLRYKVD  424


 Score = 62.8 bits (151),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFL  680
            RQINDD GPMEEQR RYGP LY+LTK+ L IRL+L
Sbjct  226  RQINDDNGPMEEQRERYGPALYTLTKLVLAIRLYL  260



>gb|KDO37187.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=158

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 125/149 (84%), Gaps = 1/149 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            + + +Q+ +LE+AVDVY SEFE FIKFI  VF N+PFFI+AE AGA+E  KN+EY+E+++
Sbjct  5    RRKRHQVAILEQAVDVYTSEFESFIKFISGVFANSPFFISAEAAGALETRKNDEYKEITI  64

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AGK  EVS +V+ +NSYIAWDFS++QG+++  DIGFS+EY + SG+KT ILPYRR+ESD
Sbjct  65   PAGKNFEVSFSVDSVNSYIAWDFSVVQGKIS-TDIGFSLEYTNESGEKTLILPYRRHESD  123

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLR  204
            QGNFCT + GNYKL+WDN+YS+FF KVLR
Sbjct  124  QGNFCTVLVGNYKLLWDNTYSTFFKKVLR  152



>ref|XP_003568677.1| PREDICTED: uncharacterized protein LOC100826543 isoform X1 [Brachypodium 
distachyon]
Length=437

 Score =   218 bits (554),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 129/163 (79%), Gaps = 2/163 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K++ + + VL++AV +Y  EF +F  FIG VFVNAPFFI+AEDAGA ++  ++EY+E  +
Sbjct  270  KIEKDDLAVLQQAVVIYSEEFGKFTTFIGEVFVNAPFFISAEDAGA-DSRTSDEYRETII  328

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRL-NLQDIGFSMEYEDSSGKKTPILPYRRYES  294
             AGKTHEV L+VE +NSYIAWDFSL QG L  L DIGF +EY   SG+KT ILPYRRYE+
Sbjct  329  PAGKTHEVILSVEAVNSYIAWDFSLQQGALGTLLDIGFHVEYISLSGEKTLILPYRRYEA  388

Query  293  DQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESS  165
            DQGNFCT  AG+YKLVWDNSYS+FF K LRYKVD +PPVVE +
Sbjct  389  DQGNFCTVSAGSYKLVWDNSYSTFFKKTLRYKVDAVPPVVEPA  431


 Score = 57.8 bits (138),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQIND  GPME QR RYGP LY+LTK+ L IRL+L L
Sbjct  225  RQINDSNGPMEVQRERYGPALYTLTKLVLAIRLYLHL  261



>ref|XP_010543126.1| PREDICTED: uncharacterized protein LOC104816146 isoform X1 [Tarenaya 
hassleriana]
Length=448

 Score =   215 bits (548),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 136/181 (75%), Gaps = 16/181 (9%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ VL +A  VY SEFE FI FI NVF N+PFFI+A+ AGA  + +NEEY+E+ V
Sbjct  271  KLNRDQMNVLYEAAIVYTSEFETFITFISNVFANSPFFISADVAGASGSRENEEYKEIIV  330

Query  470  AAGKTHE-----------VSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKT  324
             AG+T E           VSLTVE +NSYIAWDFS++QG++++ DIGF +E   +SG+KT
Sbjct  331  QAGRTCESYLCQETWRNAVSLTVESVNSYIAWDFSVVQGKISM-DIGFRVECIGASGEKT  389

Query  323  PILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQLE  144
             ILPY+RYE+DQGNF TCM GNYKLVWDNSYS+FF K LRYKVDCIPPVVE    A +L+
Sbjct  390  LILPYQRYEADQGNFSTCMPGNYKLVWDNSYSTFFKKTLRYKVDCIPPVVE----ATELK  445

Query  143  G  141
            G
Sbjct  446  G  446


 Score = 59.7 bits (143),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMA  701
            RQINDD+GPMEEQR RYGPPLYSLTKM 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMV  253



>dbj|BAJ93195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   217 bits (552),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K++ + I VL++AV +Y  EF +F  FIG VFVNAPFFI+AEDAGA ++ KN+EY+E  +
Sbjct  270  KIEKDDIAVLQQAVVIYTEEFGKFTTFIGEVFVNAPFFISAEDAGA-DSRKNDEYRETII  328

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLN-LQDIGFSMEYEDSSGKKTPILPYRRYES  294
             AGKTHEV L+VE +NSYIAWDFSL QG L+ L DIGF +EY   S +KT ILPYRRYE+
Sbjct  329  PAGKTHEVILSVEAVNSYIAWDFSLQQGALSTLLDIGFHVEYISPSQEKTLILPYRRYEA  388

Query  293  DQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            DQGNFCT  AG+YKLVWDNSYS+FF K LRYKVD +P V E
Sbjct  389  DQGNFCTVFAGSYKLVWDNSYSTFFKKTLRYKVDAVPSVTE  429


 Score = 57.4 bits (137),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQIND  GPME QR RYGP LY+LTK+ L +RL+L L
Sbjct  225  RQINDANGPMEVQRERYGPALYTLTKLVLAVRLYLHL  261



>gb|AFW77521.1| hypothetical protein ZEAMMB73_436424 [Zea mays]
Length=412

 Score =   211 bits (538),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -3

Query  560  VFVNAPFFITAEDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRL  381
            VFVNAPFFI+AEDAGA++A K++EY+E  + AGKTHEV L+VE +NSYIAWDFSL QG L
Sbjct  274  VFVNAPFFISAEDAGAVDARKSDEYKETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGAL  333

Query  380  NL-QDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLR  204
            N+  DIGF +EY   SG+KT ILPYRRYE+DQGNFCT  +G+YKLVWDNSYSSFF KVLR
Sbjct  334  NMVLDIGFHVEYISPSGEKTLILPYRRYEADQGNFCTVSSGSYKLVWDNSYSSFFKKVLR  393

Query  203  YKVDCIPPVVESSASANQL  147
            YKVD +PPVVE + SA +L
Sbjct  394  YKVDAVPPVVEPALSATEL  412


 Score = 62.8 bits (151),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFL  680
            RQINDD GPMEEQR RYGP LY+LTK+ L IRL+L
Sbjct  226  RQINDDNGPMEEQRERYGPALYTLTKLVLAIRLYL  260



>ref|XP_008793390.1| PREDICTED: uncharacterized protein LOC103709697 isoform X2 [Phoenix 
dactylifera]
Length=419

 Score =   161 bits (407),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ KL+ +Q+ ++++AV VY SE E+FIKFIG VF N+PF I+AEDAGA E+ K++EY+E
Sbjct  230  ESRKLEMDQVSIIQQAVHVYTSELEKFIKFIGEVFANSPFLISAEDAGAAESRKSDEYKE  289

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
              +  GKTHEV LTVE +NSYIAWDF+LIQG L+L DIGF +EY   SG+ T ILPY+RY
Sbjct  290  TMIPPGKTHEVILTVESVNSYIAWDFALIQGTLSL-DIGFRVEYVSPSGEITMILPYQRY  348

Query  299  ESDQ  288
            ESDQ
Sbjct  349  ESDQ  352


 Score = 75.5 bits (184),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQRHRYGPPLYSLTKM L+IRLFL L W
Sbjct  188  RQINDDKGPMEEQRHRYGPPLYSLTKMVLSIRLFLLLSW  226


 Score = 50.1 bits (118),  Expect(3) = 7e-62, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -1

Query  280  SAHAWLEITNSYGTILIHHSSARSCVTRWTVYLQLWSHRLRLIN  149
            SA +W + TNSYG I I H S R+C TRW +Y  LW+ R  L+N
Sbjct  355  SAQSWPDPTNSYGIIPIRHFSKRACGTRWMLYPLLWNRRSFLLN  398



>gb|EEE63181.1| hypothetical protein OsJ_17990 [Oryza sativa Japonica Group]
Length=431

 Score =   202 bits (514),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K++ + I VL++AV +Y  EFE+F +FIG VFVNAPFFI+AEDAGA E+  +++Y+E  +
Sbjct  272  KIEKDDIAVLQQAVAIYTEEFEKFTEFIGEVFVNAPFFISAEDAGA-ESRNSDDYKETII  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL-QDIGFSMEYEDSSGKKTPILPYRRYES  294
             AGKTHEV L+VE +NSYIAWDFSL QG LN+  DIGF +EY   SG+KT ILPYRRYE+
Sbjct  331  PAGKTHEVILSVEAVNSYIAWDFSLQQGALNMVLDIGFHVEYISPSGQKTLILPYRRYEA  390

Query  293  DQGNFCTCMAGNYKLVWDNSYSSFFSKVLR  204
            DQGNFCT  AG+YKLVWDNSYSSFF K L+
Sbjct  391  DQGNFCTVSAGSYKLVWDNSYSSFFKKGLQ  420


 Score = 62.8 bits (151),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQINDD GPMEEQR RYGP LY+LTK+ L IRL+L +
Sbjct  227  RQINDDNGPMEEQRERYGPALYTLTKLVLAIRLYLHV  263



>ref|XP_002872981.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49240.1| hypothetical protein ARALYDRAFT_486867 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   202 bits (514),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 129/169 (76%), Gaps = 8/169 (5%)
 Frame = -3

Query  686  FSISAMAAPEA----GKL---QGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITA  528
            +S++ M  PE     G L     +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A
Sbjct  247  YSLTKMIVPEYFPSFGLLLLTSKDQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISA  306

Query  527  EDAGAIEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEY  348
            + AG + +  NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL+QG++++ DIGFS+EY
Sbjct  307  DTAGILGSRDNEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLMQGKISM-DIGFSLEY  365

Query  347  EDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRY  201
              +SG+KT ILPYRRYE+DQGNF T MAGNYKLVWDNSYS+FF KV RY
Sbjct  366  ISASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKVGRY  414


 Score = 60.1 bits (144),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMAL  698
            RQINDD+GPMEEQR RYGPPLYSLTKM +
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMIV  254



>ref|XP_008793391.1| PREDICTED: uncharacterized protein LOC103709697 isoform X3 [Phoenix 
dactylifera]
Length=413

 Score =   186 bits (472),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 113/164 (69%), Gaps = 26/164 (16%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ KL+ +Q+ ++++AV VY SE E+FIKFIG VF N+PF I+AEDAGA E+ K++EY+E
Sbjct  268  ESRKLEMDQVSIIQQAVHVYTSELEKFIKFIGEVFANSPFLISAEDAGAAESRKSDEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
              +  GKTHE                          DIGF +EY   SG+ T ILPY+RY
Sbjct  328  TMIPPGKTHE--------------------------DIGFRVEYVSPSGEITMILPYQRY  361

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVES  168
            ESDQGNFCT +AG+YKL+WDNSYS+FF K LRYKVD IPPVVES
Sbjct  362  ESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRYKVDAIPPVVES  405


 Score = 76.3 bits (186),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLW  668
            RQINDD+GPMEEQRHRYGPPLYSLTKM L+IRLFL L W
Sbjct  226  RQINDDKGPMEEQRHRYGPPLYSLTKMVLSIRLFLLLSW  264



>ref|XP_006842639.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
 gb|ERN04314.1| hypothetical protein AMTR_s00077p00188630 [Amborella trichopoda]
Length=440

 Score =   206 bits (525),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 128/160 (80%), Gaps = 1/160 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KLQ +++ VLE+AVDVY SE E F+ FI  VF NAPFFI+AE+AGA EAS+ EEY+E  +
Sbjct  271  KLQKDKVAVLEQAVDVYTSELEHFLNFIVGVFANAPFFISAEEAGAAEASRGEEYKETLI  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AGKT+E+ L V+ +NSYIAWDF + QG++++ DIGFS+EY   SG  T ILPY+RYESD
Sbjct  331  PAGKTYEILLAVDSVNSYIAWDFLVTQGKMSM-DIGFSVEYISPSGITTLILPYQRYESD  389

Query  290  QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            QGNFCT  AG+YKL+WDNSYS+FF K LRYKVD IPPV E
Sbjct  390  QGNFCTVKAGSYKLIWDNSYSTFFKKNLRYKVDAIPPVAE  429


 Score = 53.9 bits (128),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMA  701
            RQIN D+GPMEEQR RYGPPLYSLT M 
Sbjct  226  RQINYDQGPMEEQRQRYGPPLYSLTSMV  253



>ref|XP_010231533.1| PREDICTED: uncharacterized protein LOC100826543 isoform X2 [Brachypodium 
distachyon]
Length=423

 Score =   193 bits (490),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 117/149 (79%), Gaps = 2/149 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K++ + + VL++AV +Y  EF +F  FIG VFVNAPFFI+AEDAGA ++  ++EY+E  +
Sbjct  270  KIEKDDLAVLQQAVVIYSEEFGKFTTFIGEVFVNAPFFISAEDAGA-DSRTSDEYRETII  328

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRL-NLQDIGFSMEYEDSSGKKTPILPYRRYES  294
             AGKTHEV L+VE +NSYIAWDFSL QG L  L DIGF +EY   SG+KT ILPYRRYE+
Sbjct  329  PAGKTHEVILSVEAVNSYIAWDFSLQQGALGTLLDIGFHVEYISLSGEKTLILPYRRYEA  388

Query  293  DQGNFCTCMAGNYKLVWDNSYSSFFSKVL  207
            DQGNFCT  AG+YKLVWDNSYS+FF K +
Sbjct  389  DQGNFCTVSAGSYKLVWDNSYSTFFKKCM  417


 Score = 57.8 bits (138),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQIND  GPME QR RYGP LY+LTK+ L IRL+L L
Sbjct  225  RQINDSNGPMEVQRERYGPALYTLTKLVLAIRLYLHL  261



>ref|XP_010938085.1| PREDICTED: uncharacterized protein LOC105057244 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   181 bits (460),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 109/163 (67%), Gaps = 26/163 (16%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E+ K Q +Q+ VL++AV VY SE E+FI+FIG V  N+PF I+AEDAGA ++ K+ EY+E
Sbjct  268  ESRKPQMDQVSVLQQAVHVYTSELEKFIQFIGEVVANSPFLISAEDAGAADSRKSVEYKE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
              +  GKTHE                          DIGF MEY   SG+ T ILPYRRY
Sbjct  328  TIIPPGKTHE--------------------------DIGFRMEYVSPSGEVTLILPYRRY  361

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE  171
            ESDQGNFCT +AG+YKL+WDNSYS+FF K LRYKVD IPPVVE
Sbjct  362  ESDQGNFCTILAGSYKLIWDNSYSTFFKKSLRYKVDAIPPVVE  404


 Score = 68.6 bits (166),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGP LY LTKM L IRLFL L W+  +
Sbjct  226  RQINDDDGPMEEQRQRYGPALYGLTKMVLFIRLFLLLSWERFE  268



>ref|XP_002980642.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
 gb|EFJ18293.1| hypothetical protein SELMODRAFT_154057 [Selaginella moellendorffii]
Length=429

 Score =   162 bits (411),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 114/166 (69%), Gaps = 5/166 (3%)
 Frame = -3

Query  644  QGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKN-EEYQEVSVA  468
            Q +++ +LE++V +Y SE +RF+ F+  VF ++PF I+AE+AG         +++E  ++
Sbjct  267  QDSRLDLLEESVKLYSSELKRFLTFLREVFEHSPFLISAEEAGTNGGKTMVNDFKETVIS  326

Query  467  AGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESDQ  288
             GKTHEV L V+   SY+AW+F L  G+    D+GFS+EY  S+G K  +LPY+RY+S Q
Sbjct  327  TGKTHEVLLPVDSEGSYVAWEFKLTSGK----DVGFSVEYISSNGAKMQMLPYQRYDSHQ  382

Query  287  GNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQ  150
            GNF +   G+YKLVWDNSYS+F+ K +RYKVD IPPV ++    +Q
Sbjct  383  GNFYSPGVGSYKLVWDNSYSTFYRKTVRYKVDAIPPVADAQKLEDQ  428


 Score = 66.6 bits (161),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKREN  647
            +QIND  GPMEEQR RYGPPLY LT++ L+IR+FL+L W+   R+ 
Sbjct  219  QQINDHNGPMEEQRERYGPPLYQLTQLGLHIRIFLTLWWKTFNRDT  264



>ref|XP_002991009.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
 gb|EFJ07817.1| hypothetical protein SELMODRAFT_161364 [Selaginella moellendorffii]
Length=429

 Score =   162 bits (411),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 114/166 (69%), Gaps = 5/166 (3%)
 Frame = -3

Query  644  QGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKN-EEYQEVSVA  468
            Q +++ +LE++V +Y SE +RF+ F+  VF ++PF I+AE+AG         +++E  ++
Sbjct  267  QDSRLDLLEESVKLYSSELKRFLTFLREVFEHSPFLISAEEAGTNGGKTMVNDFKETVIS  326

Query  467  AGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESDQ  288
             GKTHEV L V+   SY+AW+F L  G+    D+GFS+EY  S+G K  +LPY+RY+S Q
Sbjct  327  TGKTHEVLLPVDSEGSYVAWEFKLTSGK----DVGFSVEYISSNGAKMQMLPYQRYDSHQ  382

Query  287  GNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQ  150
            GNF +   G+YKLVWDNSYS+F+ K +RYKVD IPPV ++    +Q
Sbjct  383  GNFYSPGVGSYKLVWDNSYSTFYRKTVRYKVDAIPPVADAQKLEDQ  428


 Score = 66.6 bits (161),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKREN  647
            +QIND  GPMEEQR RYGPPLY LT++ L+IR+FL+L W+   R+ 
Sbjct  219  QQINDHNGPMEEQRERYGPPLYQLTQLGLHIRIFLTLWWKTFNRDT  264



>ref|XP_001765571.1| predicted protein [Physcomitrella patens]
 gb|EDQ69621.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   168 bits (426),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = -3

Query  647  LQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSVA  468
            ++   + VLE++V+ Y  +F R++ F+  VF N+PFFIT E+AG I AS +++Y+E ++A
Sbjct  273  IREEMLEVLEQSVEAYKFDFTRYLDFMQEVFKNSPFFITPEEAG-IAASADQDYKEATIA  331

Query  467  AGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESDQ  288
            AGKTHEV L V+   + +AWDF L  G+    DIGFS+E  DSS    P+ PY+RYE+ Q
Sbjct  332  AGKTHEVILPVKYEGALVAWDFRLTSGK----DIGFSVELVDSSRATRPMFPYQRYETHQ  387

Query  287  GNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESS  165
            G+F +   GNY+LVWDN+YS+F+ K LRYKVD IPPV+E +
Sbjct  388  GSFQSPCVGNYRLVWDNTYSNFYRKYLRYKVDEIPPVLEEA  428


 Score = 60.5 bits (145),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -1

Query  781  QINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYK  641
            +INDD GPMEEQR RYGP LY LT  A+ +R+FL++ W     E+ +
Sbjct  228  KINDDHGPMEEQRERYGPSLYKLTTFAVALRVFLAVWWSAFDCEDIR  274



>ref|XP_006398545.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ39998.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=412

 Score =   152 bits (384),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL   Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + + +NEEY+E+ V
Sbjct  271  KLNKEQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILGSRENEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESD  291
             AG+T+EVSL VE  NSYI WDFSL+QG++++ DIGFS+EY  +SG+KT ILPYRRYE+D
Sbjct  331  QAGRTYEVSLMVESENSYIGWDFSLMQGKISM-DIGFSVEYISASGEKTLILPYRRYEAD  389

Query  290  QGNFCTCMAGNYKLVWDNSY  231
            Q +   C+   +KL++ N +
Sbjct  390  QVS-AMCI---WKLLYANGW  405


 Score = 75.9 bits (185),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM   IR+FL+LLW+ 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVTAIRVFLTLLWER  266



>ref|XP_008463317.1| PREDICTED: uncharacterized protein LOC103501503 isoform X2 [Cucumis 
melo]
Length=411

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 112/168 (67%), Gaps = 27/168 (16%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            +A KL+   + +LE+AVDVY SE ERF+ FI  VF NAPFFI+A+ A A    K++ Y+E
Sbjct  268  DAVKLR-EHLGILEQAVDVYTSEIERFLGFIREVFNNAPFFISADVACAANERKSDSYKE  326

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +SV AGKT+E                          DIGFS+E E   G KT ILP++RY
Sbjct  327  ISVPAGKTYE--------------------------DIGFSVECESPGGVKTLILPHKRY  360

Query  299  ESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASA  156
            ESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRYKVDCIPPVVE    A
Sbjct  361  ESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRYKVDCIPPVVEPVQPA  408


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYKGIKYLFWKKQWM  605
            ++INDD+GPMEEQR RYGPPLY LT M   IRL +SL W+    +  K  ++L   +Q +
Sbjct  226  QKINDDDGPMEEQRQRYGPPLYKLTTMVRLIRLCISLSWRRF--DAVKLREHLGILEQAV  283

Query  604  SMYLS  590
             +Y S
Sbjct  284  DVYTS  288



>ref|XP_007032243.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
 gb|EOY03169.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
Length=372

 Score =   142 bits (357),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 86/122 (70%), Gaps = 17/122 (14%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +QI VLE+AVDVY SEFERFI FI  VF N+PFFI+AEDA   E  K++EY E
Sbjct  268  EAFKLNRHQISVLEEAVDVYTSEFERFINFISEVFANSPFFISAEDASMFETRKSDEYNE  327

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            ++V AGK++EVSL VE INSYIAWDFSL+QG++N+                  ILPYRRY
Sbjct  328  ITVPAGKSYEVSLAVESINSYIAWDFSLVQGKMNML-----------------ILPYRRY  370

Query  299  ES  294
            ES
Sbjct  371  ES  372


 Score = 74.7 bits (182),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLY+LTK  L IRLFLSL WQ  +
Sbjct  226  RQINDDDGPMEEQRQRYGPPLYNLTKTVLIIRLFLSLAWQRFE  268



>gb|EYU42069.1| hypothetical protein MIMGU_mgv1a006657mg [Erythranthe guttata]
Length=382

 Score =   144 bits (362),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            E  KLQ NQ+ +LE+A DVY SEF+RFIKFIG VF N+PFFITAEDAG +   K+++Y+E
Sbjct  269  ETSKLQKNQVVILEEAADVYTSEFQRFIKFIGEVFTNSPFFITAEDAGTLSIRKDDDYKE  328

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL  375
            +SV AG  HEVSLTVE +NSYIAWDFSL+QG+LN+
Sbjct  329  ISVPAGSAHEVSLTVESVNSYIAWDFSLVQGKLNV  363


 Score = 67.0 bits (162),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLYSLTKMA +IRL LSLLW  L+
Sbjct  227  RQINDDQGPMEEQRQRYGPPLYSLTKMAHSIRLLLSLLWGRLE  269



>ref|XP_006398546.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
 gb|ESQ39999.1| hypothetical protein EUTSA_v10013603mg [Eutrema salsugineum]
Length=418

 Score =   129 bits (323),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL   Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + + +NEEY+E+ V
Sbjct  271  KLNKEQMNLLSEAAIVYTSEFERFVTFISDVFANSPFFISADTAGILGSRENEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKT  324
             AG+T+EVSL VE  NSYI WDFSL+QG++++ DIGFS+EY  +SG+KT
Sbjct  331  QAGRTYEVSLMVESENSYIGWDFSLMQGKISM-DIGFSVEYISASGEKT  378


 Score = 76.6 bits (187),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQ  665
            RQINDD+GPMEEQR RYGPPLYSLTKM   IR+FL+LLW+
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMVTAIRVFLTLLWE  265



>ref|XP_009130614.1| PREDICTED: uncharacterized protein LOC103855392 isoform X2 [Brassica 
rapa]
Length=387

 Score =   134 bits (338),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  NQ+ +L +AV VY SEFERFI FI +VF N+PFFI+A+ AG + + +NEEY+E+ V
Sbjct  271  KLNKNQMNLLSEAVIVYTSEFERFITFISDVFANSPFFISADTAGTLGSRENEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKT  324
             AG+T+EVSL VE  NSYIAWDFSL+QG++++ DIGF +EY  +SG+KT
Sbjct  331  QAGRTYEVSLMVESENSYIAWDFSLVQGKISM-DIGFCVEYISASGEKT  378


 Score = 67.0 bits (162),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGP LY+LTKM   IR+ L+LLW+ 
Sbjct  226  RQINDDDGPMEEQRERYGPHLYNLTKMVTAIRVSLTLLWER  266



>dbj|BAH57287.1| AT5G01010 [Arabidopsis thaliana]
Length=98

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = -3

Query  437  VEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGN  258
            VE  NSYIAWDFSL+QG++++ DIGFS+EY ++SG+KT ILPYRRYE+DQGNF T MAGN
Sbjct  2    VESENSYIAWDFSLMQGKISM-DIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAGN  60

Query  257  YKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQL  147
            YKLVWDNSYS+FF K LRYKVDCI PVVE       L
Sbjct  61   YKLVWDNSYSTFFKKTLRYKVDCIAPVVEPDPEPEPL  97



>ref|XP_010496718.1| PREDICTED: uncharacterized protein LOC104773766, partial [Camelina 
sativa]
Length=303

 Score =   113 bits (282),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ +L +A  VY SEFERF+ FI +VF N+PFFI+A+ AG + +  NEEY+E+ V
Sbjct  178  KLSRDQMNLLSEASIVYTSEFERFVTFISDVFANSPFFISADTAGILGSRDNEEYKEIIV  237

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL  375
             AG+T+EVSL VE  NSYIAWDFSL+QG++++
Sbjct  238  QAGRTYEVSLMVESENSYIAWDFSLMQGKISM  269


 Score = 78.2 bits (191),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQH  662
            RQINDD+GPMEEQR RYGPPLYSLTKM + IR+FLSLLW  
Sbjct  133  RQINDDDGPMEEQRERYGPPLYSLTKMVMAIRVFLSLLWDR  173



>gb|KDO37188.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=114

 Score =   140 bits (353),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 89/109 (82%), Gaps = 1/109 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            + + +Q+ +LE+AVDVY SEFE FIKFI  VF N+PFFI+AE AGA+E  KN+EY+E+++
Sbjct  5    RRKRHQVAILEQAVDVYTSEFESFIKFISGVFANSPFFISAEAAGALETRKNDEYKEITI  64

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKT  324
             AGK  EVS +V+ +NSYIAWDFS++QG+++  DIGFS+EY + SG+KT
Sbjct  65   PAGKNFEVSFSVDSVNSYIAWDFSVVQGKIS-TDIGFSLEYTNESGEKT  112



>ref|XP_010543129.1| PREDICTED: uncharacterized protein LOC104816146 isoform X4 [Tarenaya 
hassleriana]
Length=373

 Score =   117 bits (292),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ VL +A  VY SEFE FI FI NVF N+PFFI+A+ AGA  + +NEEY+E+ V
Sbjct  271  KLNRDQMNVLYEAAIVYTSEFETFITFISNVFANSPFFISADVAGASGSRENEEYKEIIV  330

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQD--IGFSMEY  348
             AG+T EVSLTVE +NSYIAWDFS++QG+++++   +GF + +
Sbjct  331  QAGRTCEVSLTVESVNSYIAWDFSVVQGKISMEPSALGFGLSF  373


 Score = 59.7 bits (143),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMA  701
            RQINDD+GPMEEQR RYGPPLYSLTKM 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMV  253



>ref|XP_007032240.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY03166.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=343

 Score = 93.6 bits (231),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQE  480
            EA KL  +QI VLE+AVDVY SEFERFI FI  VF N+PFFI+AEDA   E  K++EY E
Sbjct  268  EAFKLNRHQISVLEEAVDVYTSEFERFINFISEVFANSPFFISAEDASMFETRKSDEYNE  327

Query  479  VSVAAGKTHEV  447
            ++V AGK++EV
Sbjct  328  ITVPAGKSYEV  338


 Score = 74.7 bits (182),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLY+LTK  L IRLFLSL WQ  +
Sbjct  226  RQINDDDGPMEEQRQRYGPPLYNLTKTVLIIRLFLSLAWQRFE  268



>ref|XP_010543128.1| PREDICTED: uncharacterized protein LOC104816146 isoform X3 [Tarenaya 
hassleriana]
Length=384

 Score =   108 bits (270),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 79/114 (69%), Gaps = 13/114 (11%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            KL  +Q+ VL +A  VY SEFE FI FI NVF N+PFFI+A+ AGA  + +NEEY+E+ V
Sbjct  271  KLNRDQMNVLYEAAIVYTSEFETFITFISNVFANSPFFISADVAGASGSRENEEYKEIIV  330

Query  470  AAGKTHE-----------VSLTVEDINSYIAWDFSLIQGRLNLQD--IGFSMEY  348
             AG+T E           VSLTVE +NSYIAWDFS++QG+++++   +GF + +
Sbjct  331  QAGRTCESYLCQETWRNAVSLTVESVNSYIAWDFSVVQGKISMEPSALGFGLSF  384


 Score = 59.7 bits (143),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMA  701
            RQINDD+GPMEEQR RYGPPLYSLTKM 
Sbjct  226  RQINDDDGPMEEQRERYGPPLYSLTKMV  253



>gb|EMS49914.1| hypothetical protein TRIUR3_19770 [Triticum urartu]
Length=402

 Score =   110 bits (276),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 5/95 (5%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGN----VFVNAPFFITAEDAGAIEASKNEEYQ  483
            K+  + I VL++AV +Y  EF +F  FIGN    VFVNAPFFI+AEDAGA ++ KN+EY+
Sbjct  270  KIGKDDIAVLQQAVVIYTEEFGKFTTFIGNHCSEVFVNAPFFISAEDAGA-DSRKNDEYR  328

Query  482  EVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLN  378
            E  + AGKTHEV L+VE +NSYIAWDFSL QG L+
Sbjct  329  ETIIPAGKTHEVILSVEAVNSYIAWDFSLQQGALS  363


 Score = 57.0 bits (136),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQIND  GPME QR RYGP LY+LTK+ L +RL+L L
Sbjct  225  RQINDANGPMEVQRERYGPALYTLTKLVLAVRLYLHL  261



>gb|KDO37189.1| hypothetical protein CISIN_1g030723mg [Citrus sinensis]
Length=111

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            + + +Q+ +LE+AVDVY SEFE FIKFI  VF N+PFFI+AE AGA+E  KN+EY+E+++
Sbjct  5    RRKRHQVAILEQAVDVYTSEFESFIKFISGVFANSPFFISAEAAGALETRKNDEYKEITI  64

Query  470  AAGKTHEVSLTVEDINSYIAWDFSLIQGRLN  378
             AGK  EVS +V+ +NSYIAWDFS++QG+++
Sbjct  65   PAGKNFEVSFSVDSVNSYIAWDFSVVQGKIS  95



>ref|XP_004169546.1| PREDICTED: uncharacterized protein LOC101223675 [Cucumis sativus]
Length=78

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  371  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVD  192
            DIGFS+E E   G K  ILP++RYESDQGNFCTCMAG+YKL+WDN+YS+FF KVLRYKVD
Sbjct  4    DIGFSVECESPGGVKRLILPHKRYESDQGNFCTCMAGDYKLIWDNTYSTFFKKVLRYKVD  63

Query  191  CIPPVVESSASANQ  150
            CIPPVVE    A +
Sbjct  64   CIPPVVEPVQPAAE  77



>ref|XP_010231534.1| PREDICTED: uncharacterized protein LOC100826543 isoform X3 [Brachypodium 
distachyon]
Length=339

 Score = 76.3 bits (186),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K++ + + VL++AV +Y  EF +F  FIG VFVNAPFFI+AEDAGA ++  ++EY+E  +
Sbjct  270  KIEKDDLAVLQQAVVIYSEEFGKFTTFIGEVFVNAPFFISAEDAGA-DSRTSDEYRETII  328

Query  470  AAGKTHE  450
             AGKTHE
Sbjct  329  PAGKTHE  335


 Score = 57.4 bits (137),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQIND  GPME QR RYGP LY+LTK+ L IRL+L L
Sbjct  225  RQINDSNGPMEVQRERYGPALYTLTKLVLAIRLYLHL  261



>ref|XP_006296412.1| hypothetical protein CARUB_v10025590mg, partial [Capsella rubella]
 gb|EOA29310.1| hypothetical protein CARUB_v10025590mg, partial [Capsella rubella]
Length=55

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  371  DIGFSMEYEDSSGKKTPILPYRRYESDQGNFCTCMAGNYKLVWDNSYSSFFSKV  210
            DIGFS+EY  +SG+KT ILPYRR+E++QGNF T MAGNYKLVWDNSYS+FF KV
Sbjct  1    DIGFSVEYISASGEKTLILPYRRFEAEQGNFSTLMAGNYKLVWDNSYSTFFKKV  54



>ref|XP_007032242.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 ref|XP_007032244.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY03168.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY03170.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=309

 Score = 74.3 bits (181),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLK  656
            RQINDD+GPMEEQR RYGPPLY+LTK  L IRLFLSL WQ  +
Sbjct  226  RQINDDDGPMEEQRQRYGPPLYNLTKTVLIIRLFLSLAWQRFE  268


 Score = 40.0 bits (92),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFI  567
            EA KL  +QI VLE+AVDVY SEFER +  +
Sbjct  268  EAFKLNRHQISVLEEAVDVYTSEFERILDLV  298



>ref|XP_004353064.1| serpin, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR23536.1| serpin, putative [Acanthamoeba castellanii str. Neff]
Length=490

 Score = 70.1 bits (170),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 82/167 (49%), Gaps = 18/167 (11%)
 Frame = -3

Query  671  MAAPEAGKLQG---NQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEAS  501
            +AA ++  L G    ++  +EK V  Y  E   +++    +  N+PFF+T E  G +   
Sbjct  296  LAARKSELLDGKLVQEMQFVEKLVAAYDQEASAYLEQQIKILENSPFFVTKEQVGGLSGP  355

Query  500  KNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTP  321
              E  +EV VA  K HE  + VE     +AW+F L + +    DI F + +     K   
Sbjct  356  GEE--KEVLVA--KVHEEKIAVE-AGDEVAWEF-LTKNK----DIDFFVTFTKDGTKNEQ  405

Query  320  ILPYR-RYESD----QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  195
            I+  + RYES      GN    +AG YKLVWDNSYS    K L YKV
Sbjct  406  IVKAKERYESHVNKVTGNHGCGVAGTYKLVWDNSYSWLTKKQLVYKV  452


 Score = 36.2 bits (82),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKREN  647
            + +ND  GPMEE R R+GP  Y LT+      L+++ L+  +  ++
Sbjct  248  KTVNDTAGPMEELRIRFGPKSYFLTEFINASFLYMAALFHVVASDD  293



>gb|EMT26757.1| hypothetical protein F775_30139 [Aegilops tauschii]
Length=451

 Score = 57.0 bits (136),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSL  674
            RQIND  GPME QR RYGP LY+LTK+ L +RL+L L
Sbjct  358  RQINDANGPMEVQRERYGPALYTLTKLVLAVRLYLHL  394


 Score = 42.7 bits (99),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 33/68 (49%), Gaps = 21/68 (31%)
 Frame = -3

Query  650  KLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEYQEVSV  471
            K+  + I VL +AV +Y  EF +F  FIG                     KN+EY+E  +
Sbjct  403  KIGKDDIAVLHQAVVIYTEEFGKFTTFIG---------------------KNDEYRETII  441

Query  470  AAGKTHEV  447
             AGKTHEV
Sbjct  442  PAGKTHEV  449



>gb|EFN84723.1| SEC14-like protein 2 [Harpegnathos saltator]
Length=125

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  318
            NE+Y  V +  G+  E  ++  ++ S ++W+F     R    DI F +  +D+SG KT +
Sbjct  10   NEDYTTVVIRKGRKIEFDVSASEVGSILSWEF-----RSEGHDIKFGILRKDTSGTKTEV  64

Query  317  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASAN  153
            +P RR   ++S++     C +   Y +V+DN+YS   +K + Y V  +PP+ E+ AS +
Sbjct  65   IPIRRVASHQSEEIGILNCEVPAIYSIVFDNTYSFLRNKKVHYSVRVLPPMQETEASTS  123



>ref|XP_011139122.1| PREDICTED: SEC14-like protein 2 [Harpegnathos saltator]
Length=190

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 9/119 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  318
            NE+Y  V +  G+  E  ++  ++ S ++W+F     R    DI F +  +D+SG KT +
Sbjct  75   NEDYTTVVIRKGRKIEFDVSASEVGSILSWEF-----RSEGHDIKFGILRKDTSGTKTEV  129

Query  317  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASAN  153
            +P RR   ++S++     C +   Y +V+DN+YS   +K + Y V  +PP+ E+ AS +
Sbjct  130  IPIRRVASHQSEEIGILNCEVPAIYSIVFDNTYSFLRNKKVHYSVRVLPPMQETEASTS  188



>gb|AAF89109.1|AC074299_3 TEL1S.2 [Arabidopsis thaliana]
Length=88

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNL  375
            NEEY+E+ V AG+T+E+SL VE  NSYIAWDFSL QG++ +
Sbjct  28   NEEYKEIIVQAGRTYEISLMVESENSYIAWDFSLTQGKITM  68



>ref|XP_001702453.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96948.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=643

 Score = 45.1 bits (105),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = -3

Query  626  VLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAED  522
            V+E AV  YV +  R IKFIGNVF ++PF ++ ED
Sbjct  291  VVEPAVKFYVEQMLRVIKFIGNVFQHSPFILSKED  325


 Score = 41.6 bits (96),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLS  677
            ++IN   GPMEEQR +YGP LY +T + L + + L+
Sbjct  227  KEINAKLGPMEEQRIKYGPDLYGITTLGLRLTVCLA  262



>ref|XP_004163944.1| PREDICTED: uncharacterized LOC101218161 [Cucumis sativus]
Length=331

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 2/65 (3%)
 Frame = -1

Query  784  RQINDDEGPMEEQRHRYGPPLYSLTKMALNIRLFLSLLWQHLKRENYKGIKYLFWKKQWM  605
            ++INDD+GPMEEQR RYGPPLY LT M   IRL +SL W+       +  ++L   +Q +
Sbjct  226  QKINDDDGPMEEQRQRYGPPLYKLTTMVRLIRLCISLSWRRFDAGKLR--EHLGILEQAV  283

Query  604  SMYLS  590
             +Y S
Sbjct  284  DVYTS  288


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 5/58 (9%)
 Frame = -3

Query  659  EAGKLQGNQIPVLEKAVDVYVSEFERFIKFIGNVFVNAPFFITAEDAGAIEASKNEEY  486
            +AGKL+   + +LE+AVDVY SE ERF+ FI  VF NAPFFI+A+ A A     NE Y
Sbjct  268  DAGKLR-EHLGILEQAVDVYTSEIERFLGFIREVFNNAPFFISADVACA----ANERY  320



>ref|XP_001121498.2| PREDICTED: SEC14-like protein 2-like [Apis mellifera]
Length=335

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 58/110 (53%), Gaps = 9/110 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  318
             E +  V++  G   E+++T  +I S ++W+F     R    DI F +  +D +G +  +
Sbjct  220  KENFTTVTIKKGGKLELNMTALEIGSLLSWEF-----RTENHDIKFGIVKKDDNGMQKEV  274

Query  317  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
            +P RR   ++ D+    TC +   Y +V+DN+YS   +K + Y V  IPP
Sbjct  275  IPMRRVAAHQLDEIGILTCEVPSTYSIVFDNTYSIMRNKKIHYSVKVIPP  324



>ref|XP_002602154.1| hypothetical protein BRAFLDRAFT_234283 [Branchiostoma floridae]
 gb|EEN58166.1| hypothetical protein BRAFLDRAFT_234283, partial [Branchiostoma 
floridae]
Length=128

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 11/113 (10%)
 Frame = -3

Query  482  EVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTP--ILPY  309
            E+SV AG++  + + VE     + W+F     +   ++IGFS+ Y++S   +    ++P 
Sbjct  21   EMSVKAGRSFALPILVEAPGIVLCWEF-----QTEPKNIGFSVTYKESEAHEDSQVLIPM  75

Query  308  RRYESD----QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSA  162
             +  S     QG      AG Y L++DNSYS F SK L YK+    PV E+S+
Sbjct  76   CKCNSHRQAVQGELIAKRAGVYTLMFDNSYSRFTSKKLTYKLQVKRPVTEASS  128



>ref|XP_624865.3| PREDICTED: SEC14-like protein 2-like [Apis mellifera]
Length=391

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 58/110 (53%), Gaps = 9/110 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  318
             E +  V++  G   E+++T  +I S ++W+F     R    DI F +  +D +G +  +
Sbjct  276  KENFTTVTIKKGGKLELNMTALEIGSLLSWEF-----RTENHDIKFGIVKKDDNGMQKEV  330

Query  317  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
            +P RR   ++ D+    TC +   Y +V+DN+YS   +K + Y V  IPP
Sbjct  331  IPMRRVAAHQLDEIGILTCEVPSTYSIVFDNTYSIMRNKKIHYSVKVIPP  380



>gb|EFZ20476.1| hypothetical protein SINV_14001 [Solenopsis invicta]
Length=361

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 10/117 (9%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  321
            NE+Y  V V  G   E  ++  ++ S ++W+F     R    DI F +  +D++ G KT 
Sbjct  247  NEDYTTVVVRKGGKLEFDISAPEVGSILSWEF-----RSEGHDIKFGILKKDATNGIKTE  301

Query  320  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSA  162
            ++P RR   ++SD+    TC     Y +V+DN+YS   +K + Y V  +PP  E++ 
Sbjct  302  VIPIRRVASHQSDEIGILTCETQTTYSVVFDNTYSFLRNKKVHYSVRMLPPAREAAT  358



>ref|XP_011155993.1| PREDICTED: SEC14-like protein 2 [Solenopsis invicta]
Length=390

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 62/117 (53%), Gaps = 10/117 (9%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  321
            NE+Y  V V  G   E  ++  ++ S ++W+F     R    DI F +  +D++ G KT 
Sbjct  276  NEDYTTVVVRKGGKLEFDISAPEVGSILSWEF-----RSEGHDIKFGILKKDATNGIKTE  330

Query  320  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSA  162
            ++P RR   ++SD+    TC     Y +V+DN+YS   +K + Y V  +PP  E++ 
Sbjct  331  VIPIRRVASHQSDEIGILTCETQTTYSVVFDNTYSFLRNKKVHYSVRMLPPAREAAT  387



>ref|XP_003706144.1| PREDICTED: SEC14-like protein 2-like [Megachile rotundata]
Length=393

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 61/111 (55%), Gaps = 9/111 (8%)
 Frame = -3

Query  494  EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPIL  315
            ++Y  V++  G   E+ ++  ++ S ++W+F     R    DI F +  +D++G+K  ++
Sbjct  279  QDYTTVTIRKGGKLELDMSASEMGSLLSWEF-----RTEDHDIRFGILKKDTNGEKKEVI  333

Query  314  PYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVV  174
            P +R   ++ ++    TC +   Y +V+DNSYS   +K + Y +  IPP V
Sbjct  334  PMKRVAAHQLEEIGILTCEVPATYSVVFDNSYSILRNKKIHYSIRVIPPAV  384



>ref|XP_003698581.1| PREDICTED: SEC14-like protein 2-like [Apis florea]
Length=391

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 58/110 (53%), Gaps = 9/110 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  318
             E +  V++  G   E+++T  ++ SY +W+F     R    DI F +  +D +G +  +
Sbjct  276  KENFTTVTIKKGGKLELNITALEMGSYYSWEF-----RTENHDIKFGIVKKDDNGMQKEV  330

Query  317  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
            +P RR   ++ D+    TC +   Y +++DN+YS   +K + Y V  IPP
Sbjct  331  IPIRRVAAHQLDEIGILTCEVPSTYSIIFDNTYSIMRNKKIHYSVKVIPP  380



>gb|KJE98138.1| SEC14-like protein, variant [Capsaspora owczarzaki ATCC 30864]
Length=528

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (48%), Gaps = 12/117 (10%)
 Frame = -3

Query  512  IEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGF-------SM  354
            I A     YQE+++  G T  + + V+D ++ I WDF +  G     D+GF       S+
Sbjct  385  ISADHTAMYQEMAIGRGSTFRLPIQVKDADTVITWDFFVHSG----ADVGFGVFFTKDSI  440

Query  353  EYEDSSGKKTPILPYRRYE-SDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCI  186
            + E  + K   +    +Y+ S QG      AG Y L WDN+YS    K L Y VD I
Sbjct  441  DTEAHADKLEELEKSVKYKGSVQGTMVCQRAGQYVLRWDNTYSWVTPKTLSYHVDVI  497



>ref|XP_006609824.1| PREDICTED: SEC14-like protein 2-like isoform X1 [Apis dorsata]
 ref|XP_006609825.1| PREDICTED: SEC14-like protein 2-like isoform X2 [Apis dorsata]
 ref|XP_006609826.1| PREDICTED: SEC14-like protein 2-like isoform X3 [Apis dorsata]
Length=391

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 9/109 (8%)
 Frame = -3

Query  494  EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPIL  315
            E +  V++  G   E+++T  +  S ++W+F     R    DI F +  +D++G +  ++
Sbjct  277  ENFTTVTIKKGGKLELNMTALETGSLLSWEF-----RTENHDIKFGIVKKDNNGMQKEVI  331

Query  314  PYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
            P RR   ++ D+    TC +   Y +V+DN+YS   +K + Y V  IPP
Sbjct  332  PMRRVAAHQLDEIGILTCEVPSTYSIVFDNTYSIMRNKKIHYSVKVIPP  380



>ref|XP_011049938.1| PREDICTED: SEC14-like protein 2 [Acromyrmex echinatior]
 ref|XP_011049939.1| PREDICTED: SEC14-like protein 2 [Acromyrmex echinatior]
 ref|XP_011049940.1| PREDICTED: SEC14-like protein 2 [Acromyrmex echinatior]
 ref|XP_011049941.1| PREDICTED: SEC14-like protein 2 [Acromyrmex echinatior]
Length=388

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 10/111 (9%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  321
            NE+Y  V V  G   E  ++  ++ S ++W+F     R    DI F +  +D++ GKK  
Sbjct  276  NEDYTTVVVRKGGKLEFDISAPEVGSILSWEF-----RSEGHDIKFGILKKDATNGKKIE  330

Query  320  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
            ++P RR   ++SD+    TC     Y +V+DN+YS   +K + Y V  +PP
Sbjct  331  VIPIRRVASHQSDEIGLLTCETPTTYYVVFDNTYSILRNKKVHYSVRMLPP  381



>gb|EGI68383.1| SEC14-like protein 2 [Acromyrmex echinatior]
Length=375

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 59/111 (53%), Gaps = 10/111 (9%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  321
            NE+Y  V V  G   E  ++  ++ S ++W+F     R    DI F +  +D++ GKK  
Sbjct  263  NEDYTTVVVRKGGKLEFDISAPEVGSILSWEF-----RSEGHDIKFGILKKDATNGKKIE  317

Query  320  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
            ++P RR   ++SD+    TC     Y +V+DN+YS   +K + Y V  +PP
Sbjct  318  VIPIRRVASHQSDEIGLLTCETPTTYYVVFDNTYSILRNKKVHYSVRMLPP  368



>ref|XP_004342753.1| SEC14-like protein [Capsaspora owczarzaki ATCC 30864]
Length=629

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (48%), Gaps = 12/117 (10%)
 Frame = -3

Query  512  IEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGF-------SM  354
            I A     YQE+++  G T  + + V+D ++ I WDF +  G     D+GF       S+
Sbjct  486  ISADHTAMYQEMAIGRGSTFRLPIQVKDADTVITWDFFVHSG----ADVGFGVFFTKDSI  541

Query  353  EYEDSSGKKTPILPYRRYE-SDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCI  186
            + E  + K   +    +Y+ S QG      AG Y L WDN+YS    K L Y VD I
Sbjct  542  DTEAHADKLEELEKSVKYKGSVQGTMVCQRAGQYVLRWDNTYSWVTPKTLSYHVDVI  598



>gb|KJE98137.1| SEC14-like protein [Capsaspora owczarzaki ATCC 30864]
Length=644

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 56/117 (48%), Gaps = 12/117 (10%)
 Frame = -3

Query  512  IEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGF-------SM  354
            I A     YQE+++  G T  + + V+D ++ I WDF +  G     D+GF       S+
Sbjct  501  ISADHTAMYQEMAIGRGSTFRLPIQVKDADTVITWDFFVHSG----ADVGFGVFFTKDSI  556

Query  353  EYEDSSGKKTPILPYRRYE-SDQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCI  186
            + E  + K   +    +Y+ S QG      AG Y L WDN+YS    K L Y VD I
Sbjct  557  DTEAHADKLEELEKSVKYKGSVQGTMVCQRAGQYVLRWDNTYSWVTPKTLSYHVDVI  613



>ref|XP_011334815.1| PREDICTED: SEC14-like protein 2 isoform X2 [Cerapachys biroi]
Length=342

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 59/118 (50%), Gaps = 10/118 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  321
            NE+Y  V V  G   E  +   ++   ++W+F     R    DI F +  +D++ G +T 
Sbjct  227  NEDYTTVIVRKGGKLEFDIDTSEVGCILSWEF-----RSEDHDIKFGILKKDTANGTRTE  281

Query  320  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS  159
            ++P RR   ++SD+    TC     Y +V+DNSYS   +K + Y V  +PP  +   +
Sbjct  282  VIPLRRVASHQSDEVGVLTCETPATYSIVFDNSYSLLRNKKVHYAVRVLPPAEQQKVT  339



>ref|XP_011334812.1| PREDICTED: SEC14-like protein 2 isoform X1 [Cerapachys biroi]
 ref|XP_011334813.1| PREDICTED: SEC14-like protein 2 isoform X1 [Cerapachys biroi]
 ref|XP_011334814.1| PREDICTED: SEC14-like protein 2 isoform X1 [Cerapachys biroi]
 gb|EZA56876.1| SEC14-like protein [Cerapachys biroi]
Length=391

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 10/120 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  321
            NE+Y  V V  G   E  +   ++   ++W+F     R    DI F +  +D++ G +T 
Sbjct  276  NEDYTTVIVRKGGKLEFDIDTSEVGCILSWEF-----RSEDHDIKFGILKKDTANGTRTE  330

Query  320  ILPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASAN  153
            ++P RR   ++SD+    TC     Y +V+DNSYS   +K + Y V  +PP  +   +  
Sbjct  331  VIPLRRVASHQSDEVGVLTCETPATYSIVFDNSYSLLRNKKVHYAVRVLPPAEQQKVTVK  390



>gb|EFX85554.1| hypothetical protein DAPPUDRAFT_300280 [Daphnia pulex]
Length=389

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 54/99 (55%), Gaps = 10/99 (10%)
 Frame = -3

Query  479  VSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPILPYRRY  300
            +S+A G   ++   V+D N+ + WDF   +G     DIGF++ Y   SG+  P +PY R 
Sbjct  286  LSIANGSKEQLQFQVKDANTLLKWDFQSEEG-----DIGFAV-YRKKSGELIPFVPYDRV  339

Query  299  ES----DQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  195
            +     ++G      AG+Y L +DNS+S F SK + Y +
Sbjct  340  DCQMSPEEGEIHCEYAGHYVLEFDNSFSYFRSKKIWYSI  378



>ref|XP_003394555.1| PREDICTED: LOW QUALITY PROTEIN: SEC14-like protein 2-like [Bombus 
terrestris]
Length=394

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 56/110 (51%), Gaps = 9/110 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  318
             E +  V++  G   E+ +   ++ S ++W+F     R    DI F +  +D +G +  +
Sbjct  279  KENFTTVTIKKGGKLELDIPASEMGSLLSWEF-----RTENHDIKFGIVKKDYNGTQKEV  333

Query  317  LPYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
            +P RR   ++ D+    TC +   Y +++DN+YS   +K + Y V  IPP
Sbjct  334  IPMRRVAAHQLDEIGILTCEVPSTYSIIFDNTYSIIRNKKIHYSVKVIPP  383



>emb|CDW51773.1| CRAL TRIO domain containing protein [Trichuris trichiura]
Length=329

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (54%), Gaps = 14/114 (12%)
 Frame = -3

Query  509  EASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEY---EDS  339
            E++  E Y EV+V AG  H V ++V++  S + W +     +   +DIGF++ +   E++
Sbjct  216  ESNDKESYTEVTVYAGHNHLVEISVDEAGSELYWKY-----KTTGEDIGFAVYFTDNEEA  270

Query  338  SGKKT--PILPYRRYESD----QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  195
            +  KT  P+ PY R+E      +G      AG Y + +DN YS F +K L Y +
Sbjct  271  TDIKTMEPLFPYIRFECALVPIEGALVCEKAGRYIVEFDNCYSWFSAKELSYVI  324



>ref|XP_003486550.1| PREDICTED: SEC14-like protein 2-like [Bombus impatiens]
Length=394

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 57/120 (48%), Gaps = 9/120 (8%)
 Frame = -3

Query  494  EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPIL  315
            E +  V++  G   E+ +   ++ S ++W+F     R    DI F +  +D +G +  ++
Sbjct  280  ENFTTVTIKKGGKLELDIPASEMGSLLSWEF-----RTENHDIRFGIVKKDYNGTQKEVI  334

Query  314  PYRR---YESDQGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASANQL  147
            P RR   ++ D+     C +   Y +++DN+YS   +K + Y V  IPP      +   L
Sbjct  335  PMRRVAAHQLDEIGILICEVPSTYSIIFDNTYSIIRNKKIHYSVKVIPPTESQEITPTTL  394



>ref|XP_011307420.1| PREDICTED: SEC14-like protein 2 [Fopius arisanus]
Length=241

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 53/111 (48%), Gaps = 9/111 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPI  318
            NE++  V V  G   ++    E + S ++W+F     R    DI F +    + G+K  +
Sbjct  125  NEDFTTVIVKKGDKMKIDFVPEKLGSILSWEF-----RSENHDIRFGVLRRGTGGEKVEL  179

Query  317  LPYRR---YESDQGNFCTCM-AGNYKLVWDNSYSSFFSKVLRYKVDCIPPV  177
            +P RR   ++ D+    TC   G Y +V+DNSYS   +K + Y V    P 
Sbjct  180  IPVRRVAAHQLDEVGVLTCEEPGTYSVVFDNSYSLLRNKKIHYNVRLAEPT  230



>gb|EFN74196.1| SEC14-like protein 2 [Camponotus floridanus]
Length=448

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 10/120 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  321
            N+++  V V  G   E  ++     S ++W+F     R    DI F +  +D++ G +T 
Sbjct  332  NDDFTSVVVRKGGKLEFDISAPIKGSMLSWEF-----RSEGHDIKFGILKKDTTNGTQTE  386

Query  320  ILPYRR---YESDQGNFCTCM-AGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASAN  153
            ++P R+   ++SD+    TC     Y +V+DN+YS   +K L Y V  +PP  E    A+
Sbjct  387  VIPIRKVASHQSDEIGVLTCEDPATYSIVFDNTYSLLRNKKLHYSVRILPPTKELQEMAS  446



>ref|XP_008201186.1| PREDICTED: SEC14-like protein 3, partial [Tribolium castaneum]
Length=389

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = -3

Query  506  ASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKK  327
            +S   ++    +  G+  ++   V +  S++ W+F     R    DI F +   D+ G  
Sbjct  255  SSTTRQFTTAVIKKGEKLKLDFIVVEEGSFLKWEF-----RTEAHDIRFGISLIDAEGNV  309

Query  326  TPILPYRR---YESDQGNFCTCMA-GNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS  159
            TP++ ++R   ++ D+     C A   Y + +DN+YS   SK + Y++   PP+ +    
Sbjct  310  TPVIHHKRVAAHQIDESGVIACQAPATYTVTFDNTYSLLRSKKIHYEIHIAPPLGKLDIL  369

Query  158  ANQLE  144
             N+ E
Sbjct  370  PNEDE  374



>gb|EFA12792.1| hypothetical protein TcasGA2_TC002162 [Tribolium castaneum]
Length=409

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 9/125 (7%)
 Frame = -3

Query  506  ASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKK  327
            +S   ++    +  G+  ++   V +  S++ W+F     R    DI F +   D+ G  
Sbjct  275  SSTTRQFTTAVIKKGEKLKLDFIVVEEGSFLKWEF-----RTEAHDIRFGISLIDAEGNV  329

Query  326  TPILPYRR---YESDQGNFCTCMA-GNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSAS  159
            TP++ ++R   ++ D+     C A   Y + +DN+YS   SK + Y++   PP+ +    
Sbjct  330  TPVIHHKRVAAHQIDESGVIACQAPATYTVTFDNTYSLLRSKKIHYEIHIAPPLGKLDIL  389

Query  158  ANQLE  144
             N+ E
Sbjct  390  PNEDE  394



>ref|XP_011259189.1| PREDICTED: SEC14-like protein 2 isoform X1 [Camponotus floridanus]
Length=433

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 10/120 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  321
            N+++  V V  G   E  ++     S ++W+F     R    DI F +  +D++ G +T 
Sbjct  317  NDDFTSVVVRKGGKLEFDISAPIKGSMLSWEF-----RSEGHDIKFGILKKDTTNGTQTE  371

Query  320  ILPYRR---YESDQGNFCTCM-AGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASAN  153
            ++P R+   ++SD+    TC     Y +V+DN+YS   +K L Y V  +PP  E    A+
Sbjct  372  VIPIRKVASHQSDEIGVLTCEDPATYSIVFDNTYSLLRNKKLHYSVRILPPTKELQEMAS  431



>ref|XP_011259195.1| PREDICTED: SEC14-like protein 2 isoform X2 [Camponotus floridanus]
Length=394

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 10/120 (8%)
 Frame = -3

Query  497  NEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSS-GKKTP  321
            N+++  V V  G   E  ++     S ++W+F     R    DI F +  +D++ G +T 
Sbjct  278  NDDFTSVVVRKGGKLEFDISAPIKGSMLSWEF-----RSEGHDIKFGILKKDTTNGTQTE  332

Query  320  ILPYRR---YESDQGNFCTCM-AGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVESSASAN  153
            ++P R+   ++SD+    TC     Y +V+DN+YS   +K L Y V  +PP  E    A+
Sbjct  333  VIPIRKVASHQSDEIGVLTCEDPATYSIVFDNTYSLLRNKKLHYSVRILPPTKELQEMAS  392



>gb|KFD58027.1| hypothetical protein M513_01260 [Trichuris suis]
 gb|KFD70789.1| hypothetical protein M514_01260 [Trichuris suis]
Length=383

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 57/114 (50%), Gaps = 14/114 (12%)
 Frame = -3

Query  509  EASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGK  330
            E++  E Y EV+V AG  H V ++V++  S + W +     +   +DIGF++ + D+   
Sbjct  270  ESNDKESYTEVTVYAGHNHLVEVSVDEAGSELYWKY-----KTTGEDIGFAVYFTDNEEA  324

Query  329  KT-----PILPYRRYESD----QGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKV  195
                   P+ PY R+E      +G      AG Y + +DN YS F +K L Y +
Sbjct  325  TDIKVMEPLFPYIRFECALVPIEGALVCEKAGRYIVEFDNCYSWFSAKELSYVI  378



>ref|XP_003724076.1| PREDICTED: FYVE and coiled-coil domain-containing protein 1-like 
isoform 1 [Strongylocentrotus purpuratus]
Length=1575

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 12/109 (11%)
 Frame = -3

Query  485   QEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTP---IL  315
             +EV+VAA + H + + + D+   + W+F       + + IGFS+ ++DSS   +P   ++
Sbjct  1468  EEVTVAAYQKHNLPVAINDVGLMLCWEFVS-----SPKSIGFSVIFQDSSDSTSPHEELI  1522

Query  314   PYRRYESDQ----GNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
             P  +  S Q    G       G Y L++DN +S F SKV++Y +    P
Sbjct  1523  PLCKCNSHQHAVQGELLARKPGVYTLIFDNKFSRFTSKVVKYSLHIKRP  1571



>ref|XP_780082.3| PREDICTED: FYVE and coiled-coil domain-containing protein 1-like 
isoform 2 [Strongylocentrotus purpuratus]
Length=1599

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 12/109 (11%)
 Frame = -3

Query  485   QEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTP---IL  315
             +EV+VAA + H + + + D+   + W+F       + + IGFS+ ++DSS   +P   ++
Sbjct  1492  EEVTVAAYQKHNLPVAINDVGLMLCWEFVS-----SPKSIGFSVIFQDSSDSTSPHEELI  1546

Query  314   PYRRYESDQ----GNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
             P  +  S Q    G       G Y L++DN +S F SKV++Y +    P
Sbjct  1547  PLCKCNSHQHAVQGELLARKPGVYTLIFDNKFSRFTSKVVKYSLHIKRP  1595



>ref|XP_002116332.1| hypothetical protein TRIADDRAFT_60316 [Trichoplax adhaerens]
 gb|EDV21365.1| hypothetical protein TRIADDRAFT_60316 [Trichoplax adhaerens]
Length=368

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = -3

Query  512  IEASKNEEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFS----MEYE  345
            + +   E+Y  V++A G T ++   +    + + W+F     +    +IGF     +E E
Sbjct  249  VNSRSEEDYSTVTIARGDTLKLQFDINIPGTLMKWEF-----KTENHNIGFGVVKVIENE  303

Query  344  DSSGKKTPILPYRRYES----DQGNFCTCMAGNYKLVWDNSYSSFFSKVLRYKVDCIPP  180
            D + +   ++P  R       ++GN+    AG Y L +DNS+S    K L Y +D +PP
Sbjct  304  DGTIENYEVIPIARRSCQSTLEEGNYYCEDAGTYILCFDNSFSWLTGKSLHYAIDILPP  362



>ref|XP_003747619.1| PREDICTED: SEC14-like protein 2-like [Metaseiulus occidentalis]
Length=401

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 14/126 (11%)
 Frame = -3

Query  494  EEYQEVSVAAGKTHEVSLTVEDINSYIAWDFSLIQGRLNLQDIGFSMEYEDSSGKKTPIL  315
            E  + + ++   +H++ L VE+  S I W F     R N  D+GF++  + + G     +
Sbjct  279  ENAKTIKLSKRSSHKIELPVENEGSVINWTF-----RTNGHDLGFALLRKKNDGSLEGCV  333

Query  314  PYRRYESD---QGNFCTC-MAGNYKLVWDNSYSSFFSKVLRYKVDCIPPVVE-----SSA  162
            P  R +     +  F TC ++G Y   +DNSYS F  K + + V+  PP  E     S A
Sbjct  334  PSTRVDCHVLPEEGFYTCNVSGTYIFKFDNSYSWFTDKTVTFDVNVAPPSDELEKTSSVA  393

Query  161  SANQLE  144
              NQ++
Sbjct  394  LENQIK  399



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150