BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020N16

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610468.1|  PREDICTED: CTD nuclear envelope phosphatase ...    325   3e-107   Nicotiana tomentosiformis
ref|XP_009760936.1|  PREDICTED: CTD nuclear envelope phosphatase ...    320   2e-105   Nicotiana sylvestris
ref|XP_004240939.1|  PREDICTED: CTD nuclear envelope phosphatase ...    318   9e-105   Solanum lycopersicum
ref|XP_006338842.1|  PREDICTED: CTD small phosphatase-like protei...    316   9e-104   Solanum tuberosum [potatoes]
emb|CDP14017.1|  unnamed protein product                                313   6e-103   Coffea canephora [robusta coffee]
gb|EYU20007.1|  hypothetical protein MIMGU_mgv1a010325mg                312   2e-102   Erythranthe guttata [common monkey flower]
ref|XP_011076695.1|  PREDICTED: CTD small phosphatase-like protein      310   1e-100   Sesamum indicum [beniseed]
ref|XP_009622999.1|  PREDICTED: CTD small phosphatase-like protein 2    306   3e-100   Nicotiana tomentosiformis
ref|XP_010689631.1|  PREDICTED: CTD nuclear envelope phosphatase ...    306   5e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008463241.1|  PREDICTED: carboxy-terminal domain RNA polym...    305   1e-99    Cucumis melo [Oriental melon]
ref|XP_009616349.1|  PREDICTED: uncharacterized protein C2F7.02c-...    302   2e-99    
ref|XP_004149232.1|  PREDICTED: CTD small phosphatase-like protei...    301   2e-98    Cucumis sativus [cucumbers]
ref|XP_011084905.1|  PREDICTED: LOW QUALITY PROTEIN: CTD nuclear ...    301   3e-98    
gb|KDP44760.1|  hypothetical protein JCGZ_01260                         301   3e-98    Jatropha curcas
ref|XP_004491033.1|  PREDICTED: CTD small phosphatase-like protei...    298   4e-97    Cicer arietinum [garbanzo]
ref|XP_006355653.1|  PREDICTED: CTD small phosphatase-like protei...    298   6e-97    Solanum tuberosum [potatoes]
gb|KHN48568.1|  CTD small phosphatase-like protein 2                    297   1e-96    Glycine soja [wild soybean]
ref|XP_010535319.1|  PREDICTED: carboxy-terminal domain RNA polym...    296   3e-96    Tarenaya hassleriana [spider flower]
ref|NP_001242244.1|  uncharacterized protein LOC100783451               295   5e-96    Glycine max [soybeans]
ref|XP_010534600.1|  PREDICTED: CTD small phosphatase-like protein      295   1e-95    Tarenaya hassleriana [spider flower]
ref|XP_007141764.1|  hypothetical protein PHAVU_008G223800g             295   1e-95    Phaseolus vulgaris [French bean]
ref|XP_011035940.1|  PREDICTED: CTD nuclear envelope phosphatase 1      293   3e-95    Populus euphratica
gb|KHN20843.1|  CTD small phosphatase-like protein 2                    293   4e-95    Glycine soja [wild soybean]
gb|KDP24445.1|  hypothetical protein JCGZ_25009                         293   4e-95    Jatropha curcas
ref|XP_004239942.1|  PREDICTED: carboxy-terminal domain RNA polym...    293   6e-95    Solanum lycopersicum
ref|XP_011046823.1|  PREDICTED: CTD nuclear envelope phosphatase ...    292   7e-95    Populus euphratica
ref|XP_006378658.1|  hypothetical protein POPTR_0010s19580g             292   7e-95    Populus trichocarpa [western balsam poplar]
ref|XP_010095241.1|  CTD small phosphatase-like protein 2               289   1e-94    
ref|XP_010067527.1|  PREDICTED: CTD small phosphatase-like protein      291   2e-94    Eucalyptus grandis [rose gum]
emb|CAN64082.1|  hypothetical protein VITISV_006933                     288   2e-94    Vitis vinifera
ref|XP_003545230.1|  PREDICTED: LOW QUALITY PROTEIN: carboxy-term...    294   3e-94    
ref|XP_002273682.1|  PREDICTED: carboxy-terminal domain RNA polym...    290   2e-93    Vitis vinifera
ref|XP_009385548.1|  PREDICTED: carboxy-terminal domain RNA polym...    289   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003616639.1|  CTD small phosphatase-like protein                 289   2e-93    Medicago truncatula
ref|XP_008805431.1|  PREDICTED: carboxy-terminal domain RNA polym...    288   2e-93    Phoenix dactylifera
gb|EPS72976.1|  hypothetical protein M569_01780                         288   6e-93    Genlisea aurea
ref|XP_010922553.1|  PREDICTED: CTD small phosphatase-like protein 2    287   1e-92    Elaeis guineensis
ref|XP_004307664.1|  PREDICTED: CTD nuclear envelope phosphatase ...    286   2e-92    Fragaria vesca subsp. vesca
ref|XP_009377758.1|  PREDICTED: carboxy-terminal domain RNA polym...    285   3e-92    Pyrus x bretschneideri [bai li]
gb|KFK34835.1|  hypothetical protein AALP_AA5G199300                    285   5e-92    Arabis alpina [alpine rockcress]
gb|KJB78769.1|  hypothetical protein B456_013G018000                    285   6e-92    Gossypium raimondii
ref|XP_008345306.1|  PREDICTED: probable C-terminal domain small ...    285   6e-92    Malus domestica [apple tree]
ref|XP_007008962.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    284   2e-91    
ref|XP_002878054.1|  NLI interacting factor family protein              283   4e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_009369172.1|  PREDICTED: probable C-terminal domain small ...    283   4e-91    Pyrus x bretschneideri [bai li]
ref|XP_004302575.1|  PREDICTED: carboxy-terminal domain RNA polym...    282   8e-91    Fragaria vesca subsp. vesca
ref|XP_010427400.1|  PREDICTED: carboxy-terminal domain RNA polym...    282   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_004970462.1|  PREDICTED: CTD small phosphatase-like protei...    282   1e-90    Setaria italica
gb|EMS66920.1|  CTD small phosphatase-like protein 2                    279   1e-90    Triticum urartu
emb|CDX67629.1|  BnaA07g16690D                                          281   1e-90    
ref|XP_007205648.1|  hypothetical protein PRUPE_ppa009333mg             281   1e-90    Prunus persica
gb|KHG26952.1|  ctdspl2                                                 281   2e-90    Gossypium arboreum [tree cotton]
gb|ACG32959.1|  CTD small phosphatase-like protein                      281   2e-90    Zea mays [maize]
gb|KFK23193.1|  hypothetical protein AALP_AAs48948U000100               281   2e-90    Arabis alpina [alpine rockcress]
ref|XP_009344958.1|  PREDICTED: carboxy-terminal domain RNA polym...    281   2e-90    Pyrus x bretschneideri [bai li]
ref|XP_006403042.1|  hypothetical protein EUTSA_v10006119mg             281   2e-90    Eutrema salsugineum [saltwater cress]
ref|XP_010516189.1|  PREDICTED: carboxy-terminal domain RNA polym...    281   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006429395.1|  hypothetical protein CICLE_v10012210mg             281   3e-90    Citrus clementina [clementine]
ref|XP_008374036.1|  PREDICTED: CTD small phosphatase-like protein      281   3e-90    Malus domestica [apple tree]
ref|XP_010504466.1|  PREDICTED: carboxy-terminal domain RNA polym...    281   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_006481044.1|  PREDICTED: CTD small phosphatase-like protei...    281   4e-90    Citrus sinensis [apfelsine]
emb|CDY46516.1|  BnaC06g15690D                                          280   4e-90    Brassica napus [oilseed rape]
ref|XP_006291562.1|  hypothetical protein CARUB_v10017717mg             280   4e-90    Capsella rubella
ref|XP_008672265.1|  PREDICTED: uncharacterized protein LOC100216...    282   5e-90    Zea mays [maize]
ref|NP_001136647.1|  uncharacterized protein LOC100216776               282   5e-90    Zea mays [maize]
gb|KDO56645.1|  hypothetical protein CISIN_1g020937mg                   281   5e-90    Citrus sinensis [apfelsine]
ref|XP_009103976.1|  PREDICTED: CTD small phosphatase-like protein      280   6e-90    Brassica rapa
gb|EEC71746.1|  hypothetical protein OsI_04315                          280   8e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_002458718.1|  hypothetical protein SORBIDRAFT_03g038910          280   8e-90    Sorghum bicolor [broomcorn]
ref|NP_001148462.1|  LOC100282077                                       280   1e-89    Zea mays [maize]
ref|NP_191155.1|  Haloacid dehalogenase-like hydrolase (HAD) supe...    279   1e-89    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ91589.1|  predicted protein                                      280   1e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT13698.1|  CTD small phosphatase-like protein 2                    280   1e-89    
emb|CDM84840.1|  unnamed protein product                                280   1e-89    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001044710.1|  Os01g0833100                                       280   1e-89    
ref|XP_009116289.1|  PREDICTED: CTD small phosphatase-like protei...    279   1e-89    Brassica rapa
ref|XP_008243657.1|  PREDICTED: carboxy-terminal domain RNA polym...    279   1e-89    Prunus mume [ume]
ref|XP_010264631.1|  PREDICTED: CTD nuclear envelope phosphatase ...    279   2e-89    Nelumbo nucifera [Indian lotus]
emb|CDX72186.1|  BnaC08g26880D                                          278   2e-89    
ref|XP_003564541.1|  PREDICTED: CTD small phosphatase-like protein      278   4e-89    Brachypodium distachyon [annual false brome]
ref|XP_006646453.1|  PREDICTED: CTD small phosphatase-like protei...    277   4e-89    
ref|XP_008370102.1|  PREDICTED: carboxy-terminal domain RNA polym...    277   6e-89    
ref|XP_006435743.1|  hypothetical protein CICLE_v10031856mg             280   7e-89    Citrus clementina [clementine]
gb|KDO68952.1|  hypothetical protein CISIN_1g022258mg                   277   7e-89    Citrus sinensis [apfelsine]
ref|XP_010044096.1|  PREDICTED: CTD small phosphatase-like protein      276   4e-88    Eucalyptus grandis [rose gum]
gb|AFK34480.1|  unknown                                                 275   4e-88    Lotus japonicus
tpg|DAA56990.1|  TPA: hypothetical protein ZEAMMB73_478385              270   5e-88    
emb|CDX93216.1|  BnaC04g46800D                                          275   5e-88    
ref|XP_003600913.1|  CTD small phosphatase-like protein                 274   6e-88    Medicago truncatula
emb|CDY27252.1|  BnaA09g35500D                                          275   7e-88    Brassica napus [oilseed rape]
ref|XP_009116288.1|  PREDICTED: CTD small phosphatase-like protei...    274   8e-88    Brassica rapa
ref|XP_009141872.1|  PREDICTED: carboxy-terminal domain RNA polym...    275   8e-88    Brassica rapa
ref|XP_010920860.1|  PREDICTED: carboxy-terminal domain RNA polym...    274   2e-87    
ref|XP_004500494.1|  PREDICTED: probable C-terminal domain small ...    271   5e-87    Cicer arietinum [garbanzo]
ref|XP_002265560.1|  PREDICTED: CTD small phosphatase-like protein      272   1e-86    Vitis vinifera
gb|KDO68954.1|  hypothetical protein CISIN_1g022258mg                   271   1e-86    Citrus sinensis [apfelsine]
ref|XP_007218742.1|  hypothetical protein PRUPE_ppa009189mg             271   2e-86    Prunus persica
ref|XP_002528087.1|  conserved hypothetical protein                     270   3e-86    
gb|KJB74327.1|  hypothetical protein B456_011G288400                    270   5e-86    Gossypium raimondii
emb|CDY07060.1|  BnaA04g22550D                                          270   7e-86    
ref|XP_008793248.1|  PREDICTED: carboxy-terminal domain RNA polym...    269   1e-85    Phoenix dactylifera
ref|XP_002309143.2|  hypothetical protein POPTR_0006s10170g             270   2e-85    Populus trichocarpa [western balsam poplar]
ref|XP_002439933.1|  hypothetical protein SORBIDRAFT_09g022940          268   2e-85    Sorghum bicolor [broomcorn]
ref|XP_006655392.1|  PREDICTED: CTD small phosphatase-like protei...    268   2e-85    Oryza brachyantha
ref|XP_006294652.1|  hypothetical protein CARUB_v10023688mg             268   3e-85    
ref|XP_009406928.1|  PREDICTED: CTD nuclear envelope phosphatase ...    268   4e-85    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK00193.1|  predicted protein                                      267   4e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011019110.1|  PREDICTED: carboxy-terminal domain RNA polym...    268   5e-85    Populus euphratica
ref|XP_010508910.1|  PREDICTED: probable C-terminal domain small ...    268   5e-85    Camelina sativa [gold-of-pleasure]
ref|XP_009416286.1|  PREDICTED: CTD nuclear envelope phosphatase ...    267   6e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805436.1|  PREDICTED: carboxy-terminal domain RNA polym...    266   9e-85    Phoenix dactylifera
ref|XP_010505730.1|  PREDICTED: CTD small phosphatase-like protei...    267   9e-85    Camelina sativa [gold-of-pleasure]
ref|XP_009392189.1|  PREDICTED: CTD nuclear envelope phosphatase ...    267   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010505729.1|  PREDICTED: CTD small phosphatase-like protei...    267   1e-84    
ref|XP_006411263.1|  hypothetical protein EUTSA_v10016941mg             267   1e-84    Eutrema salsugineum [saltwater cress]
ref|XP_010517420.1|  PREDICTED: CTD nuclear envelope phosphatase ...    266   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010517419.1|  PREDICTED: CTD nuclear envelope phosphatase ...    267   1e-84    
ref|XP_010505722.1|  PREDICTED: CTD small phosphatase-like protei...    267   2e-84    
ref|XP_010505726.1|  PREDICTED: CTD small phosphatase-like protei...    266   2e-84    
ref|XP_010101420.1|  CTD small phosphatase-like protein                 265   4e-84    Morus notabilis
ref|XP_008442416.1|  PREDICTED: CTD small phosphatase-like protein 2    265   5e-84    Cucumis melo [Oriental melon]
ref|XP_010517418.1|  PREDICTED: CTD nuclear envelope phosphatase ...    266   6e-84    
ref|XP_010508909.1|  PREDICTED: CTD small phosphatase-like protei...    267   6e-84    
ref|XP_010517411.1|  PREDICTED: CTD nuclear envelope phosphatase ...    266   6e-84    
ref|XP_004961795.1|  PREDICTED: CTD small phosphatase-like protei...    264   9e-84    Setaria italica
ref|XP_004137719.1|  PREDICTED: CTD small phosphatase-like protei...    264   1e-83    Cucumis sativus [cucumbers]
ref|XP_011019111.1|  PREDICTED: carboxy-terminal domain RNA polym...    261   2e-82    Populus euphratica
gb|EAY98360.1|  hypothetical protein OsI_20271                          259   1e-81    Oryza sativa Indica Group [Indian rice]
gb|EEE64021.1|  hypothetical protein OsJ_18850                          258   5e-81    Oryza sativa Japonica Group [Japonica rice]
gb|KHG26951.1|  putative phosphatase PSR2                               256   2e-80    Gossypium arboreum [tree cotton]
ref|XP_002323581.2|  hypothetical protein POPTR_0016s12400g             251   5e-79    Populus trichocarpa [western balsam poplar]
ref|XP_008370103.1|  PREDICTED: carboxy-terminal domain RNA polym...    248   8e-78    
gb|EMT12311.1|  CTD small phosphatase-like protein 2                    250   1e-77    
ref|XP_011019112.1|  PREDICTED: CTD small phosphatase-like protei...    244   2e-76    Populus euphratica
ref|XP_002315157.2|  NLI interacting factor family protein              244   2e-76    
ref|XP_002312160.2|  NLI interacting factor family protein              244   5e-76    
gb|KDO68955.1|  hypothetical protein CISIN_1g022258mg                   241   7e-75    Citrus sinensis [apfelsine]
gb|KJB74328.1|  hypothetical protein B456_011G288400                    237   2e-73    Gossypium raimondii
ref|XP_006843565.1|  hypothetical protein AMTR_s00007p00087260          233   3e-72    
gb|KCW65681.1|  hypothetical protein EUGRSUZ_G03062                     232   5e-72    Eucalyptus grandis [rose gum]
ref|XP_006294651.1|  hypothetical protein CARUB_v10023688mg             211   2e-63    
ref|XP_002990146.1|  hypothetical protein SELMODRAFT_131171             209   2e-63    
ref|XP_010231274.1|  PREDICTED: uncharacterized protein LOC100829084    210   3e-63    Brachypodium distachyon [annual false brome]
ref|XP_002992543.1|  hypothetical protein SELMODRAFT_135380             208   4e-63    
ref|XP_010517421.1|  PREDICTED: CTD nuclear envelope phosphatase ...    206   2e-61    Camelina sativa [gold-of-pleasure]
gb|AAT58765.1|  unknown protein, contains NLI interacting factor-...    191   1e-55    Oryza sativa Japonica Group [Japonica rice]
gb|AAW22871.1|  hypothetical protein 56B23-g1                           161   3e-46    Solanum lycopersicum
ref|XP_009609474.1|  PREDICTED: mitochondrial import inner membra...    157   8e-45    Nicotiana tomentosiformis
ref|XP_009762549.1|  PREDICTED: mitochondrial import inner membra...    155   1e-43    Nicotiana sylvestris
ref|XP_009610469.1|  PREDICTED: nuclear envelope morphology prote...    158   5e-43    Nicotiana tomentosiformis
ref|XP_009760937.1|  PREDICTED: nuclear envelope morphology prote...    153   4e-41    Nicotiana sylvestris
ref|XP_009805067.1|  PREDICTED: CTD small phosphatase-like protei...    150   9e-41    Nicotiana sylvestris
ref|XP_009805066.1|  PREDICTED: CTD small phosphatase-like protei...    150   2e-40    Nicotiana sylvestris
ref|XP_005648282.1|  hypothetical protein COCSUDRAFT_63263              149   2e-40    Coccomyxa subellipsoidea C-169
gb|KDO56646.1|  hypothetical protein CISIN_1g020937mg                   149   4e-40    Citrus sinensis [apfelsine]
ref|XP_002533382.1|  conserved hypothetical protein                     149   2e-39    
ref|XP_001699661.1|  hypothetical protein CHLREDRAFT_111940             144   2e-38    Chlamydomonas reinhardtii
gb|KCW86105.1|  hypothetical protein EUGRSUZ_B02803                     144   3e-38    Eucalyptus grandis [rose gum]
ref|XP_002501116.1|  predicted protein                                  141   4e-38    Micromonas commoda
emb|CAN74278.1|  hypothetical protein VITISV_004711                     147   1e-37    Vitis vinifera
gb|AFW82277.1|  hypothetical protein ZEAMMB73_719646                    144   1e-37    
ref|XP_007008963.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    142   1e-37    
emb|CDP11904.1|  unnamed protein product                                127   3e-33    Coffea canephora [robusta coffee]
ref|XP_008656380.1|  PREDICTED: probable phosphatase PSR2 isoform X1    124   6e-31    
ref|XP_008388217.1|  PREDICTED: uncharacterized protein LOC103450630    114   5e-27    
ref|XP_002956598.1|  hypothetical protein VOLCADRAFT_36131              107   3e-25    Volvox carteri f. nagariensis
ref|XP_011401617.1|  CTD small phosphatase-like protein                 108   4e-25    Auxenochlorella protothecoides
gb|KIZ04779.1|  hypothetical protein MNEG_3173                          113   9e-25    Monoraphidium neglectum
ref|XP_005845048.1|  hypothetical protein CHLNCDRAFT_137319             107   1e-22    Chlorella variabilis
ref|XP_007141763.1|  hypothetical protein PHAVU_008G223800g           99.8    1e-21    Phaseolus vulgaris [French bean]
gb|KJB74329.1|  hypothetical protein B456_011G288400                    100   2e-21    Gossypium raimondii
ref|XP_008895497.1|  hypothetical protein PPTG_04907                  99.0    4e-21    Phytophthora parasitica INRA-310
ref|XP_008614870.1|  hypothetical protein SDRG_10647                  98.6    4e-21    Saprolegnia diclina VS20
ref|XP_009538580.1|  hypothetical protein PHYSODRAFT_551168           98.6    5e-21    Phytophthora sojae
ref|WP_028833278.1|  hypothetical protein                             98.2    6e-21    
gb|KDO32623.1|  hypothetical protein SPRG_02324                       98.2    6e-21    Saprolegnia parasitica CBS 223.65
ref|XP_009834767.1|  hypothetical protein H257_10034                  97.8    1e-20    Aphanomyces astaci
gb|AAV63941.1|  putative nuclear LIM factor interactor-interactin...  97.8    1e-20    Phytophthora infestans [potato late blight]
gb|ETO67065.1|  hypothetical protein F444_15879                       97.8    1e-20    Phytophthora parasitica P1976
gb|ETI38295.1|  hypothetical protein F443_15895                       97.4    1e-20    Phytophthora parasitica P1569
ref|XP_008864818.1|  hypothetical protein H310_02908                  97.4    1e-20    Aphanomyces invadans
gb|KFK44809.1|  hypothetical protein AALP_AA1G305500                  96.3    2e-20    Arabis alpina [alpine rockcress]
ref|XP_002906966.1|  CTD small phosphatase-like protein, putative     97.1    2e-20    Phytophthora infestans T30-4
ref|XP_007908504.1|  PREDICTED: carboxy-terminal domain RNA polym...  94.4    2e-20    Callorhinchus milii [Australian ghost shark]
ref|XP_007861736.1|  hypothetical protein GLOTRDRAFT_34014            95.9    3e-20    Gloeophyllum trabeum ATCC 11539
ref|XP_005647998.1|  hypothetical protein COCSUDRAFT_62990            99.8    3e-20    Coccomyxa subellipsoidea C-169
ref|XP_002961880.1|  hypothetical protein SELMODRAFT_77112            96.3    4e-20    
emb|CDS08568.1|  hypothetical protein LRAMOSA09929                    95.1    4e-20    Lichtheimia ramosa
gb|KIK48253.1|  hypothetical protein CY34DRAFT_798350                 97.8    5e-20    Suillus luteus UH-Slu-Lm8-n1
ref|XP_004309632.1|  PREDICTED: CTD small phosphatase-like protein    97.1    5e-20    Fragaria vesca subsp. vesca
ref|XP_008327260.1|  PREDICTED: carboxy-terminal domain RNA polym...  94.0    6e-20    
ref|XP_002990255.1|  hypothetical protein SELMODRAFT_131302           95.5    7e-20    
gb|KIP07696.1|  hypothetical protein PHLGIDRAFT_70560                 93.6    1e-19    Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_007302351.1|  NLI interacting factor                           93.2    1e-19    Stereum hirsutum FP-91666 SS1
ref|XP_001877699.1|  predicted protein                                94.0    1e-19    Laccaria bicolor S238N-H82
ref|XP_009346338.1|  PREDICTED: uncharacterized protein LOC103938066  94.0    1e-19    
ref|XP_007025282.1|  Haloacid dehalogenase hydrolase domain-conta...  95.5    1e-19    
gb|KIM45038.1|  hypothetical protein M413DRAFT_66696                  93.2    2e-19    Hebeloma cylindrosporum h7
ref|XP_003029995.1|  hypothetical protein SCHCODRAFT_57677            93.2    2e-19    Schizophyllum commune H4-8
ref|XP_006957876.1|  NIF-domain-containing protein                    95.5    2e-19    Wallemia mellicola CBS 633.66
ref|XP_010538232.1|  PREDICTED: probable C-terminal domain small ...  94.4    2e-19    Tarenaya hassleriana [spider flower]
ref|XP_001457501.1|  hypothetical protein                             94.7    2e-19    Paramecium tetraurelia strain d4-2
emb|CDX90211.1|  BnaA08g17730D                                        94.0    2e-19    
ref|XP_006461039.1|  hypothetical protein AGABI2DRAFT_68868           92.8    2e-19    Agaricus bisporus var. bisporus H97
ref|XP_003962166.1|  PREDICTED: uncharacterized protein LOC101077160  97.8    3e-19    
gb|KIO19513.1|  hypothetical protein M407DRAFT_16113                  91.7    3e-19    Tulasnella calospora MUT 4182
gb|KIY51614.1|  NLI interacting factor                                91.7    3e-19    Fistulina hepatica ATCC 64428
ref|XP_008371514.1|  PREDICTED: carboxy-terminal domain RNA polym...  94.0    4e-19    Malus domestica [apple tree]
ref|XP_009351769.1|  PREDICTED: carboxy-terminal domain RNA polym...  94.0    4e-19    Pyrus x bretschneideri [bai li]
emb|CAF98978.1|  unnamed protein product                              92.0    4e-19    Tetraodon nigroviridis
ref|XP_009352935.1|  PREDICTED: CTD small phosphatase-like protein    94.0    4e-19    
gb|KFH71123.1|  protein phosphatase                                   94.0    5e-19    Mortierella verticillata NRRL 6337
gb|KFV18538.1|  Carboxy-terminal domain RNA polymerase II polypep...  90.5    5e-19    Tauraco erythrolophus
gb|KFQ94722.1|  Carboxy-terminal domain RNA polymerase II polypep...  90.5    5e-19    Nipponia nippon
gb|KIK67046.1|  hypothetical protein GYMLUDRAFT_156868                92.4    5e-19    Gymnopus luxurians FD-317 M1
gb|EPT04500.1|  hypothetical protein FOMPIDRAFT_1027771               93.2    5e-19    Fomitopsis pinicola FP-58527 SS1
ref|XP_007266541.1|  NLI interacting factor                           92.4    5e-19    Fomitiporia mediterranea MF3/22
ref|XP_009985333.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.5    5e-19    Tauraco erythrolophus
ref|XP_002985448.1|  hypothetical protein SELMODRAFT_5502             90.9    6e-19    
ref|XP_007767400.1|  NLI interacting factor                           91.7    6e-19    Coniophora puteana RWD-64-598 SS2
ref|XP_007362124.1|  NLI interacting factor                           92.0    6e-19    Dichomitus squalens LYAD-421 SS1
ref|XP_001427839.1|  hypothetical protein                             93.6    6e-19    Paramecium tetraurelia strain d4-2
ref|XP_009109641.1|  PREDICTED: CTD small phosphatase-like protein    92.4    6e-19    Brassica rapa
ref|XP_001877698.1|  predicted protein                                91.7    6e-19    Laccaria bicolor S238N-H82
ref|XP_002979786.1|  hypothetical protein SELMODRAFT_5501             90.9    6e-19    
ref|XP_011462148.1|  PREDICTED: CTD small phosphatase-like protein    94.0    6e-19    Fragaria vesca subsp. vesca
emb|CCF49449.1|  related to PSR1-plasma membrane phosphatase requ...  95.9    6e-19    Ustilago hordei
emb|CBJ29851.1|  putative nuclear LIM interactor-interacting protein  93.6    6e-19    Ectocarpus siliculosus
gb|KIY44365.1|  NLI interacting factor                                92.0    7e-19    Fistulina hepatica ATCC 64428
ref|XP_010790522.1|  PREDICTED: carboxy-terminal domain RNA polym...  92.8    7e-19    Notothenia coriiceps [yellowbelly rockcod]
gb|KIM68582.1|  hypothetical protein SCLCIDRAFT_104632                91.3    8e-19    Scleroderma citrinum Foug A
ref|NP_001043640.2|  Os01g0629400                                     91.3    8e-19    
ref|XP_002683148.1|  CTD phosphatase                                  93.2    8e-19    Naegleria gruberi strain NEG-M
ref|XP_002128680.1|  PREDICTED: carboxy-terminal domain RNA polym...  93.2    8e-19    Ciona intestinalis [sea vase]
ref|XP_001439574.1|  hypothetical protein                             95.5    8e-19    Paramecium tetraurelia strain d4-2
gb|KIL68965.1|  hypothetical protein M378DRAFT_184815                 92.8    8e-19    Amanita muscaria Koide BX008
ref|XP_002991478.1|  hypothetical protein SELMODRAFT_133639           92.0    9e-19    
ref|XP_001783372.1|  predicted protein                                91.3    9e-19    
ref|XP_002191656.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.9    9e-19    Taeniopygia guttata
gb|EIE92518.1|  hypothetical protein RO3G_17116                       92.0    9e-19    Rhizopus delemar RA 99-880
ref|XP_006636766.1|  PREDICTED: carboxy-terminal domain RNA polym...  92.4    1e-18    Lepisosteus oculatus
gb|AAV63937.1|  putative nuclear LIM factor interactor-interactin...  92.8    1e-18    Phytophthora infestans [potato late blight]
ref|XP_007381158.1|  NLI interacting factor                           90.9    1e-18    Punctularia strigosozonata HHB-11173 SS5
gb|KJA29065.1|  hypothetical protein HYPSUDRAFT_128731                91.3    1e-18    Hypholoma sublateritium FD-334 SS-4
gb|KDQ27827.1|  hypothetical protein PLEOSDRAFT_1056370               91.3    1e-18    Pleurotus ostreatus PC15
ref|XP_006461036.1|  hypothetical protein AGABI2DRAFT_185336          92.4    1e-18    Agaricus bisporus var. bisporus H97
ref|XP_008933692.1|  PREDICTED: carboxy-terminal domain RNA polym...  91.7    1e-18    Merops nubicus
ref|XP_007328072.1|  hypothetical protein AGABI1DRAFT_56063           92.4    1e-18    Agaricus bisporus var. burnettii JB137-S8
ref|XP_002902000.1|  nuclear LIM factor interactor-interacting pr...  92.0    1e-18    Phytophthora infestans T30-4
gb|KDO71957.1|  hypothetical protein CISIN_1g0212542mg                90.5    1e-18    Citrus sinensis [apfelsine]
ref|XP_008383866.1|  PREDICTED: CTD small phosphatase-like protein    92.8    1e-18    
emb|CDW71311.1|  serine threonine-protein phosphatase dullard         95.5    1e-18    Stylonychia lemnae
gb|KII92247.1|  hypothetical protein PLICRDRAFT_102531                91.3    1e-18    Plicaturopsis crispa FD-325 SS-3
gb|KDO71958.1|  hypothetical protein CISIN_1g0212542mg                90.1    1e-18    Citrus sinensis [apfelsine]
ref|XP_009460452.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.1    1e-18    Nipponia nippon
gb|EJU04267.1|  NLI interacting factor                                90.5    2e-18    Dacryopinax primogenitus
gb|KIM23710.1|  hypothetical protein M408DRAFT_77067                  90.5    2e-18    Serendipita vermifera MAFF 305830
ref|XP_002978918.1|  hypothetical protein SELMODRAFT_418692           91.3    2e-18    
gb|KIO10168.1|  hypothetical protein M404DRAFT_130838                 90.9    2e-18    Pisolithus tinctorius Marx 270
ref|XP_009547234.1|  protein phosphatase                              90.9    2e-18    Heterobasidion irregulare TC 32-1
ref|XP_007766321.1|  NLI interacting factor                           90.5    2e-18    Coniophora puteana RWD-64-598 SS2
ref|XP_002984918.1|  hypothetical protein SELMODRAFT_424005           90.9    2e-18    
emb|CDY35276.1|  BnaC03g59470D                                        91.7    2e-18    Brassica napus [oilseed rape]
gb|KIJ68164.1|  hypothetical protein HYDPIDRAFT_82923                 90.9    2e-18    Hydnomerulius pinastri MD-312
ref|XP_010891429.1|  PREDICTED: carboxy-terminal domain RNA polym...  91.7    2e-18    Esox lucius
gb|KDQ27800.1|  hypothetical protein PLEOSDRAFT_1042370               90.1    2e-18    Pleurotus ostreatus PC15
ref|XP_010549563.1|  PREDICTED: probable C-terminal domain small ...  91.3    2e-18    Tarenaya hassleriana [spider flower]
ref|XP_001455830.1|  hypothetical protein                             91.7    2e-18    Paramecium tetraurelia strain d4-2
gb|KIK40170.1|  hypothetical protein CY34DRAFT_284277                 90.1    2e-18    Suillus luteus UH-Slu-Lm8-n1
gb|EPT03629.1|  hypothetical protein FOMPIDRAFT_49187                 89.4    2e-18    Fomitopsis pinicola FP-58527 SS1
gb|KJA27814.1|  hypothetical protein HYPSUDRAFT_130335                91.3    2e-18    Hypholoma sublateritium FD-334 SS-4
ref|XP_002984913.1|  hypothetical protein SELMODRAFT_5868             89.7    2e-18    
ref|XP_007863999.1|  NLI interacting factor                           89.7    3e-18    Gloeophyllum trabeum ATCC 11539
gb|EMD37721.1|  hypothetical protein CERSUDRAFT_65328                 90.9    3e-18    Gelatoporia subvermispora B
gb|KIK30637.1|  hypothetical protein PISMIDRAFT_86388                 89.7    3e-18    Pisolithus microcarpus 441
gb|KIJ18738.1|  hypothetical protein PAXINDRAFT_71375                 90.5    3e-18    Paxillus involutus ATCC 200175
emb|CEP17909.1|  hypothetical protein                                 92.8    3e-18    Parasitella parasitica
gb|KIL00717.1|  hypothetical protein PAXRUDRAFT_129201                90.1    3e-18    Paxillus rubicundulus Ve08.2h10
ref|XP_010499496.1|  PREDICTED: carboxy-terminal domain RNA polym...  91.3    3e-18    Camelina sativa [gold-of-pleasure]
ref|XP_005708391.1|  mitochondrial presequence translocase subuni...  92.0    3e-18    
gb|KEH37831.1|  NLI interacting factor-like phosphatase               91.7    3e-18    
ref|XP_005485332.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.5    3e-18    
gb|KDQ55864.1|  hypothetical protein JAAARDRAFT_133632                90.1    3e-18    
gb|ESA12593.1|  hypothetical protein GLOINDRAFT_26958                 91.7    3e-18    
ref|XP_002984912.1|  hypothetical protein SELMODRAFT_48489            89.4    3e-18    
gb|KIK03515.1|  hypothetical protein K443DRAFT_676691                 92.0    3e-18    
ref|XP_005279781.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.9    3e-18    
gb|EMS19014.1|  protein phosphatase                                   94.0    3e-18    
gb|KDR75432.1|  hypothetical protein GALMADRAFT_227080                92.0    3e-18    
ref|XP_007397292.1|  hypothetical protein PHACADRAFT_146736           93.6    3e-18    
gb|KIK27727.1|  hypothetical protein PISMIDRAFT_92452                 90.1    4e-18    
emb|CDM83593.1|  unnamed protein product                              92.8    4e-18    
ref|XP_001440239.1|  hypothetical protein                             91.3    4e-18    
gb|ABR26130.1|  ctd-phosphatase-like protein                          89.7    4e-18    
gb|KIM65061.1|  hypothetical protein SCLCIDRAFT_113907                90.1    4e-18    
gb|KJB69663.1|  hypothetical protein B456_011G035900                  91.3    4e-18    
ref|XP_005416111.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.7    4e-18    
emb|CCM05067.1|  predicted protein                                    93.6    4e-18    
ref|XP_008655172.1|  PREDICTED: hypothetical protein isoform X2       91.3    4e-18    
gb|KIO12904.1|  hypothetical protein M404DRAFT_58949                  89.0    4e-18    
ref|XP_007339491.1|  NLI interacting factor                           89.4    4e-18    
ref|XP_011039376.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.9    5e-18    
ref|XP_003059945.1|  predicted protein                                89.7    5e-18    
gb|KFU88472.1|  Carboxy-terminal domain RNA polymerase II polypep...  90.1    5e-18    
ref|XP_010462980.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.9    5e-18    
ref|XP_007434637.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.5    5e-18    
gb|EJT97493.1|  hypothetical protein DACRYDRAFT_58644                 88.2    5e-18    
dbj|BAK06784.1|  predicted protein                                    92.4    5e-18    
gb|AAQ92971.1|  CTD-phosphatase-like protein                          92.0    5e-18    
gb|KFM04640.1|  Carboxy-terminal domain RNA polymerase II polypep...  88.2    6e-18    
ref|XP_005235084.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.1    6e-18    
gb|KIM31418.1|  hypothetical protein M408DRAFT_65165                  89.4    6e-18    
gb|EMC84205.1|  Carboxy-terminal domain RNA polymerase II polypep...  89.7    6e-18    
ref|XP_004309622.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.5    6e-18    
ref|XP_005443012.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.1    6e-18    
gb|KFO55056.1|  Carboxy-terminal domain RNA polymerase II polypep...  89.7    6e-18    
ref|XP_008643065.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.1    6e-18    
ref|XP_007230515.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.7    6e-18    
ref|XP_001426636.1|  hypothetical protein                             90.9    6e-18    
ref|XP_011409583.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.5    6e-18    
ref|XP_002984914.1|  hypothetical protein SELMODRAFT_121036           89.4    6e-18    
ref|XP_002890830.1|  NLI interacting factor family protein            89.7    6e-18    
ref|XP_002984911.1|  hypothetical protein SELMODRAFT_121282           89.4    6e-18    
ref|XP_008921240.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.1    6e-18    
ref|XP_001732718.1|  hypothetical protein MGL_0493                    90.1    7e-18    
ref|XP_002985967.1|  hypothetical protein SELMODRAFT_123223           89.0    7e-18    
ref|XP_007138493.1|  hypothetical protein PHAVU_009G213700g           92.4    7e-18    
ref|XP_010783729.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.1    7e-18    
ref|NP_199382.1|  haloacid dehalogenase-like hydrolase (HAD) supe...  90.1    7e-18    
ref|XP_002305050.2|  hypothetical protein POPTR_0004s06150g           90.5    7e-18    
ref|XP_002155392.2|  PREDICTED: CTD small phosphatase-like protei...  90.5    7e-18    
ref|XP_010712086.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.0    7e-18    
ref|XP_005154136.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.7    7e-18    
ref|XP_009556259.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.1    7e-18    
ref|XP_010478348.1|  PREDICTED: carboxy-terminal domain RNA polym...  90.1    7e-18    
gb|KFQ25276.1|  Carboxy-terminal domain RNA polymerase II polypep...  88.6    8e-18    
ref|XP_009691890.1|  RNA polymerase II carboxyterminal domain pho...  90.1    8e-18    
ref|XP_002426356.1|  nuclear lim interactor-interacting factor, p...  90.1    8e-18    
gb|KIJ58767.1|  hypothetical protein HYDPIDRAFT_102032                90.9    8e-18    
ref|XP_002984910.1|  hypothetical protein SELMODRAFT_121210           89.0    8e-18    
ref|XP_005519751.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.7    8e-18    
gb|KFO69706.1|  Carboxy-terminal domain RNA polymerase II polypep...  89.0    8e-18    
ref|XP_006488832.1|  PREDICTED: CTD small phosphatase-like protei...  90.1    8e-18    
ref|NP_001167877.1|  hypothetical protein                             91.3    9e-18    
gb|KDN52079.1|  NLI interacting factor                                89.0    9e-18    
ref|XP_009543571.1|  hypothetical protein HETIRDRAFT_443965           93.6    9e-18    
ref|XP_007317752.1|  hypothetical protein SERLADRAFT_466076           89.0    9e-18    
ref|XP_009080445.1|  PREDICTED: carboxy-terminal domain RNA polym...  87.4    9e-18    
gb|KIM45034.1|  hypothetical protein M413DRAFT_441678                 90.5    9e-18    
emb|CDS03455.1|  hypothetical protein LRAMOSA00857                    90.1    9e-18    
ref|XP_009994552.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.7    9e-18    
ref|XP_008655170.1|  PREDICTED: hypothetical protein isoform X1       90.9    9e-18    
ref|XP_008495206.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.7    1e-17    
emb|CBK20438.2|  unnamed protein product                              89.7    1e-17    
ref|XP_009273305.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.7    1e-17    
ref|NP_001084286.1|  CTD (carboxy-terminal domain, RNA polymerase...  89.7    1e-17    
ref|XP_010593809.1|  PREDICTED: CTD small phosphatase-like protei...  89.7    1e-17    
gb|EPS60408.1|  hypothetical protein M569_14397                       89.4    1e-17    
emb|CCI39932.1|  unnamed protein product                              88.6    1e-17    
ref|XP_003854544.1|  hypothetical protein MYCGRDRAFT_103622           88.2    1e-17    
ref|XP_011391468.1|  hypothetical protein UMAG_05720                  92.4    1e-17    
gb|KFP72671.1|  Carboxy-terminal domain RNA polymerase II polypep...  87.0    1e-17    
gb|ETE71329.1|  Carboxy-terminal domain RNA polymerase II polypep...  89.7    1e-17    
emb|CDY59322.1|  BnaCnng34680D                                        89.7    1e-17    
ref|XP_010213680.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.7    1e-17    
ref|XP_001452557.1|  hypothetical protein                             90.1    1e-17    
gb|KHJ93971.1|  Dullard-like phosphatase domain protein               89.4    1e-17    
ref|XP_006398252.1|  hypothetical protein EUTSA_v10000984mg           89.7    1e-17    
ref|XP_003595565.1|  CTD small phosphatase-like protein               91.7    1e-17    
ref|XP_002865229.1|  NLI interacting factor family protein            89.7    1e-17    
gb|ETN57919.1|  protein phosphatase                                   90.1    1e-17    
ref|XP_009086523.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.4    1e-17    
ref|XP_003595566.1|  CTD small phosphatase-like protein               91.7    1e-17    
ref|XP_002316807.2|  hypothetical protein POPTR_0011s06780g           89.7    1e-17    
gb|KHN40732.1|  CTD small phosphatase-like protein 2                  90.1    1e-17    
ref|NP_174271.1|  Haloacid dehalogenase-like hydrolase (HAD) supe...  89.0    1e-17    
gb|KIP05592.1|  hypothetical protein PHLGIDRAFT_119691                92.0    1e-17    
gb|ETO79247.1|  hypothetical protein F444_06022                       89.7    1e-17    
dbj|GAN02241.1|  HAD-like protein                                     90.9    1e-17    
ref|XP_010499497.1|  PREDICTED: probable C-terminal domain small ...  89.0    1e-17    
emb|CDQ82545.1|  unnamed protein product                              88.6    1e-17    
gb|KFW80159.1|  Carboxy-terminal domain RNA polymerase II polypep...  89.0    1e-17    
ref|XP_006419366.1|  hypothetical protein CICLE_v10005213mg           90.1    1e-17    
ref|XP_004036743.1|  NLI interacting factor-like phosphatase fami...  87.8    1e-17    
ref|XP_010593808.1|  PREDICTED: CTD small phosphatase-like protei...  89.7    1e-17    
ref|XP_001656818.1|  AAEL003412-PA                                    89.4    1e-17    
ref|XP_005498732.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.4    1e-17    
ref|XP_003569513.1|  PREDICTED: uncharacterized protein LOC100822852  91.3    1e-17    
ref|XP_002173595.1|  NLI interacting factor family phosphatase        89.7    1e-17    
ref|XP_002286214.1|  predicted protein                                88.6    1e-17    
ref|XP_006261563.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.0    1e-17    
gb|ETP48195.1|  hypothetical protein F442_06005                       89.4    1e-17    
emb|CDS12650.1|  Putative Phosphatase PSR1                            89.7    1e-17    
gb|KGL77757.1|  Carboxy-terminal domain RNA polymerase II polypep...  88.6    1e-17    
gb|EST08150.1|  Aspartate-based protein phosphatase                   92.0    1e-17    
ref|XP_007924783.1|  hypothetical protein MYCFIDRAFT_122652           87.8    2e-17    
gb|EYC18911.1|  hypothetical protein Y032_0026g1444                   88.6    2e-17    
gb|AAG10616.1|AC008030_16  Hypothetical protein                       89.0    2e-17    
ref|XP_008383597.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.4    2e-17    
gb|EPB83424.1|  hypothetical protein HMPREF1544_09808                 90.5    2e-17    
gb|KIP11554.1|  hypothetical protein PHLGIDRAFT_63549                 87.8    2e-17    
gb|ADO27995.1|  carboxy-terminal domain RNA polymerase II polypep...  89.0    2e-17    
emb|CDH51119.1|  nli interacting factor                               89.4    2e-17    
dbj|GAC94677.1|  phosphatase                                          91.7    2e-17    
gb|KJB66868.1|  hypothetical protein B456_010G161800                  89.0    2e-17    
ref|XP_001420859.1|  predicted protein                                87.0    2e-17    
ref|XP_317884.3|  AGAP011422-PA                                       88.6    2e-17    
ref|XP_005826001.1|  hypothetical protein GUITHDRAFT_165068           90.9    2e-17    
ref|XP_007880331.1|  hypothetical protein PFL1_04614                  90.9    2e-17    
emb|CCO26799.1|  Nuclear envelope morphology protein 1                87.8    2e-17    
dbj|GAK66903.1|  NLI interacting factor                               91.7    2e-17    
gb|AAR09909.1|  similar to Drosophila melanogaster CG1696             86.7    2e-17    
gb|KJB69665.1|  hypothetical protein B456_011G036100                  89.4    2e-17    
ref|XP_005049613.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.0    2e-17    
gb|KDP21150.1|  hypothetical protein JCGZ_21621                       89.0    2e-17    
ref|XP_002456002.1|  hypothetical protein SORBIDRAFT_03g028730        90.1    2e-17    
ref|XP_010568051.1|  PREDICTED: carboxy-terminal domain RNA polym...  89.0    2e-17    
gb|KIK98739.1|  hypothetical protein PAXRUDRAFT_133578                90.1    2e-17    
ref|XP_007127857.1|  PREDICTED: CTD small phosphatase-like protein    89.0    2e-17    
emb|CCA14728.1|  putative nuclear LIM factor interactorinteractin...  88.2    2e-17    
emb|CDO71384.1|  hypothetical protein BN946_scf184908.g142            92.0    2e-17    
gb|KIO30323.1|  hypothetical protein M407DRAFT_69306                  90.9    2e-17    
gb|KFH65735.1|  protein phosphatase                                   89.0    2e-17    
ref|XP_001026353.1|  NLI interacting factor-like phosphatase fami...  89.0    2e-17    
gb|KFP03323.1|  Carboxy-terminal domain RNA polymerase II polypep...  88.2    2e-17    
ref|XP_010743522.1|  PREDICTED: carboxy-terminal domain RNA polym...  88.6    2e-17    
gb|KIK03519.1|  hypothetical protein K443DRAFT_676695                 90.5    2e-17    
gb|ETN82756.1|  Dullard-like phosphatase domain protein               88.2    2e-17    
ref|XP_008034597.1|  NIF-domain-containing protein                    90.1    2e-17    
gb|KDQ64274.1|  hypothetical protein JAAARDRAFT_27896                 90.5    2e-17    
ref|XP_007396886.1|  hypothetical protein PHACADRAFT_162559           87.4    3e-17    
ref|XP_007000918.1|  hypothetical protein TREMEDRAFT_41494            87.4    3e-17    
emb|CDI55665.1|  related to PSR1-plasma membrane phosphatase requ...  91.3    3e-17    
ref|NP_001188083.1|  carboxy-terminal domain RNA polymerase II po...  88.6    3e-17    
ref|XP_008672892.1|  PREDICTED: CTD-phosphatase-like protein isof...  89.7    3e-17    
gb|ETP20252.1|  hypothetical protein F441_05981                       88.6    3e-17    
gb|EAZ12780.1|  hypothetical protein OsJ_02697                        91.3    3e-17    
gb|KFO85972.1|  CTD small phosphatase-like                            85.9    3e-17    
ref|XP_010790521.1|  PREDICTED: probable serine/threonine-protein...  92.0    3e-17    
ref|XP_009687992.1|  PREDICTED: carboxy-terminal domain RNA polym...  88.2    3e-17    
ref|XP_008033589.1|  NIF-domain-containing protein                    90.9    3e-17    
ref|XP_006304077.1|  hypothetical protein CARUB_v10009936mg           88.6    3e-17    
ref|XP_001302150.1|  NLI interacting factor-like phosphatase fami...  88.6    3e-17    
ref|XP_008620839.1|  protein phosphatase                              89.0    3e-17    
ref|XP_001461464.1|  hypothetical protein                             88.6    3e-17    
ref|XP_004018627.1|  PREDICTED: CTD small phosphatase-like protein    88.2    3e-17    
ref|XP_003533846.1|  PREDICTED: CTD small phosphatase-like protei...  90.5    3e-17    
gb|EKC98705.1|  protein phosphatase                                   90.5    3e-17    
ref|XP_005537320.1|  mitochondrial presequence translocase subuni...  89.7    3e-17    
ref|XP_006597936.1|  PREDICTED: CTD small phosphatase-like protei...  90.5    3e-17    
gb|ETS61418.1|  hypothetical protein PaG_04448                        90.9    3e-17    
gb|KDN45200.1|  hypothetical protein RSAG8_05115                      89.7    3e-17    
gb|ETL43802.1|  hypothetical protein L916_05781                       88.6    3e-17    
ref|XP_002022997.1|  GL16570                                          86.7    3e-17    
ref|XP_007567653.1|  PREDICTED: carboxy-terminal domain RNA polym...  88.6    3e-17    
ref|XP_008916843.1|  hypothetical protein PPTG_19961                  88.6    3e-17    
emb|CCU97386.1|  unnamed protein product                              90.5    3e-17    
ref|XP_002193720.2|  PREDICTED: CTD small phosphatase-like protei...  86.7    3e-17    
ref|XP_008225256.1|  PREDICTED: carboxy-terminal domain RNA polym...  88.6    3e-17    
ref|XP_008891378.1|  hypothetical protein PPTG_02126                  88.2    3e-17    
ref|XP_010128762.1|  PREDICTED: CTD small phosphatase-like protein    87.4    3e-17    
ref|XP_006958104.1|  NIF-domain-containing protein                    89.7    3e-17    
ref|XP_006415548.1|  hypothetical protein EUTSA_v10009586mg           88.2    3e-17    
gb|ETO79269.1|  hypothetical protein F444_06008                       88.2    3e-17    
gb|KFV74752.1|  Carboxy-terminal domain RNA polymerase II polypep...  87.8    4e-17    
emb|CDJ95238.1|  NLI interacting factor domain containing protein     87.8    4e-17    
ref|XP_006688457.1|  NIF-domain-containing protein                    88.6    4e-17    
ref|XP_006008119.1|  PREDICTED: carboxy-terminal domain RNA polym...  87.8    4e-17    
emb|CDQ89270.1|  unnamed protein product                              87.8    4e-17    
ref|XP_001849639.1|  nuclear lim interactor-interacting factor        87.8    4e-17    
gb|ACQ58628.1|  Carboxy-terminal domain RNA polymerase II polypep...  87.8    4e-17    
ref|XP_003214992.1|  PREDICTED: carboxy-terminal domain RNA polym...  88.6    4e-17    
ref|XP_001427386.1|  hypothetical protein                             88.2    4e-17    
ref|XP_008421637.1|  PREDICTED: carboxy-terminal domain RNA polym...  88.2    4e-17    
emb|CCM04063.1|  predicted protein                                    90.1    4e-17    
ref|XP_009237486.1|  PREDICTED: CTD small phosphatase-like protei...  87.8    4e-17    
ref|XP_002505634.1|  predicted protein                                90.5    4e-17    
gb|EAS06108.2|  NLI interacting factor-like phosphatase               88.6    4e-17    
ref|XP_010080407.1|  PREDICTED: CTD small phosphatase-like protein    86.7    4e-17    
ref|XP_006279676.1|  hypothetical protein CARUB_v10026939mg           87.8    4e-17    
ref|XP_007025284.1|  Haloacid dehalogenase-like hydrolase superfa...  88.2    4e-17    
gb|KFK31529.1|  hypothetical protein AALP_AA6G124500                  87.8    4e-17    
ref|XP_001830537.2|  protein phosphatase                              89.4    4e-17    
gb|KFB37775.1|  AGAP011422-PA-like protein                            87.8    4e-17    
ref|XP_006173743.1|  PREDICTED: CTD small phosphatase-like protein    87.8    4e-17    
ref|XP_001450695.1|  hypothetical protein                             88.2    4e-17    
gb|EJT52167.1|  protein phosphatase                                   90.5    4e-17    
ref|XP_010743521.1|  PREDICTED: carboxy-terminal domain RNA polym...  88.2    4e-17    
ref|XP_003523928.1|  PREDICTED: uncharacterized protein LOC100810756  89.7    4e-17    
ref|XP_005181267.1|  PREDICTED: CTD nuclear envelope phosphatase ...  87.4    4e-17    
ref|XP_002736972.1|  PREDICTED: CTD small phosphatase-like protei...  87.8    4e-17    
gb|ERL87100.1|  hypothetical protein D910_04500                       87.8    4e-17    
ref|XP_001830541.2|  protein phosphatase                              90.5    4e-17    
gb|KIH56754.1|  Dullard-like phosphatase domain protein               87.4    4e-17    
emb|CDO75668.1|  hypothetical protein BN946_scf184941.g21             90.5    4e-17    
ref|XP_005695726.1|  PREDICTED: CTD small phosphatase-like protein    87.4    5e-17    
ref|NP_174270.1|  haloacid dehalogenase-like hydrolase                87.8    5e-17    
ref|XP_009303177.1|  PREDICTED: carboxy-terminal domain RNA polym...  87.8    5e-17    
ref|XP_006077095.1|  PREDICTED: CTD small phosphatase-like protei...  87.8    5e-17    
gb|AES97137.2|  NLI interacting factor-like phosphatase               87.8    5e-17    



>ref|XP_009610468.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=325

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SSDKECD KPKI YVTVFERPGLH+FLK+LG FADLVLFTAGLEGYAR
Sbjct  145  EAGLKWFELECISSDKECDSKPKINYVTVFERPGLHDFLKELGEFADLVLFTAGLEGYAR  204

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID+ NRF  RLYRPSTTSTEYREHVKDLS IS DLSRIVIVDNNPFSFLLQPLNG
Sbjct  205  PLVDKIDLGNRFSMRLYRPSTTSTEYREHVKDLSCISKDLSRIVIVDNNPFSFLLQPLNG  264

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPF+AGQPHD QL++VILPLLKHLSQQ+DVRP L +RFHMPEW +KHGIP S LT+
Sbjct  265  IPCIPFAAGQPHDIQLLEVILPLLKHLSQQKDVRPVLYERFHMPEWFQKHGIPVSALTS  323



>ref|XP_009760936.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Nicotiana sylvestris]
Length=324

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC SSDKECD KPKI YVTVFERPGLH+FLK+L  FADLVLFTAGLEGYAR
Sbjct  145  EAGLKWFELECTSSDKECDSKPKINYVTVFERPGLHDFLKELSEFADLVLFTAGLEGYAR  204

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID+ NRF  R YRPSTTSTEYREHVKDLS IS DLSRIVIVDNNPFSFLLQPLNG
Sbjct  205  PLVDKIDLGNRFSMRFYRPSTTSTEYREHVKDLSCISKDLSRIVIVDNNPFSFLLQPLNG  264

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCIPF+AGQPHD QL++VILPLLKHLSQQ+DVRP L +RFHMPEW +KHGIP+S LT
Sbjct  265  IPCIPFAAGQPHDIQLLEVILPLLKHLSQQKDVRPVLYERFHMPEWFQKHGIPASALT  322



>ref|XP_004240939.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Solanum 
lycopersicum]
Length=306

 Score =   318 bits (814),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC SSDKEC+GKPKI YVTVFERPGLHEFLK+L  FA+LVLFTAGLEGYAR
Sbjct  126  EAGLKWFELECTSSDKECEGKPKINYVTVFERPGLHEFLKELSEFANLVLFTAGLEGYAR  185

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKIDV NRF  RLYRPST STEYREHVKDL  IS DLSRIVIVDNNPFSFLLQPLNG
Sbjct  186  PLVDKIDVGNRFSLRLYRPSTISTEYREHVKDLVCISKDLSRIVIVDNNPFSFLLQPLNG  245

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFSAGQPHD QL++VILPLLKHLS+Q+DVRP L  RFHMPEW +KHGIP+S LT+
Sbjct  246  IPCIPFSAGQPHDIQLLEVILPLLKHLSKQKDVRPVLYDRFHMPEWFQKHGIPASALTS  304



>ref|XP_006338842.1| PREDICTED: CTD small phosphatase-like protein 2-like [Solanum 
tuberosum]
Length=313

 Score =   316 bits (809),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC SSDKEC+GKPKI YVTVFERPGLHEFLK+L  FA+LVLFTAGLEGYAR
Sbjct  133  EAGLKWFELECTSSDKECEGKPKINYVTVFERPGLHEFLKELSEFANLVLFTAGLEGYAR  192

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKIDV NRF  RLYRPST STEYREHVKDL  IS DLSR+VIVDNNPFSFLLQPLNG
Sbjct  193  PLVDKIDVGNRFSLRLYRPSTISTEYREHVKDLLCISKDLSRMVIVDNNPFSFLLQPLNG  252

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFSAGQPHD QL++VILPLLKHLS+Q+DVRP L  RFHMPEW +KHGIP+S LT+
Sbjct  253  IPCIPFSAGQPHDIQLLEVILPLLKHLSKQKDVRPVLYDRFHMPEWFQKHGIPASALTS  311



>emb|CDP14017.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   313 bits (803),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGLNWFELECVSSDKE +GKPKI YVTVFERPGLHEFLKQL  FA+LVLFTAGLEGYAR
Sbjct  132  EAGLNWFELECVSSDKEIEGKPKINYVTVFERPGLHEFLKQLSEFANLVLFTAGLEGYAR  191

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST STEYREHVKDLS +S DL R+VIVDNNPFSFLLQPLNG
Sbjct  192  PLVDRIDAENRFSLRLYRPSTISTEYREHVKDLSCVSKDLCRMVIVDNNPFSFLLQPLNG  251

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCIPFSAGQP DEQL++VILPLLKHLSQQ+DVRP L +RFHMPEW ++HGIP+S
Sbjct  252  IPCIPFSAGQPQDEQLLEVILPLLKHLSQQKDVRPVLYERFHMPEWFQRHGIPAS  306



>gb|EYU20007.1| hypothetical protein MIMGU_mgv1a010325mg [Erythranthe guttata]
Length=316

 Score =   312 bits (800),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+ WFELEC+SSDKE +GKPKI YVTVFERPGL EFL QL  FADLVLFTAGLEGYAR
Sbjct  138  EAGIKWFELECISSDKEFEGKPKINYVTVFERPGLKEFLSQLSEFADLVLFTAGLEGYAR  197

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDK+D  NRF RRLYRPSTTSTEYREHVKDLS +S D  RIVIVDNNPFSFLLQPLNG
Sbjct  198  PLVDKLDGGNRFSRRLYRPSTTSTEYREHVKDLSSLSKDFCRIVIVDNNPFSFLLQPLNG  257

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFS GQPHDEQL++VILPLLKHLS Q+DVRP L +RFHMPEW +KHGIP+SG TT
Sbjct  258  IPCIPFSPGQPHDEQLLEVILPLLKHLSLQKDVRPVLYERFHMPEWFQKHGIPASGWTT  316



>ref|XP_011076695.1| PREDICTED: CTD small phosphatase-like protein [Sesamum indicum]
Length=382

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+NWFELEC+SSDKE +GKPKI YVTVFERPGL EFL QL  FADLVLFTAGLEGYAR
Sbjct  205  EAGINWFELECISSDKEFEGKPKINYVTVFERPGLKEFLNQLSEFADLVLFTAGLEGYAR  264

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV+NRF RRLYRPST STEYREHVKDLS +S D  RIVIVDNNPFSFLLQPLNG
Sbjct  265  PLVDRIDVDNRFSRRLYRPSTISTEYREHVKDLSCLSKDFCRIVIVDNNPFSFLLQPLNG  324

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCIPFS GQPHD QLM+VILPLLKHLS Q+DVRP L +RFHMPEW  KHGIP+SG T
Sbjct  325  IPCIPFSPGQPHDVQLMEVILPLLKHLSLQKDVRPVLYERFHMPEWFRKHGIPASGWT  382



>ref|XP_009622999.1| PREDICTED: CTD small phosphatase-like protein 2 [Nicotiana tomentosiformis]
Length=304

 Score =   306 bits (784),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKE DGKPKI YVTVFERPGLHEFLKQL  FA+LVLFTAGLEGYAR
Sbjct  126  EAGLKWFELECVSSDKEYDGKPKINYVTVFERPGLHEFLKQLSEFANLVLFTAGLEGYAR  185

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID EN F  RLYRPST STE+REHVKDLS IS DL RIVIVDNNPFSFLLQPLNG
Sbjct  186  PLVDKIDPENWFSHRLYRPSTISTEFREHVKDLSSISKDLCRIVIVDNNPFSFLLQPLNG  245

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            IPCIPFS GQPHDEQL++VILPLLKHLS+Q+DVRP L++RF MPEW + HGIP+
Sbjct  246  IPCIPFSPGQPHDEQLLEVILPLLKHLSEQKDVRPVLHERFQMPEWFQNHGIPA  299



>ref|XP_010689631.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=312

 Score =   306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SSDKEC+GKPKI YVTVFERPGLHEFL QL  FADL+LFTAGLEGYAR
Sbjct  134  EAGLKWFELECISSDKECEGKPKISYVTVFERPGLHEFLVQLSEFADLILFTAGLEGYAR  193

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID +NRF RRLYRPSTTSTEYR+HVKDLS IS +L R+VIVDNNPFSFLLQPLNG
Sbjct  194  PLVDRIDADNRFSRRLYRPSTTSTEYRDHVKDLSCISQELCRVVIVDNNPFSFLLQPLNG  253

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGI  236
            IPC+PFSAGQPHD+QL++V+LP+LKHLS Q+DVRP L ++FHMPEW +KHGI
Sbjct  254  IPCVPFSAGQPHDDQLLEVLLPILKHLSLQDDVRPILYEKFHMPEWFQKHGI  305



>ref|XP_008463241.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Cucumis melo]
Length=297

 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELEC SSDK+C+GKPK+ YVTVFERPGLH+FLK LG FADLVLFTAGLEGYAR
Sbjct  121  EAGLKSFELECYSSDKDCEGKPKVNYVTVFERPGLHDFLKHLGGFADLVLFTAGLEGYAR  180

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST STEYR+HVKDLS +S DL RIVIVDNNPFSFLLQPLNG
Sbjct  181  PLVDRIDEENRFSLRLYRPSTISTEYRDHVKDLSCLSKDLRRIVIVDNNPFSFLLQPLNG  240

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            IPCIPFSAGQPHD QL+DVILPLL+HLSQQ DVRP L +RFHMPEW +KHGIP+
Sbjct  241  IPCIPFSAGQPHDSQLLDVILPLLEHLSQQNDVRPVLYERFHMPEWFQKHGIPT  294



>ref|XP_009616349.1| PREDICTED: uncharacterized protein C2F7.02c-like [Nicotiana tomentosiformis]
Length=251

 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKE DGKPKI Y TVFERPGLHEFLKQL  FA+LVLFTAGLEGYAR
Sbjct  73   EAGLKWFELECVSSDKEYDGKPKINYFTVFERPGLHEFLKQLSEFANLVLFTAGLEGYAR  132

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDK+D EN F  RLYRPST STE+REHVKDLS IS DL RIVIVDNNPFSFLLQPLNG
Sbjct  133  PLVDKMDPENWFSHRLYRPSTISTEFREHVKDLSSISTDLCRIVIVDNNPFSFLLQPLNG  192

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            IPCIPFS GQPHDEQL++VILPLLKHLS+Q+DVRP L++RF MPEW + HGIP+
Sbjct  193  IPCIPFSPGQPHDEQLLEVILPLLKHLSEQKDVRPVLHERFQMPEWFQNHGIPA  246



>ref|XP_004149232.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 ref|XP_004172125.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 gb|KGN50658.1| hypothetical protein Csa_5G203410 [Cucumis sativus]
Length=297

 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELEC SSDK+C+GKPK+ YVTVFERPGLH+FLK LG FADLVLFTAGLEGYAR
Sbjct  121  EAGLKSFELECFSSDKDCEGKPKVNYVTVFERPGLHDFLKHLGGFADLVLFTAGLEGYAR  180

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST STEYR+HVKDLS +S DL R+VIVDNNPFSFLLQP NG
Sbjct  181  PLVDRIDEENRFSLRLYRPSTISTEYRDHVKDLSCLSKDLRRVVIVDNNPFSFLLQPQNG  240

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            IPCIPFSAGQPHD QL+DVILPLL+HLSQQ DVRP L +RFHMPEW +KHGIP+
Sbjct  241  IPCIPFSAGQPHDSQLLDVILPLLEHLSQQNDVRPVLYERFHMPEWFQKHGIPT  294



>ref|XP_011084905.1| PREDICTED: LOW QUALITY PROTEIN: CTD nuclear envelope phosphatase 
1 homolog [Sesamum indicum]
Length=307

 Score =   301 bits (771),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SSDKE +GKPKI YVTVFERPG+ +FL QL  FADLVLFTAGLEGYAR
Sbjct  127  EAGLKWFELECISSDKEFEGKPKINYVTVFERPGVRDFLDQLSKFADLVLFTAGLEGYAR  186

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVENRF  RLYRPST STEYREHVKDLS ++ DLSRIVIVDNNPFSFLLQPLNG
Sbjct  187  PLVDRIDVENRFSLRLYRPSTISTEYREHVKDLSCLAKDLSRIVIVDNNPFSFLLQPLNG  246

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            IPC+PFSAGQP DEQL++VILPLLKHLS Q+DVRP L ++FHMPEW +KHGIP+
Sbjct  247  IPCVPFSAGQPQDEQLLEVILPLLKHLSLQKDVRPMLYEKFHMPEWFQKHGIPA  300



>gb|KDP44760.1| hypothetical protein JCGZ_01260 [Jatropha curcas]
Length=297

 Score =   301 bits (770),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKEC+GKPKI YVTVFERPGL EFLK+L  F+DLVLFTAGLEGYA+
Sbjct  119  EAGLRWFELECVSSDKECEGKPKINYVTVFERPGLAEFLKKLSEFSDLVLFTAGLEGYAK  178

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID +N F  RLYRPST STEYREHVKDLS +S D  R VIVDNNPFSFLLQPLNG
Sbjct  179  PLVDKIDTDNLFSLRLYRPSTISTEYREHVKDLSCLSKDPCRTVIVDNNPFSFLLQPLNG  238

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PFSAGQP+D QLMDV+LPLLKHLS+Q+DVRP L +RF MPEW +K GIP+SG T
Sbjct  239  IPCVPFSAGQPYDTQLMDVLLPLLKHLSEQKDVRPVLYERFRMPEWFQKQGIPASGWT  296



>ref|XP_004491033.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cicer arietinum]
Length=311

 Score =   298 bits (764),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGLNWFELECVSSDKE +GKPKI YVTVFERPGL EFLKQL  FADLVLFTAGLEGYAR
Sbjct  133  EAGLNWFELECVSSDKEGEGKPKINYVTVFERPGLKEFLKQLSEFADLVLFTAGLEGYAR  192

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD ID ENRF  RLYRPST STEYREHVKDL+ IS DL RIVIVDNNPFSF+LQP+NG
Sbjct  193  PLVDIIDKENRFSLRLYRPSTISTEYREHVKDLTCISKDLDRIVIVDNNPFSFVLQPVNG  252

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCIPFSAG P+D QL+DVILPLLK LS+Q DVRP L ++FHMP+W +K GIP+S  T
Sbjct  253  IPCIPFSAGHPNDTQLLDVILPLLKQLSKQSDVRPLLCEKFHMPDWFQKQGIPASSWT  310



>ref|XP_006355653.1| PREDICTED: CTD small phosphatase-like protein 2-like [Solanum 
tuberosum]
Length=317

 Score =   298 bits (764),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS+KE DGKPKI YVTVFERPGLHEFLKQL  FA+LVLFTAGLEGYAR
Sbjct  137  EAGLKWFELECVSSEKEYDGKPKINYVTVFERPGLHEFLKQLSEFANLVLFTAGLEGYAR  196

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P+VDKID+EN F  RLYRPST STE+REHVKDLS IS DL R+VIVDNNPFSFLLQPLNG
Sbjct  197  PVVDKIDLENLFSHRLYRPSTISTEFREHVKDLSCISEDLCRVVIVDNNPFSFLLQPLNG  256

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCI FS GQPHD QL++ ILPLLKHLS+Q+DVRP L +RF MPEW + HGIP+   T
Sbjct  257  IPCISFSPGQPHDNQLLEEILPLLKHLSEQKDVRPVLRERFQMPEWFQNHGIPTCEFT  314



>gb|KHN48568.1| CTD small phosphatase-like protein 2 [Glycine soja]
Length=304

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GLNWFELECVS DKE +GKPKI YVTVFERPGL EFLKQL  FAD+VLFTAGLEGYAR
Sbjct  126  EGGLNWFELECVSIDKEGEGKPKINYVTVFERPGLKEFLKQLSEFADMVLFTAGLEGYAR  185

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVENRF  RLYRPST STEYREHVKDL+ IS DL RIVIVDNNPFSF+LQP+NG
Sbjct  186  PLVDRIDVENRFCLRLYRPSTISTEYREHVKDLTCISKDLCRIVIVDNNPFSFVLQPVNG  245

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCIPFSAGQPHD QL+DVILPLLK LS++ D+RP L ++FHMP+W +K GIP+S 
Sbjct  246  IPCIPFSAGQPHDTQLLDVILPLLKQLSERNDIRPLLYEKFHMPDWFQKQGIPASS  301



>ref|XP_010535319.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Tarenaya hassleriana]
 ref|XP_010535391.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Tarenaya hassleriana]
Length=307

 Score =   296 bits (758),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GL WFELEC+SSDKECDGKPKI YVTVFERPGLHEFL+QL  FA+LVLFTAGLEGYAR
Sbjct  132  EGGLKWFELECISSDKECDGKPKINYVTVFERPGLHEFLEQLSQFANLVLFTAGLEGYAR  191

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  N F  RLYRPST ST+YR+HVKDLS  SN++ R VIVDNNPFSFLLQPLNG
Sbjct  192  PLVDRIDTRNAFSLRLYRPSTVSTQYRDHVKDLSCTSNNMCRTVIVDNNPFSFLLQPLNG  251

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCIPFSAGQ +D QL+DVILPLLKHLS+QED+RP L  RFHMPEW EK GI ++
Sbjct  252  IPCIPFSAGQANDTQLLDVILPLLKHLSEQEDIRPILYDRFHMPEWFEKQGISAT  306



>ref|NP_001242244.1| uncharacterized protein LOC100783451 [Glycine max]
 gb|ACU20842.1| unknown [Glycine max]
Length=304

 Score =   295 bits (756),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GLNWFELECVS DKE +GKPKI YVTVFERPGL EFLKQL  FAD+ LFTAGLEGYAR
Sbjct  126  EGGLNWFELECVSIDKEGEGKPKINYVTVFERPGLKEFLKQLSEFADMALFTAGLEGYAR  185

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVENRF  RLYRPST STEYREHVKDL+ IS DL RIVIVDNNPFSF+LQP+NG
Sbjct  186  PLVDRIDVENRFCLRLYRPSTISTEYREHVKDLTCISKDLCRIVIVDNNPFSFVLQPVNG  245

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCIPFSAGQPHD QL+DVILPLLK LS++ D+RP L ++FHMP+W +K GIP+S 
Sbjct  246  IPCIPFSAGQPHDTQLLDVILPLLKQLSERNDIRPLLYEKFHMPDWFQKQGIPASS  301



>ref|XP_010534600.1| PREDICTED: CTD small phosphatase-like protein [Tarenaya hassleriana]
Length=311

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS+KEC+GKPKI YVTVFERPGLHEFL+QL  FA+LVLFTAGLEGYAR
Sbjct  133  EAGLKWFELECVSSEKECEGKPKINYVTVFERPGLHEFLEQLSRFANLVLFTAGLEGYAR  192

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  N F  RLYRPST ST+YR+HVKDL+  S+++ R VIVDNNPFSFLLQPLNG
Sbjct  193  PLVDRIDTGNLFSLRLYRPSTVSTQYRDHVKDLTCTSDNMFRTVIVDNNPFSFLLQPLNG  252

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFSAGQP+D QL+DVILPLL HLS+QEDVRP L+ RFHM EW EK GIPS+  T+
Sbjct  253  IPCIPFSAGQPNDTQLLDVILPLLTHLSEQEDVRPILHDRFHMAEWFEKQGIPSTCWTS  311



>ref|XP_007141764.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
 gb|ESW13758.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
Length=303

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GLNWFELECVS DKE +GKPKI YVTVFERPGL EFLK+L  FA+LVLFTAGLEGYAR
Sbjct  125  EGGLNWFELECVSIDKEGEGKPKINYVTVFERPGLKEFLKKLSEFANLVLFTAGLEGYAR  184

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST STEYREHVKDL+ IS DL RIVIVDNNPFSF+LQP+NG
Sbjct  185  PLVDRIDAENRFSLRLYRPSTISTEYREHVKDLTCISKDLCRIVIVDNNPFSFVLQPVNG  244

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCIPFSAGQPHD QL+DVILPLLK LS+  DVRP L ++FHMP+W +K GIP+S  T
Sbjct  245  IPCIPFSAGQPHDTQLLDVILPLLKQLSELNDVRPLLYEKFHMPDWFQKQGIPASSWT  302



>ref|XP_011035940.1| PREDICTED: CTD nuclear envelope phosphatase 1 [Populus euphratica]
Length=294

 Score =   293 bits (750),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFEL+CVSSDKEC+GKPKI YVTVFERPGL EFLKQL  FA+LVLFTAGLEGYAR
Sbjct  117  EAGLKWFELDCVSSDKECEGKPKINYVTVFERPGLDEFLKQLSEFAELVLFTAGLEGYAR  176

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST+STEYREHVKDLS IS D  RIVIVDNNPFSFLLQPLNG
Sbjct  177  PLVDRIDTENRFSLRLYRPSTSSTEYREHVKDLSCISKDPCRIVIVDNNPFSFLLQPLNG  236

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PFSAGQPHD QL+DV+LPLLK LSQQ+DVRP L +RFHMPEW +K GIP+SG T
Sbjct  237  IPCVPFSAGQPHDTQLLDVLLPLLKQLSQQKDVRPVLYERFHMPEWFQKQGIPASGWT  294



>gb|KHN20843.1| CTD small phosphatase-like protein 2 [Glycine soja]
Length=306

 Score =   293 bits (751),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GLNWFELECVS DKE +GK KI YVTVFERPGL EFLKQL  FAD+VLFTAGLEGYAR
Sbjct  129  EGGLNWFELECVSIDKEGEGK-KINYVTVFERPGLKEFLKQLSEFADMVLFTAGLEGYAR  187

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVENRF  RLYRPST STEYREHVKDL+ IS DL RIVIVDNNPFSF+LQP+NG
Sbjct  188  PLVDRIDVENRFSLRLYRPSTISTEYREHVKDLTCISKDLCRIVIVDNNPFSFVLQPVNG  247

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCIPFSAGQPHD QL+DVILPLLK LS+Q DVRP L ++FHMP+W +K GIP+S  T
Sbjct  248  IPCIPFSAGQPHDTQLLDVILPLLKQLSEQNDVRPFLYEKFHMPDWFQKQGIPASSWT  305



>gb|KDP24445.1| hypothetical protein JCGZ_25009 [Jatropha curcas]
Length=316

 Score =   293 bits (751),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  748  AGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARP  569
            AGL WFELECVS DKEC+GK K+ YVTVFERPGL EFLKQ+  FADLVLFTAGLEGYARP
Sbjct  139  AGLKWFELECVSPDKECEGKTKVNYVTVFERPGLREFLKQINEFADLVLFTAGLEGYARP  198

Query  568  LVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGI  389
            LVD+IDVENRF  RLYRPST STEYREHVKDLS I  DL RIVIVDNNPFSFLLQPLNGI
Sbjct  199  LVDRIDVENRFKLRLYRPSTVSTEYREHVKDLSCIMKDLHRIVIVDNNPFSFLLQPLNGI  258

Query  388  PCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            PC+PFSA QP+D QL+D +LPL+KHLS Q+DVR  L +RFHMPEW + HGIP+
Sbjct  259  PCVPFSAAQPYDNQLLDYLLPLIKHLSLQKDVRTELQERFHMPEWFQMHGIPA  311



>ref|XP_004239942.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Solanum lycopersicum]
Length=318

 Score =   293 bits (751),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS+KE DGKPKI +VTVFERPGLHEFLKQL  FA+LVLFTAGLEGYAR
Sbjct  138  EAGLKWFELECVSSEKEYDGKPKINHVTVFERPGLHEFLKQLSEFANLVLFTAGLEGYAR  197

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P+VDKID+EN F  RLYRPST STE+REHVKDLS IS DL R+VIVDNNPFSFLLQPLNG
Sbjct  198  PVVDKIDLENLFSHRLYRPSTISTEFREHVKDLSCISEDLCRVVIVDNNPFSFLLQPLNG  257

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCI FS GQP+D QL++ ILPLLKHLS+Q+DVRP L +RF MPEW + HGIP+   T
Sbjct  258  IPCISFSPGQPYDNQLLEEILPLLKHLSEQKDVRPVLRERFQMPEWFQNHGIPTCEFT  315



>ref|XP_011046823.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Populus 
euphratica]
Length=295

 Score =   292 bits (748),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKEC+GK KI YVTVFERPGL EFLKQL  FA+LVLFTAGLEGYAR
Sbjct  118  EAGLKWFELECVSSDKECEGKLKINYVTVFERPGLDEFLKQLSEFAELVLFTAGLEGYAR  177

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID ENRF  RLYRPSTTSTEY+EHVKDLS ISND  RIVIVDNNPFSFLLQPLNG
Sbjct  178  PLVDKIDAENRFSLRLYRPSTTSTEYQEHVKDLSCISNDPCRIVIVDNNPFSFLLQPLNG  237

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PFSAGQPHD QL+DV+LPLLKHLSQQ DVRP L++RFHM EW +K GIP+SG T
Sbjct  238  IPCVPFSAGQPHDTQLLDVLLPLLKHLSQQNDVRPVLSERFHMLEWFQKQGIPASGWT  295



>ref|XP_006378658.1| hypothetical protein POPTR_0010s19580g [Populus trichocarpa]
 gb|ERP56455.1| hypothetical protein POPTR_0010s19580g [Populus trichocarpa]
Length=294

 Score =   292 bits (748),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFEL+C+SSDKEC+GKPKI YVTVFERPGL EFLKQL  FA+LVLFTAGLEGYAR
Sbjct  117  EAGLKWFELDCISSDKECEGKPKINYVTVFERPGLDEFLKQLSEFAELVLFTAGLEGYAR  176

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST+STEYREHVKDLS IS D  RIVIVDNNPFSFLLQPLNG
Sbjct  177  PLVDRIDTENRFSLRLYRPSTSSTEYREHVKDLSCISKDPCRIVIVDNNPFSFLLQPLNG  236

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PFSAGQPHD QL+DV+LPLLK LSQQ+DVRP L +RFHMPEW +K GIP+SG T
Sbjct  237  IPCVPFSAGQPHDTQLLDVLLPLLKQLSQQKDVRPVLYERFHMPEWFQKQGIPASGWT  294



>ref|XP_010095241.1| CTD small phosphatase-like protein 2 [Morus notabilis]
 gb|EXB59009.1| CTD small phosphatase-like protein 2 [Morus notabilis]
Length=234

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKECDGKPKI YVTVFERPGL EFLKQ+G FA LVLFTAGLEGYAR
Sbjct  56   EAGLKWFELECVSSDKECDGKPKISYVTVFERPGLQEFLKQIGEFAVLVLFTAGLEGYAR  115

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST STEYREHVKDLS +S DLSR+VIVDNNPFSFLLQP NG
Sbjct  116  PLVDRIDAENRFSLRLYRPSTVSTEYREHVKDLSNLSKDLSRVVIVDNNPFSFLLQPSNG  175

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCIPFSAGQP+D+QL++V+LPLLKHLS+Q+DVRP L  RF MPEW + HGIP  G
Sbjct  176  IPCIPFSAGQPYDDQLLEVLLPLLKHLSKQKDVRPVLCDRFRMPEWFQMHGIPVFG  231



>ref|XP_010067527.1| PREDICTED: CTD small phosphatase-like protein [Eucalyptus grandis]
 gb|KCW65680.1| hypothetical protein EUGRSUZ_G03062 [Eucalyptus grandis]
Length=289

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E+GL WF+LEC+SS+K+ +GKPK+  VTVFERPGL EFL+QL  FADLVLFTAGLEGYA+
Sbjct  111  ESGLEWFDLECISSEKDSEGKPKVNLVTVFERPGLQEFLEQLHEFADLVLFTAGLEGYAK  170

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD IDVENRF  RLYRPST STEYREHVKDLS +S DLSRIVIVDNNPFSFLLQP+NG
Sbjct  171  PLVDTIDVENRFSLRLYRPSTISTEYREHVKDLSCLSKDLSRIVIVDNNPFSFLLQPVNG  230

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGL  221
            IPCIPF+AGQPHD QL++V++PLLKHLS Q DVRP L +RF MPEW +K+GIP+ GL
Sbjct  231  IPCIPFTAGQPHDNQLLEVLVPLLKHLSMQRDVRPVLYERFRMPEWFQKYGIPALGL  287



>emb|CAN64082.1| hypothetical protein VITISV_006933 [Vitis vinifera]
Length=208

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E+GL WFELECVSSDKEC+GKPK+ YVTVFERPGL EFLKQL  F++LVLFTAGLEGYAR
Sbjct  30   ESGLKWFELECVSSDKECEGKPKVNYVTVFERPGLREFLKQLSEFSELVLFTAGLEGYAR  89

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVEN F  RLYRPST STEYREHVKDLS +S DL RIVIVDNNPFSFLLQPLNG
Sbjct  90   PLVDRIDVENLFSLRLYRPSTISTEYREHVKDLSCLSKDLCRIVIVDNNPFSFLLQPLNG  149

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            +PCIPFSAGQP+D QL++V+LPLLKHLSQQ DVRP L  RF MPEW +KHGIP+SG T 
Sbjct  150  VPCIPFSAGQPNDGQLLEVLLPLLKHLSQQNDVRPVLYDRFRMPEWFQKHGIPASGWTV  208



>ref|XP_003545230.1| PREDICTED: LOW QUALITY PROTEIN: carboxy-terminal domain RNA polymerase 
II polypeptide A small phosphatase 2-like [Glycine 
max]
Length=393

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GLNWFELECVS DKE +GK KI YVTVFERPGL EFLKQL  FAD+VLFTAGLEGYAR
Sbjct  216  EGGLNWFELECVSIDKEGEGK-KINYVTVFERPGLKEFLKQLSEFADMVLFTAGLEGYAR  274

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVENRF  RLYRPST STEYREHVKDL+ IS DL RIVIVDNNPFSF+LQP+NG
Sbjct  275  PLVDRIDVENRFSLRLYRPSTISTEYREHVKDLTCISKDLCRIVIVDNNPFSFVLQPVNG  334

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCIPFSAGQPHD QL+DVILPLLK LS+Q DVRP L ++FHMP+W +K GIP+S  T
Sbjct  335  IPCIPFSAGQPHDTQLLDVILPLLKQLSEQNDVRPFLYEKFHMPDWFQKQGIPASSWT  392



>ref|XP_002273682.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Vitis vinifera]
 emb|CBI25474.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E+GL WFELECVSSDKEC+GKPK+ YVTVFERPGL EFLKQL  F++LVLFTAGLEGYAR
Sbjct  140  ESGLKWFELECVSSDKECEGKPKVNYVTVFERPGLREFLKQLSEFSELVLFTAGLEGYAR  199

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVEN F  RLYRPST STEYREHVKDLS +S DL RIVIVDNNPFSFLLQPLNG
Sbjct  200  PLVDRIDVENLFSLRLYRPSTISTEYREHVKDLSCLSKDLCRIVIVDNNPFSFLLQPLNG  259

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            +PCIPFSAGQP+D QL++V+LPLLKHLSQQ DVRP L  RF MPEW +KHGIP+SG T 
Sbjct  260  VPCIPFSAGQPNDGQLLEVLLPLLKHLSQQNDVRPVLYDRFRMPEWFQKHGIPASGWTV  318



>ref|XP_009385548.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Musa acuminata subsp. malaccensis]
Length=313

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+  FELEC+S DKE +GK K+ +VTVFERPGL EFL+Q+  FADLVLFTAGLE YAR
Sbjct  124  EAGVKCFELECISMDKEVEGKQKVNHVTVFERPGLQEFLQQISEFADLVLFTAGLEDYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKIDVENRF  RLYRP+T STEYR+HVKDLS +S DLSR VIVDNNPFSFLLQPLNG
Sbjct  184  PLVDKIDVENRFSLRLYRPATVSTEYRDHVKDLSCLSKDLSRTVIVDNNPFSFLLQPLNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSAGQP+DEQLM VILPLLKHLS ++DVRPAL +RFHMPEW + HGI SS  T+
Sbjct  244  IPCVPFSAGQPYDEQLMGVILPLLKHLSVEKDVRPALYERFHMPEWFQNHGIHSSDGTS  302



>ref|XP_003616639.1| CTD small phosphatase-like protein [Medicago truncatula]
 gb|AES99597.1| NLI interacting factor-like phosphatase [Medicago truncatula]
Length=305

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGLNWF++ECVSSDKE +G+PKI YVTVFERPGL EFL +L  FADLVLFTAGLEGYAR
Sbjct  127  EAGLNWFDMECVSSDKEGEGRPKINYVTVFERPGLKEFLTKLSEFADLVLFTAGLEGYAR  186

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD ID ENRF  RLYRPST STE+REHVKDL+ IS DL RIVIVDNNPFSF+LQP+NG
Sbjct  187  PLVDIIDKENRFSLRLYRPSTISTEHREHVKDLTCISKDLDRIVIVDNNPFSFVLQPVNG  246

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCIPFSAG PHD QL+DVILPLLK LS+Q DVRP L ++FHM +W +K GIP+S  T
Sbjct  247  IPCIPFSAGHPHDTQLLDVILPLLKQLSEQNDVRPLLYEKFHMTDWFQKQGIPASSWT  304



>ref|XP_008805431.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Phoenix dactylifera]
Length=301

 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELEC+S DKE +GK K+ +VTVFERPGL EFL+Q+  FADLVLFTAGLEGYAR
Sbjct  123  EAGLKCFELECISIDKEVEGKQKVNHVTVFERPGLQEFLQQISDFADLVLFTAGLEGYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID+ENRF  RLYRP+T STEYREHVKDL+ +S DL R V+VDNNPFSFLLQPLNG
Sbjct  183  PLVDRIDIENRFSLRLYRPATVSTEYREHVKDLTCLSKDLCRTVLVDNNPFSFLLQPLNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PFSAGQP+DEQLM V+ PLLKHLS Q+DVRP L++RFHMPEW +KHGIP S  T
Sbjct  243  IPCVPFSAGQPYDEQLMAVVFPLLKHLSLQKDVRPVLHERFHMPEWFQKHGIPPSNQT  300



>gb|EPS72976.1| hypothetical protein M569_01780, partial [Genlisea aurea]
Length=307

 Score =   288 bits (736),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+NWFELECVSSDKE +GKPKI YVTVFERPG+ +FLKQL  +ADLVLFTAGLEGYAR
Sbjct  132  EAGINWFELECVSSDKEINGKPKINYVTVFERPGMKDFLKQLSEYADLVLFTAGLEGYAR  191

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  N F +RLYRPST +T YR+HVKDLS +S DLSRIVIVDNNPFSFLLQP NG
Sbjct  192  PLVDRIDASNLFTQRLYRPSTVTTPYRDHVKDLSCLSKDLSRIVIVDNNPFSFLLQPSNG  251

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPC+PFSA QP D+QLM+VILPLLK LS Q DVRP L  +F MPEW +KHGIP  G
Sbjct  252  IPCVPFSAAQPRDDQLMEVILPLLKQLSVQRDVRPVLYDKFRMPEWFKKHGIPDPG  307



>ref|XP_010922553.1| PREDICTED: CTD small phosphatase-like protein 2 [Elaeis guineensis]
Length=302

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELEC+S DKE +GK K+ +VTVFERPGL EFL Q+  FADLVLFTAGLEGYAR
Sbjct  124  EAGLKCFELECISIDKEVEGKQKVNHVTVFERPGLQEFLCQISEFADLVLFTAGLEGYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVENRF  RLYRP+T STEYREHVKDL+ +S DLSR VIVDNNPFSFLLQP NG
Sbjct  184  PLVDRIDVENRFSLRLYRPATVSTEYREHVKDLTCLSKDLSRTVIVDNNPFSFLLQPSNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSAGQP+DEQLM V+ PLLKHLS Q+DVRP L +RFHMPEW +KHGIP S  T+
Sbjct  244  IPCVPFSAGQPYDEQLMGVVFPLLKHLSLQKDVRPVLYERFHMPEWFQKHGIPPSNPTS  302



>ref|XP_004307664.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=297

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E G+ WFELEC+SSDKECDGKPK+ YVTVFERPGLHEFLKQ+  FADLVLFTAGLEGYAR
Sbjct  120  EGGMKWFELECISSDKECDGKPKVNYVTVFERPGLHEFLKQVHGFADLVLFTAGLEGYAR  179

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVENRF  RLYRPSTTSTEYREHVKDLSG+S DL RIV+VDNNPFSFLLQPLNG
Sbjct  180  PLVDRIDVENRFSFRLYRPSTTSTEYREHVKDLSGLSKDLGRIVLVDNNPFSFLLQPLNG  239

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCIPFSAGQ HD QL+DV+LPLLKHLS Q+DVRP L +RFHMPEW +K GIPS+ 
Sbjct  240  IPCIPFSAGQLHDTQLLDVLLPLLKHLSLQKDVRPVLYERFHMPEWFQKQGIPSTS  295



>ref|XP_009377758.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=297

 Score =   285 bits (730),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFE+EC+SS KE DGKPK+ YVTVFERPGL EFLK++  FADLVLFTAGLE YAR
Sbjct  122  EAGLKWFEIECLSSGKESDGKPKVNYVTVFERPGLREFLKRVCEFADLVLFTAGLEDYAR  181

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVEN F  RLYRPST STE+REHVKDLS +S D SRIVIVDNNPFSFLLQPLNG
Sbjct  182  PLVDRIDVENLFKLRLYRPSTVSTEFREHVKDLSCLSKDFSRIVIVDNNPFSFLLQPLNG  241

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPC+PFSAGQP+D+QL++V+ PLLK LS Q+DVRP L++RFHMPEW + HG P SG
Sbjct  242  IPCVPFSAGQPYDDQLLEVLHPLLKQLSLQKDVRPMLHERFHMPEWFQMHGFPVSG  297



>gb|KFK34835.1| hypothetical protein AALP_AA5G199300 [Arabis alpina]
Length=301

 Score =   285 bits (729),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+S+DKECDGKPKI YVTVFERPGLHEFL++L  FADLVLFTAGLEGYAR
Sbjct  123  EAGLKWFELECLSADKECDGKPKINYVTVFERPGLHEFLEKLSQFADLVLFTAGLEGYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  N    RLYRPST ST+YR+HVKDL   S ++ R VIVDNNPFSFLLQP NG
Sbjct  183  PLVDRIDTRNVLSNRLYRPSTVSTQYRDHVKDLLSTSKNMCRTVIVDNNPFSFLLQPSNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCI FSAGQP+D QL+DVILPLLK LS+++DVRP L  RF MPEW EK GIP S   T
Sbjct  243  IPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDRFRMPEWFEKQGIPPSCWNT  301



>gb|KJB78769.1| hypothetical protein B456_013G018000 [Gossypium raimondii]
Length=302

 Score =   285 bits (729),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFELECVSSDKEC+GKPKI YVTVFERPGL +FL QL  FA+LVLFTAGLEGYAR
Sbjct  124  DAGLKWFELECVSSDKECEGKPKINYVTVFERPGLQDFLNQLSEFAELVLFTAGLEGYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST STEYREHVKDL+ IS DL R VIVDNNPFSFLLQP+NG
Sbjct  184  PLVDRIDAENRFSLRLYRPSTVSTEYREHVKDLTCISKDLCRTVIVDNNPFSFLLQPVNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCIPFSAGQPHD QL+ V+LPLLKHLSQ++DVRP L  RF MPEW +K GIPSS  +
Sbjct  244  IPCIPFSAGQPHDTQLLGVLLPLLKHLSQEKDVRPVLYDRFRMPEWFQKQGIPSSSWS  301



>ref|XP_008345306.1| PREDICTED: probable C-terminal domain small phosphatase [Malus 
domestica]
Length=298

 Score =   285 bits (729),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GL WFELECVSSDKECDGKPK+ YVTVFERPGLH+FLKQ+  FA+LVLFTAGLEGYAR
Sbjct  121  EGGLKWFELECVSSDKECDGKPKVNYVTVFERPGLHDFLKQVSQFAELVLFTAGLEGYAR  180

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV+N F  RLYRPSTTSTEYREHVKDLSG+S D+ RIVIVDNNPFSFLLQPLNG
Sbjct  181  PLVDRIDVDNLFSYRLYRPSTTSTEYREHVKDLSGLSKDMRRIVIVDNNPFSFLLQPLNG  240

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCIPFSAGQ HD+QL+DV+LPLLK LS Q+DVRPAL +RFHMPEW +K GIPS+ 
Sbjct  241  IPCIPFSAGQTHDKQLLDVLLPLLKQLSLQKDVRPALYERFHMPEWFQKQGIPSTA  296



>ref|XP_007008962.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY17772.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 1 [Theobroma cacao]
Length=310

 Score =   284 bits (726),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFELECVSSDKE +GKPKI YVTVFERPGL EFL QL  FA+LVLFTAGLEGYAR
Sbjct  132  DAGLKWFELECVSSDKEFEGKPKINYVTVFERPGLQEFLNQLSEFAELVLFTAGLEGYAR  191

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST STEYREHVKDLS +S DL R VIVDNNPFSFLLQPLNG
Sbjct  192  PLVDRIDAENRFSLRLYRPSTISTEYREHVKDLSCLSKDLCRTVIVDNNPFSFLLQPLNG  251

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFSAGQPHD QL+DV+LPLLKHLSQQ+DVR  L +RF MPEW +K GIP+SG + 
Sbjct  252  IPCIPFSAGQPHDTQLLDVLLPLLKHLSQQKDVRSVLYERFRMPEWFQKQGIPASGWSV  310



>ref|XP_002878054.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54313.1| NLI interacting factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   283 bits (724),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+S+DKECDGKPKI YVTVFERPGLHEFL+QL  FADLVLFTAGLEGYAR
Sbjct  126  EAGLKWFELECLSTDKECDGKPKINYVTVFERPGLHEFLEQLSEFADLVLFTAGLEGYAR  185

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++ R VIVDNNPFSFLLQP NG
Sbjct  186  PLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNMCRTVIVDNNPFSFLLQPSNG  245

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCI FSAGQP+D QL+DVILPLLK LS+++DVRP L  RF MPEW EK GIP S
Sbjct  246  IPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDRFRMPEWFEKQGIPPS  300



>ref|XP_009369172.1| PREDICTED: probable C-terminal domain small phosphatase [Pyrus 
x bretschneideri]
 ref|XP_009369173.1| PREDICTED: probable C-terminal domain small phosphatase [Pyrus 
x bretschneideri]
Length=300

 Score =   283 bits (724),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GL WFELECVSSDKECDGKPK+ YVTVFERPGL +FLKQ+  FA+LVLFTAGLEGYAR
Sbjct  123  EGGLKWFELECVSSDKECDGKPKVNYVTVFERPGLQDFLKQVSQFAELVLFTAGLEGYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV+N F  RLYRPSTTSTEYREHVKDLSG+S D+ RIVIVDNNPFSFLLQPLNG
Sbjct  183  PLVDRIDVDNLFSYRLYRPSTTSTEYREHVKDLSGLSKDMRRIVIVDNNPFSFLLQPLNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCIPFSAGQ HD+QL+DV+LPLLK LS Q+DVRPAL +RFHMPEW +K GIPS+ 
Sbjct  243  IPCIPFSAGQTHDKQLLDVLLPLLKQLSLQKDVRPALYERFHMPEWFQKQGIPSTA  298



>ref|XP_004302575.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Fragaria vesca subsp. vesca]
Length=295

 Score =   282 bits (721),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFE+ECVSSDK+ DGKPKI YVTVFERPGLHEFLK++G FADLVLFTAGLEGYAR
Sbjct  120  DAGLKWFEIECVSSDKDSDGKPKISYVTVFERPGLHEFLKRIGEFADLVLFTAGLEGYAR  179

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVENRF  RLYRPST +TE R+HVKD+S IS DL RIVIVDNNPFSFLLQPLNG
Sbjct  180  PLVDRIDVENRFKFRLYRPSTVTTEKRDHVKDISCISKDLCRIVIVDNNPFSFLLQPLNG  239

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            +PCIPFSAG P+D+QL++V+LPLLKHL QQ+DVRP L +RFHMPEW + HGI  SG
Sbjct  240  VPCIPFSAGHPYDDQLLEVLLPLLKHLGQQKDVRPVLYERFHMPEWFQMHGITVSG  295



>ref|XP_010427400.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=301

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+S+DKECDGKPKI YVTVFERPGLHEFL++L  FADLVLFTAGLEGYAR
Sbjct  123  EAGLKWFELECLSTDKECDGKPKINYVTVFERPGLHEFLEKLSEFADLVLFTAGLEGYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++ R VIVDNNPFSFLLQP NG
Sbjct  183  PLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNMCRTVIVDNNPFSFLLQPSNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCI FSAGQP+D QL+DVILPLLK LS++EDVRP L  RF MPEW EK GIP S
Sbjct  243  IPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDRFRMPEWFEKQGIPPS  297



>ref|XP_004970462.1| PREDICTED: CTD small phosphatase-like protein 2-like [Setaria 
italica]
Length=312

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+SSDK+ DGK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  134  EAGLHCFDMECISSDKDVDGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  193

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV NRF  RLYRPST +TE+REHVKDLS +S D  RIVIVDNNPFSF+LQPLNG
Sbjct  194  PLVDRIDVHNRFRLRLYRPSTVTTEFREHVKDLSCVSKDFCRIVIVDNNPFSFILQPLNG  253

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+PFSAGQ  D+QLM VI PLLKHLS Q+DVRP L++RFHMPEW +KHGIP +
Sbjct  254  IPCVPFSAGQHSDDQLMTVIFPLLKHLSLQKDVRPVLHERFHMPEWFQKHGIPQT  308



>gb|EMS66920.1| CTD small phosphatase-like protein 2 [Triticum urartu]
Length=232

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+S+DK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  54   EAGLHCFDMECISTDKDVEGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  113

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD ID  NRF  RLYRPST +TEYREHVKDLS +S D SRIVIVDNNPFSF++QPLNG
Sbjct  114  PLVDIIDAHNRFKLRLYRPSTVTTEYREHVKDLSCLSKDFSRIVIVDNNPFSFIVQPLNG  173

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+PFSAGQ  D+QLM+VI PLLKHLS Q DVRPAL +RFHMPEW +KHGIP +
Sbjct  174  IPCVPFSAGQHSDDQLMEVIFPLLKHLSVQRDVRPALYERFHMPEWFQKHGIPRT  228



>emb|CDX67629.1| BnaA07g16690D [Brassica napus]
Length=296

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGLNWFELEC+SSDKE +GKPKI YVTVFERPGLH+FL+QL  FADLVLFTAGLEGYAR
Sbjct  118  EAGLNWFELECLSSDKEVNGKPKINYVTVFERPGLHDFLEQLSHFADLVLFTAGLEGYAR  177

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++SR VIVDNNPFSFLLQP NG
Sbjct  178  PLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSTNMSRTVIVDNNPFSFLLQPSNG  237

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+ FSAGQP+D QL+DVILPLLK LS++EDVR  L  RFHMPEW EK GIP S
Sbjct  238  IPCVAFSAGQPNDTQLLDVILPLLKQLSEEEDVRRTLYDRFHMPEWFEKQGIPPS  292



>ref|XP_007205648.1| hypothetical protein PRUPE_ppa009333mg [Prunus persica]
 gb|EMJ06847.1| hypothetical protein PRUPE_ppa009333mg [Prunus persica]
Length=297

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 152/179 (85%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFE+ECVSSDKE DGKPK+ +VTVFERPGL EFLKQ+  FADLVLFTAG+E YAR
Sbjct  119  EAGLKWFEIECVSSDKEPDGKPKVNHVTVFERPGLREFLKQVYEFADLVLFTAGVEDYAR  178

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVEN F  RLYRPST STE REHVKDLS +S DL R VIVDNNPFSFLLQPLNG
Sbjct  179  PLVDRIDVENLFKLRLYRPSTVSTECREHVKDLSCLSKDLCRTVIVDNNPFSFLLQPLNG  238

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSAGQP+D+QL++V+LP LK LS Q+DVRP L +RFHMPEW + HG P S LT 
Sbjct  239  IPCVPFSAGQPNDDQLLEVLLPHLKQLSLQKDVRPVLYERFHMPEWFQMHGFPVSVLTA  297



>gb|KHG26952.1| ctdspl2 [Gossypium arboreum]
Length=302

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFELECVSSDKEC+GKPKI YVTVFERPGL +FL QL  FA+LVLFTAGLEGYAR
Sbjct  124  DAGLKWFELECVSSDKECEGKPKINYVTVFERPGLQDFLNQLSEFAELVLFTAGLEGYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST STEYREHVKDL+ I  DL R VIVDNNPFSFLLQP+NG
Sbjct  184  PLVDRIDAENRFSLRLYRPSTVSTEYREHVKDLTCIFKDLCRTVIVDNNPFSFLLQPVNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCIPFSAGQPHD QL+ V+LPLLKHLSQ++DVRP L  RF MPEW +K GIPSS
Sbjct  244  IPCIPFSAGQPHDTQLLGVLLPLLKHLSQEKDVRPVLYDRFRMPEWFQKQGIPSS  298



>gb|ACG32959.1| CTD small phosphatase-like protein [Zea mays]
 tpg|DAA56988.1| TPA: CTD small phosphatase-like protein [Zea mays]
Length=311

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+SSDK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  133  EAGLHCFDMECISSDKDAEGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  192

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV NRF  RLYRPST +TEYREHVKDLS +S D  RIVIVDNNPFSF+LQPLNG
Sbjct  193  PLVDRIDVHNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGRIVIVDNNPFSFILQPLNG  252

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+PFSAGQ  D+QLM VI PLLKHLS Q+DVRP L++RFHMPEW +KHGIP +
Sbjct  253  IPCVPFSAGQHSDDQLMMVIFPLLKHLSLQKDVRPVLHERFHMPEWFQKHGIPQT  307



>gb|KFK23193.1| hypothetical protein AALP_AAs48948U000100 [Arabis alpina]
Length=303

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SS KEC GKPKI YVTVFERPGLHEFL+QL  FA L+LFTAGLE YAR
Sbjct  118  EAGLKWFELECISSTKECKGKPKINYVTVFERPGLHEFLEQLSQFAHLILFTAGLEDYAR  177

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID +N    RLYRPST ST+Y +HVKDL   S ++ R VIVDNNP+SF+LQPLNG
Sbjct  178  PLVDRIDAKNVLRDRLYRPSTVSTQYGDHVKDLLSASKNMHRTVIVDNNPYSFVLQPLNG  237

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSA QPHD QL+D ILPLLK +S+ EDVRPAL +RFHMPEW EKHGIP S  T+
Sbjct  238  IPCVPFSAEQPHDTQLLDFILPLLKQVSEVEDVRPALYERFHMPEWFEKHGIPRSCWTS  296



>ref|XP_009344958.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=301

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E G+ WFELECVSSDKECDGKPK+ YVTVFERPGLH+FLKQ+  FA+LVLFTAGLEGYAR
Sbjct  124  EGGMKWFELECVSSDKECDGKPKVNYVTVFERPGLHDFLKQVSQFAELVLFTAGLEGYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV+N F  RLYRPSTTSTEYREHVKDLSG+S D+ RIVIVDNNPFSFLLQP NG
Sbjct  184  PLVDRIDVDNLFSCRLYRPSTTSTEYREHVKDLSGLSKDMRRIVIVDNNPFSFLLQPSNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCIPFSAGQ HD QL+DV+LPLLK LS Q+DVRPAL +RFHMPEW +K GIPS+ 
Sbjct  244  IPCIPFSAGQTHDTQLLDVLLPLLKQLSLQKDVRPALYERFHMPEWFQKQGIPSTA  299



>ref|XP_006403042.1| hypothetical protein EUTSA_v10006119mg [Eutrema salsugineum]
 gb|ESQ44495.1| hypothetical protein EUTSA_v10006119mg [Eutrema salsugineum]
Length=305

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFELECVSSDKE DGKPKI YVTVFERPGLHEFL+QL  FADLVLFTAGLEGYAR
Sbjct  127  DAGLKWFELECVSSDKEYDGKPKINYVTVFERPGLHEFLEQLSQFADLVLFTAGLEGYAR  186

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++ R VIVDNNPFSFLLQP NG
Sbjct  187  PLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNMCRTVIVDNNPFSFLLQPSNG  246

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCI FSAGQP+D QL+DVILPLLK LS+++DVRP L  RF MPEW EK GIP S   T
Sbjct  247  IPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDRFRMPEWFEKQGIPPSCWNT  305



>ref|XP_010516189.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=300

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+S+DKECDGKPKI YVTVFERPGLHEFL++L  FADLVLFTAGLEGYAR
Sbjct  122  EAGLKWFELECLSTDKECDGKPKINYVTVFERPGLHEFLEKLSEFADLVLFTAGLEGYAR  181

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++ R VIVDNNPFSFLLQP NG
Sbjct  182  PLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNMCRTVIVDNNPFSFLLQPSNG  241

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCI FSAGQP+D QL+DVILPLLK LS+++DVRP L  RF MPEW EK GIP S
Sbjct  242  IPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDRFRMPEWFEKQGIPPS  296



>ref|XP_006429395.1| hypothetical protein CICLE_v10012210mg [Citrus clementina]
 gb|ESR42635.1| hypothetical protein CICLE_v10012210mg [Citrus clementina]
Length=321

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELECVSSDKECDGKPKI YVTVFERPGLHEFLK+L  FADLVLFTAGLEGYAR
Sbjct  143  EAGLKLFELECVSSDKECDGKPKINYVTVFERPGLHEFLKKLAEFADLVLFTAGLEGYAR  202

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID EN F  RLYRPST STEYREHVKDLS +S DL R+V+VDNNPFSFLLQPLNG
Sbjct  203  PLVDKIDRENLFSLRLYRPSTVSTEYREHVKDLSCLSKDLCRVVLVDNNPFSFLLQPLNG  262

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFS GQP+D QL++V+LPLL HLS Q+DVRP L++RFHMPEW + HGIP+S LT 
Sbjct  263  IPCIPFSTGQPYDNQLLEVLLPLLNHLSLQKDVRPVLHERFHMPEWFQMHGIPASALTV  321



>ref|XP_008374036.1| PREDICTED: CTD small phosphatase-like protein [Malus domestica]
Length=301

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E G+ WFELECVSSDKECDGKPK+ YVTVFERPGLH+FLKQ+  FA+LVLFTAGLEGYAR
Sbjct  124  EGGMKWFELECVSSDKECDGKPKVNYVTVFERPGLHDFLKQVSQFAELVLFTAGLEGYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV+N F  RLYRPSTTSTEYREHVKDLSG+S D+ RIVIVDNNPFSFLLQP NG
Sbjct  184  PLVDRIDVDNLFSCRLYRPSTTSTEYREHVKDLSGLSKDMRRIVIVDNNPFSFLLQPSNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCIPFSAGQ HD QL+DV+LPLLK LS Q+DVRPAL +RFHMPEW +K GIPS+ 
Sbjct  244  IPCIPFSAGQTHDTQLLDVLLPLLKQLSLQKDVRPALYERFHMPEWFQKQGIPSNA  299



>ref|XP_010504466.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Camelina sativa]
Length=300

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+S+DKECDGKPKI YVTVFERPGLHEFL++L  FADL+LFTAGLEGYAR
Sbjct  122  EAGLKWFELECLSTDKECDGKPKINYVTVFERPGLHEFLEKLSEFADLILFTAGLEGYAR  181

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++ R VIVDNNPFSFLLQP NG
Sbjct  182  PLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNMCRTVIVDNNPFSFLLQPSNG  241

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCI FSAGQP+D QL+DVILPLLK LS+++DVRP L  RF MPEW EK GIP S
Sbjct  242  IPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDRFRMPEWFEKQGIPPS  296



>ref|XP_006481044.1| PREDICTED: CTD small phosphatase-like protein-like [Citrus sinensis]
Length=321

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELECVSSDKECDGKPKI YVTVFERPGLHEFLK+L  FADLVLFTAGLEGYAR
Sbjct  143  EAGLKLFELECVSSDKECDGKPKINYVTVFERPGLHEFLKKLAEFADLVLFTAGLEGYAR  202

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID EN F  RLYRPST STEYREHVKDLS +S DL R+V+VDNNPFSFLLQPLNG
Sbjct  203  PLVDKIDRENLFSLRLYRPSTVSTEYREHVKDLSCLSKDLCRVVLVDNNPFSFLLQPLNG  262

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFS GQP+D QL++V+LPLL HLS Q+DVRP L++RFHMPEW + HGIP+S LT 
Sbjct  263  IPCIPFSTGQPYDNQLLEVLLPLLNHLSLQKDVRPVLHERFHMPEWFQMHGIPASALTV  321



>emb|CDY46516.1| BnaC06g15690D [Brassica napus]
Length=303

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGLNWFELEC+SSDKE +GKPKI YVTVFERPGLH+FL+QL  FADLVLFTAGLEGYAR
Sbjct  125  DAGLNWFELECLSSDKEVNGKPKINYVTVFERPGLHDFLEQLSHFADLVLFTAGLEGYAR  184

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++SR VIVDNNPFSFLLQP NG
Sbjct  185  PLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSTNMSRTVIVDNNPFSFLLQPSNG  244

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+ FSAGQP+D QL+DVILPLLK LS++EDVR  L  RFHMPEW +K GIP+S
Sbjct  245  IPCVAFSAGQPNDTQLLDVILPLLKQLSEEEDVRRTLYDRFHMPEWFQKQGIPTS  299



>ref|XP_006291562.1| hypothetical protein CARUB_v10017717mg [Capsella rubella]
 gb|EOA24460.1| hypothetical protein CARUB_v10017717mg [Capsella rubella]
Length=303

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+S+DKECDGKPKI YVTVFERPGLHEFL++L  FADLVLFTAGLEGYAR
Sbjct  125  EAGLKWFELECLSTDKECDGKPKINYVTVFERPGLHEFLEKLSEFADLVLFTAGLEGYAR  184

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++ R VIVDNNPFSFLLQP NG
Sbjct  185  PLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNMYRTVIVDNNPFSFLLQPSNG  244

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCI FSAGQP+D QL+DVILPLLK LS+++DVRP L  RF MPEW EK GIP S
Sbjct  245  IPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDRFRMPEWFEKQGIPPS  299



>ref|XP_008672265.1| PREDICTED: uncharacterized protein LOC100216776 isoform X1 [Zea 
mays]
Length=360

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+SSDK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  133  EAGLHCFDMECISSDKDAEGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  192

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV NRF  RLYRPST +TEYREHVKDLS +S D  RIVIVDNNPFSF+LQPLNG
Sbjct  193  PLVDRIDVHNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGRIVIVDNNPFSFILQPLNG  252

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPC+PFSAGQ  D+QLM VI PLLKHLS Q+DVRP L++RFHMPEW +KHGIP + 
Sbjct  253  IPCVPFSAGQHSDDQLMMVIFPLLKHLSLQKDVRPVLHERFHMPEWFQKHGIPQTN  308



>ref|NP_001136647.1| uncharacterized protein LOC100216776 [Zea mays]
 gb|ACF82332.1| unknown [Zea mays]
 tpg|DAA56987.1| TPA: CTD small phosphatase-like protein [Zea mays]
Length=364

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+SSDK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  133  EAGLHCFDMECISSDKDAEGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  192

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV NRF  RLYRPST +TEYREHVKDLS +S D  RIVIVDNNPFSF+LQPLNG
Sbjct  193  PLVDRIDVHNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGRIVIVDNNPFSFILQPLNG  252

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPC+PFSAGQ  D+QLM VI PLLKHLS Q+DVRP L++RFHMPEW +KHGIP + 
Sbjct  253  IPCVPFSAGQHSDDQLMMVIFPLLKHLSLQKDVRPVLHERFHMPEWFQKHGIPQTN  308



>gb|KDO56645.1| hypothetical protein CISIN_1g020937mg [Citrus sinensis]
Length=319

 Score =   281 bits (718),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELECVSSDKECDGKPKI YVTVFERPGLHEFLK+L  FADLVLFTAGLEGYAR
Sbjct  141  EAGLKLFELECVSSDKECDGKPKINYVTVFERPGLHEFLKKLAEFADLVLFTAGLEGYAR  200

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID EN F  RLYRPST STEYREHVKDLS +S DL R+V+VDNNPFSFLLQPLNG
Sbjct  201  PLVDKIDRENLFSLRLYRPSTVSTEYREHVKDLSCLSKDLCRVVLVDNNPFSFLLQPLNG  260

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFS GQP+D QL++V+LPLL HLS Q+DVRP L++RFHMPEW + HGIP+S LT 
Sbjct  261  IPCIPFSTGQPYDNQLLEVLLPLLNHLSLQKDVRPVLHERFHMPEWFQMHGIPASALTV  319



>ref|XP_009103976.1| PREDICTED: CTD small phosphatase-like protein [Brassica rapa]
Length=296

 Score =   280 bits (715),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGLNWFELEC+SSDKE +GKPKI YVTVFERPGLH+FL+QL  FADLVLFTAGLEGYAR
Sbjct  118  DAGLNWFELECLSSDKEVNGKPKINYVTVFERPGLHDFLEQLSHFADLVLFTAGLEGYAR  177

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++SR VIVDNNPFSFLLQP NG
Sbjct  178  PLVDRIDTRKVLSNRLYRPSTVSTQYRDHVKDLLSTSKNMSRTVIVDNNPFSFLLQPSNG  237

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+ FSAGQP+D QL+DVILPLLK LS++EDVR  L  RFHMPEW EK GIP S
Sbjct  238  IPCVAFSAGQPNDTQLLDVILPLLKQLSEEEDVRRTLYDRFHMPEWFEKQGIPPS  292



>gb|EEC71746.1| hypothetical protein OsI_04315 [Oryza sativa Indica Group]
Length=312

 Score =   280 bits (716),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+S++K+ +G+ K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  134  EAGLHCFDMECISTEKDVEGRNKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  193

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV NRF  RLYRPST +TEYREHVKDLS +S D  R+VIVDNNPFSF+LQPLNG
Sbjct  194  PLVDRIDVHNRFKLRLYRPSTVTTEYREHVKDLSCVSKDFCRVVIVDNNPFSFILQPLNG  253

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+PFSAGQ +D+QLM+VI PLLKHLS Q DVRPAL +RFHMPEW +KHGIP +
Sbjct  254  IPCVPFSAGQHNDDQLMEVIFPLLKHLSIQRDVRPALYERFHMPEWFQKHGIPQT  308



>ref|XP_002458718.1| hypothetical protein SORBIDRAFT_03g038910 [Sorghum bicolor]
 gb|EES03838.1| hypothetical protein SORBIDRAFT_03g038910 [Sorghum bicolor]
Length=314

 Score =   280 bits (716),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+SSDK+ +GK K+ +VTVFERPGLHEFL +   FADL+LFTAGLEGYAR
Sbjct  136  EAGLHCFDMECISSDKDVEGKQKVNHVTVFERPGLHEFLLKTSEFADLILFTAGLEGYAR  195

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV NRF  RLYRPST +TEYREHVKDLS +S D  RIVIVDNNPFSF+LQPLNG
Sbjct  196  PLVDRIDVHNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGRIVIVDNNPFSFILQPLNG  255

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPC+PFSAGQ  D+QLM VI PLLKHLS Q+DVRP L++RFHMPEW +KHGIP
Sbjct  256  IPCVPFSAGQHSDDQLMTVIFPLLKHLSLQKDVRPVLHERFHMPEWFQKHGIP  308



>ref|NP_001148462.1| LOC100282077 [Zea mays]
 gb|ACG31578.1| CTD small phosphatase-like protein [Zea mays]
 gb|AFW84679.1| CTD small phosphatase-like protein isoform 1 [Zea mays]
 gb|AFW84680.1| CTD small phosphatase-like protein isoform 2 [Zea mays]
Length=311

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+SSDK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  133  EAGLHCFDMECISSDKDVEGKQKVNHVTVFERPGLHEFLRKTSEFADLILFTAGLEGYAR  192

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV NRF  RLYRPST +TEYREHVKDL+ +S D  RIVIVDNNPFSF+LQPLNG
Sbjct  193  PLVDRIDVHNRFRIRLYRPSTVTTEYREHVKDLTRVSKDFGRIVIVDNNPFSFILQPLNG  252

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPC+PFSAGQ  D+QLM VI PLLKHLS Q+DVRP L +RFHMPEW + HGIP
Sbjct  253  IPCVPFSAGQHSDDQLMTVIFPLLKHLSLQKDVRPVLRERFHMPEWFQNHGIP  305



>ref|NP_191155.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Arabidopsis thaliana]
 emb|CAB87850.1| putative protein [Arabidopsis thaliana]
 gb|AAM20657.1| putative protein [Arabidopsis thaliana]
 gb|AAM61626.1| unknown [Arabidopsis thaliana]
 gb|AAN15623.1| putative protein [Arabidopsis thaliana]
 gb|AEE79461.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Arabidopsis thaliana]
Length=305

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+S+DKE DGKPKI YVTVFERPGLHEFL+QL  FADL+LFTAGLEGYAR
Sbjct  127  EAGLKWFELECLSTDKEYDGKPKINYVTVFERPGLHEFLEQLSEFADLILFTAGLEGYAR  186

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST+YR+HVKDL   S ++ R VIVDNNPFSFLLQP NG
Sbjct  187  PLVDRIDTRKVLTNRLYRPSTVSTQYRDHVKDLLSTSKNMCRTVIVDNNPFSFLLQPSNG  246

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCI FSAGQP+D QL+DVILPLLK LS+++DVRP L  RF MPEW EK GIP S
Sbjct  247  IPCIAFSAGQPNDTQLLDVILPLLKQLSEEDDVRPTLYDRFRMPEWFEKQGIPPS  301



>dbj|BAJ91589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+S+DK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  135  EAGLHCFDMECISTDKDVEGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  194

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD ID  NRF  RLYRPST +TEYREHVKDLS +S   SRIVIVDNNPFSF+LQPLNG
Sbjct  195  PLVDIIDAHNRFKLRLYRPSTVTTEYREHVKDLSCLSKQFSRIVIVDNNPFSFILQPLNG  254

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSAGQ  D+QLM+VI PLLKHLS Q DVRPAL +RFHMPEW +KHGIP +   T
Sbjct  255  IPCVPFSAGQHSDDQLMEVIFPLLKHLSVQRDVRPALYERFHMPEWFQKHGIPQTDQAT  313



>gb|EMT13698.1| CTD small phosphatase-like protein 2 [Aegilops tauschii]
Length=314

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+S+DK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  136  EAGLHCFDMECISTDKDVEGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  195

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD ID  NRF  RLYRPST +TEYREHVKDLS +S D SRIVIVDNNPFSF++QPLNG
Sbjct  196  PLVDIIDAHNRFKLRLYRPSTVTTEYREHVKDLSCLSKDFSRIVIVDNNPFSFIVQPLNG  255

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+PFSAGQ  D+QLM+VI PLLKHLS Q DVRPAL +RFHMPEW +KHGIP +
Sbjct  256  IPCVPFSAGQHSDDQLMEVIFPLLKHLSVQRDVRPALYERFHMPEWFQKHGIPRT  310



>emb|CDM84840.1| unnamed protein product [Triticum aestivum]
Length=313

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+S+DK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  135  EAGLHCFDMECISTDKDVEGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  194

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD ID  NRF  RLYRPST +TEYREHVKDLS +S D SRIVIVDNNPFSF++QPLNG
Sbjct  195  PLVDIIDAHNRFKLRLYRPSTVTTEYREHVKDLSCLSKDFSRIVIVDNNPFSFIVQPLNG  254

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+PFSAGQ  D+QLM+VI PLLKHLS Q DVRPAL +RFHMPEW +KHGIP +
Sbjct  255  IPCVPFSAGQHSDDQLMEVIFPLLKHLSVQRDVRPALYERFHMPEWFQKHGIPRT  309



>ref|NP_001044710.1| Os01g0833100 [Oryza sativa Japonica Group]
 dbj|BAD73773.1| NLI interacting factor (NIF) family protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF06624.1| Os01g0833100 [Oryza sativa Japonica Group]
 dbj|BAG91176.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55630.1| hypothetical protein OsJ_03971 [Oryza sativa Japonica Group]
Length=312

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+S++K+ +G+ K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  134  EAGLHCFDMECISTEKDVEGRNKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  193

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV NRF  RLYRPST +TEYREHVKDLS +S D  R+VIVDNNPFSF+LQPLNG
Sbjct  194  PLVDRIDVHNRFKLRLYRPSTVTTEYREHVKDLSCVSKDFCRVVIVDNNPFSFILQPLNG  253

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+PFSAGQ +D QLM+VI PLLKHLS Q DVRPAL +RFHMPEW +KHGIP +
Sbjct  254  IPCVPFSAGQHNDNQLMEVIFPLLKHLSIQRDVRPALYERFHMPEWFQKHGIPQT  308



>ref|XP_009116289.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Brassica 
rapa]
Length=291

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGLNWFELEC+SSDKE DGK KI YVTVFERPGLHEFL++L  FADLVLFTAGLEGYAR
Sbjct  113  EAGLNWFELECLSSDKESDGKSKINYVTVFERPGLHEFLEKLSQFADLVLFTAGLEGYAR  172

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID       RLYRPST ST YR+HVKDL   S ++SR VIVDNNPFSFLLQP NG
Sbjct  173  PLVDRIDTRKVLSNRLYRPSTVSTPYRDHVKDLLTTSKNMSRTVIVDNNPFSFLLQPSNG  232

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCI FSAGQP+D QL+DVILPLLK LS++EDVRP L  RF MPEW EK GIP S
Sbjct  233  IPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDRFRMPEWFEKQGIPPS  287



>ref|XP_008243657.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Prunus mume]
Length=297

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFE+EC SSDKE DGKPK+ +VTVFERPGL EFLKQ+  FADLVLFTAG+E YAR
Sbjct  119  EAGLKWFEIECASSDKEPDGKPKVNHVTVFERPGLREFLKQVYEFADLVLFTAGVEDYAR  178

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVEN F  RLYRPST STE REHVKDLS +S DL R VIVDNNPFSFLLQPLNG
Sbjct  179  PLVDRIDVENLFKLRLYRPSTVSTECREHVKDLSCLSKDLCRTVIVDNNPFSFLLQPLNG  238

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSAGQP D+QL++V+LP LK LS Q+DVRP L  RFHMPEW + HG P S LT 
Sbjct  239  IPCVPFSAGQPKDDQLLEVLLPHLKQLSLQKDVRPVLYDRFHMPEWFQMHGFPVSVLTA  297



>ref|XP_010264631.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Nelumbo 
nucifera]
Length=309

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKE DGKPK+ +VTVFERPGL EFLKQ   FADLVLFTAGLEGYAR
Sbjct  131  EAGLKWFELECVSSDKESDGKPKVNHVTVFERPGLREFLKQTSEFADLVLFTAGLEGYAR  190

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVE RF  RLYRPST STEYREHVKDLS +S DL RIVIVDNNPFSFLLQPLNG
Sbjct  191  PLVDRIDVEKRFSLRLYRPSTISTEYREHVKDLSCLSKDLCRIVIVDNNPFSFLLQPLNG  250

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCIPFSAGQP+DEQL++V+LPLLKHLS Q+DVRP L +RFHMPEW +KHGIP+S
Sbjct  251  IPCIPFSAGQPYDEQLLEVLLPLLKHLSLQKDVRPVLYERFHMPEWFQKHGIPTS  305



>emb|CDX72186.1| BnaC08g26880D [Brassica napus]
Length=295

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 146/176 (83%), Gaps = 1/176 (1%)
 Frame = -3

Query  751  EAGLNWFELECVSSDK-ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYA  575
            EAGLNWFELEC+SSDK E DGKPKI YVTVFERPGLHEFL+QL  FADLVLFTAGLEGYA
Sbjct  116  EAGLNWFELECLSSDKKESDGKPKINYVTVFERPGLHEFLEQLSQFADLVLFTAGLEGYA  175

Query  574  RPLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLN  395
            RPLVD+ID       RLYRPST ST YR+HVKDL   S ++SR VIVDNNPFSFLLQP N
Sbjct  176  RPLVDRIDTRKVLSNRLYRPSTVSTPYRDHVKDLLTTSKNMSRTVIVDNNPFSFLLQPSN  235

Query  394  GIPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            GIPCI FSAGQP+D QL+DVILPLLK LS++EDVRP L  RF MPEW EK GIP S
Sbjct  236  GIPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDRFRMPEWFEKQGIPPS  291



>ref|XP_003564541.1| PREDICTED: CTD small phosphatase-like protein [Brachypodium distachyon]
Length=312

 Score =   278 bits (711),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+S+DK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  134  EAGLHCFDMECISTDKDVEGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAR  193

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD ID  NRF  RLYRPST +TEYREHVKDLS IS + SRIVIVDNNPFSF+LQPLNG
Sbjct  194  PLVDTIDAHNRFKLRLYRPSTVTTEYREHVKDLSCISKEFSRIVIVDNNPFSFILQPLNG  253

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+PFSAGQ  D+QLM+VI PLLK LS Q DVRPAL +RFHMPEW +KHGIP +
Sbjct  254  IPCVPFSAGQHSDDQLMEVIFPLLKRLSLQRDVRPALYERFHMPEWFQKHGIPQT  308



>ref|XP_006646453.1| PREDICTED: CTD small phosphatase-like protein 2-like, partial 
[Oryza brachyantha]
Length=282

 Score =   277 bits (708),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+S++K+ +G+ K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYAR
Sbjct  104  EAGLHCFDMECISTEKDVEGRQKVNHVTVFERPGLHEFLQKTSDFADLILFTAGLEGYAR  163

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV N F  RLYRPST +TEYREHVKDLS +S D  R+VIVDNNPFSF+LQPLNG
Sbjct  164  PLVDRIDVHNIFKLRLYRPSTVTTEYREHVKDLSCVSKDFCRVVIVDNNPFSFILQPLNG  223

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSAGQ +D+QLM+VI PLLKHLS Q DVRPAL +RFHMPEW +KHGIP +  T 
Sbjct  224  IPCVPFSAGQHNDDQLMEVIFPLLKHLSLQRDVRPALYERFHMPEWFQKHGIPQTDQTV  282



>ref|XP_008370102.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Malus domestica]
Length=297

 Score =   277 bits (709),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 150/175 (86%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFE+EC+SS KE DGKPK+ YVTVFERPGL EFLK++  FADLVLFTAGLE YAR
Sbjct  122  EAGLKWFEIECLSSGKESDGKPKVNYVTVFERPGLREFLKRVCEFADLVLFTAGLEDYAR  181

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVEN F  RLYRPST STE+REHVKDLS +S D SRIVIVDNNPFSFLLQPLNG
Sbjct  182  PLVDRIDVENLFKLRLYRPSTVSTEFREHVKDLSCLSKDFSRIVIVDNNPFSFLLQPLNG  241

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPC+PFSAGQP+D+QL++V+ PLL  LS Q+DVRP L+++F MPEW + HG P S
Sbjct  242  IPCVPFSAGQPYDDQLLEVLHPLLMQLSLQKDVRPMLHEKFQMPEWFQMHGFPVS  296



>ref|XP_006435743.1| hypothetical protein CICLE_v10031856mg [Citrus clementina]
 ref|XP_006486313.1| PREDICTED: CTD small phosphatase-like protein-like [Citrus sinensis]
 gb|ESR48983.1| hypothetical protein CICLE_v10031856mg [Citrus clementina]
Length=375

 Score =   280 bits (715),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  748  AGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARP  569
            AGL WFE+EC+SSDKEC+GKPKI +VTVFERPGL EFLKQL  FADL+LFTAGLEGYARP
Sbjct  200  AGLKWFEMECLSSDKECEGKPKINHVTVFERPGLREFLKQLSEFADLILFTAGLEGYARP  259

Query  568  LVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGI  389
            LVD+ID EN F  RLYRPSTTSTEYREHVKDLS +S DL R VIVDNNPFSFLLQPLNGI
Sbjct  260  LVDRIDGENLFSLRLYRPSTTSTEYREHVKDLSCLSKDLCRTVIVDNNPFSFLLQPLNGI  319

Query  388  PCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGL  221
            PCIPFSAGQPHD QL++V+LPLLKHLS Q+DVRP L +RFHMPEW +K GIP+SGL
Sbjct  320  PCIPFSAGQPHDNQLLNVLLPLLKHLSLQKDVRPELYERFHMPEWFQKQGIPTSGL  375



>gb|KDO68952.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
 gb|KDO68953.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=300

 Score =   277 bits (708),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  748  AGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARP  569
            AGL WFE+EC+SSDKEC+GKPKI +VTVFERPGL EFLKQL  FADL+LFTAGLEGYARP
Sbjct  125  AGLKWFEMECLSSDKECEGKPKINHVTVFERPGLREFLKQLSEFADLILFTAGLEGYARP  184

Query  568  LVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGI  389
            LVD+ID EN F  RLYRPSTTSTEYREHVKDLS +S DL R +IVDNNPFSFLLQPLNGI
Sbjct  185  LVDRIDGENLFSLRLYRPSTTSTEYREHVKDLSCLSKDLCRTLIVDNNPFSFLLQPLNGI  244

Query  388  PCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGL  221
            PCIPFSAGQPHD QL++V+LPLLKHLS Q+DVRP L +RFHMPEW +K GIP+SGL
Sbjct  245  PCIPFSAGQPHDNQLLNVLLPLLKHLSLQKDVRPELYERFHMPEWFQKQGIPTSGL  300



>ref|XP_010044096.1| PREDICTED: CTD small phosphatase-like protein [Eucalyptus grandis]
 gb|KCW86104.1| hypothetical protein EUGRSUZ_B02803 [Eucalyptus grandis]
Length=333

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKECDGKPK+ YVTVFERPGLHEFLK++G FA+L+LFTAGLE YAR
Sbjct  155  EAGLKWFELECVSSDKECDGKPKVNYVTVFERPGLHEFLKRVGEFANLILFTAGLEDYAR  214

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID +N    RLYRPST STEYREHVKDLS +S DL RIVIVDNNPFSFLLQPLNG
Sbjct  215  PLVDRIDKDNLIGERLYRPSTVSTEYREHVKDLSSLSKDLCRIVIVDNNPFSFLLQPLNG  274

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPC+PFSAGQP+D+QL++V+LPLLKHLS Q DVRP L +RFHMPEW + HGIP+SG
Sbjct  275  IPCVPFSAGQPYDDQLLEVLLPLLKHLSLQRDVRPVLYERFHMPEWFQMHGIPASG  330



>gb|AFK34480.1| unknown [Lotus japonicus]
Length=292

 Score =   275 bits (703),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGLNWFE+EC+ SDK+ +G  K  YVTVFERPGL EFLKQL  FADLVLFTAGLEGYAR
Sbjct  117  QAGLNWFEMECLCSDKDAEGITKTSYVTVFERPGLKEFLKQLSEFADLVLFTAGLEGYAR  176

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID +N F  RLYRPST STE+REHVKDL+ IS DL RIVIVDNNPFSFLLQP NG
Sbjct  177  PLVDRIDSDNLFSLRLYRPSTISTEHREHVKDLTCISKDLCRIVIVDNNPFSFLLQPDNG  236

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCI FSAGQP D QL+DVILPLLKHLS ++DVR  L ++FHMPEW +K GIP+S 
Sbjct  237  IPCISFSAGQPCDTQLLDVILPLLKHLSAEKDVRHVLYEQFHMPEWFQKQGIPASS  292



>tpg|DAA56990.1| TPA: hypothetical protein ZEAMMB73_478385 [Zea mays]
Length=171

 Score =   270 bits (691),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -3

Query  727  LECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDV  548
            +EC+SSDK+ +GK K+ +VTVFERPGLHEFL++   FADL+LFTAGLEGYARPLVD+IDV
Sbjct  1    MECISSDKDAEGKQKVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYARPLVDRIDV  60

Query  547  ENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSA  368
             NRF  RLYRPST +TEYREHVKDLS +S D  RIVIVDNNPFSF+LQPLNGIPC+PFSA
Sbjct  61   HNRFRLRLYRPSTVTTEYREHVKDLSCVSKDFGRIVIVDNNPFSFILQPLNGIPCVPFSA  120

Query  367  GQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            GQ  D+QLM VI PLLKHLS Q+DVRP L++RFHMPEW +KHGIP + 
Sbjct  121  GQHSDDQLMMVIFPLLKHLSLQKDVRPVLHERFHMPEWFQKHGIPQTN  168



>emb|CDX93216.1| BnaC04g46800D [Brassica napus]
Length=304

 Score =   275 bits (704),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SS KEC+G+PKI YVTVFERPGLHEFL++L  FA+L++FTAGLE YAR
Sbjct  124  EAGLKWFELECISSTKECNGEPKINYVTVFERPGLHEFLEKLSQFANLIVFTAGLEDYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID ++    RLYRP T ST+YR+HVKDL   S ++ R VIVDNNP+SFLLQPLNG
Sbjct  184  PLVDKIDTKHVLNERLYRPCTVSTQYRDHVKDLLCTSKNMCRTVIVDNNPYSFLLQPLNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSA QPHD QL+D+ILPLLK LS++EDVR AL  RFHMPEW EK GIP S  T+
Sbjct  244  IPCVPFSAEQPHDTQLLDIILPLLKKLSEEEDVRGALYDRFHMPEWFEKQGIPRSCWTS  302



>ref|XP_003600913.1| CTD small phosphatase-like protein [Medicago truncatula]
 gb|AES71164.1| NLI interacting factor-like phosphatase [Medicago truncatula]
Length=276

 Score =   274 bits (700),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGLNWFELECV  +KE DG+P I YVTVFERPGL EFLKQL  FADLVLFTAG+EGYAR
Sbjct  101  QAGLNWFELECVFDNKEADGEPIINYVTVFERPGLKEFLKQLSEFADLVLFTAGVEGYAR  160

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID EN F  RLYRPST  TE+RE+VKDL+ IS DL  IVIVDNNP+SFLLQP NG
Sbjct  161  PLVDRIDTENWFSLRLYRPSTIRTEHREYVKDLTCISKDLCNIVIVDNNPYSFLLQPDNG  220

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            IPC+PFSAGQPHD QL+DVILP+LK LS Q+DVR  L +++HMPEW ++HGIP+
Sbjct  221  IPCVPFSAGQPHDTQLLDVILPILKDLSDQKDVRHVLYEKYHMPEWFQQHGIPA  274



>emb|CDY27252.1| BnaA09g35500D [Brassica napus]
Length=295

 Score =   275 bits (702),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = -3

Query  751  EAGLNWFELECVSSDK-ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYA  575
            EAGLNWFELEC+SSDK E DGK KI YVTVFERPGLHEFL++L  FADLVLFTAGLEGYA
Sbjct  116  EAGLNWFELECLSSDKKESDGKSKINYVTVFERPGLHEFLEKLSQFADLVLFTAGLEGYA  175

Query  574  RPLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLN  395
            RPLVD+ID       RLYRPST ST YR+HVKDL   S ++SR VIVDNNPFSFLLQP N
Sbjct  176  RPLVDRIDTRKVLSNRLYRPSTVSTPYRDHVKDLLTTSKNMSRTVIVDNNPFSFLLQPSN  235

Query  394  GIPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            GIPCI FSAGQP+D QL+DVILPLLK LS++EDVRP L  RF MPEW EK GIP S
Sbjct  236  GIPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDRFRMPEWFEKQGIPPS  291



>ref|XP_009116288.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Brassica 
rapa]
Length=292

 Score =   274 bits (701),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = -3

Query  751  EAGLNWFELECVSSDK-ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYA  575
            EAGLNWFELEC+SSDK E DGK KI YVTVFERPGLHEFL++L  FADLVLFTAGLEGYA
Sbjct  113  EAGLNWFELECLSSDKKESDGKSKINYVTVFERPGLHEFLEKLSQFADLVLFTAGLEGYA  172

Query  574  RPLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLN  395
            RPLVD+ID       RLYRPST ST YR+HVKDL   S ++SR VIVDNNPFSFLLQP N
Sbjct  173  RPLVDRIDTRKVLSNRLYRPSTVSTPYRDHVKDLLTTSKNMSRTVIVDNNPFSFLLQPSN  232

Query  394  GIPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            GIPCI FSAGQP+D QL+DVILPLLK LS++EDVRP L  RF MPEW EK GIP S
Sbjct  233  GIPCIAFSAGQPNDTQLLDVILPLLKQLSEEEDVRPTLYDRFRMPEWFEKQGIPPS  288



>ref|XP_009141872.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Brassica rapa]
Length=304

 Score =   275 bits (702),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SS KEC+G+PKI YVTVFERPGLHEFL++L  FA L++FTAGLE YAR
Sbjct  124  EAGLKWFELECISSTKECNGEPKINYVTVFERPGLHEFLEKLSQFAHLIVFTAGLEDYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID ++    RLYRP T ST+YR+HVKDL   S ++ R VIVDNNP+SFLLQPLNG
Sbjct  184  PLVDKIDTKHVLNERLYRPCTVSTQYRDHVKDLLCTSKNMCRTVIVDNNPYSFLLQPLNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSA QPHD QL+D+ILPLLK LS++EDVR AL  RFHMPEW EK GIP S  T+
Sbjct  244  IPCVPFSAEQPHDTQLLDIILPLLKQLSEEEDVRGALYDRFHMPEWFEKQGIPRSCWTS  302



>ref|XP_010920860.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Elaeis guineensis]
Length=303

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELEC+S +K+ +GK K+ +VTVFERPGL EFL+Q+  FA+LVLFTAGLEGYA 
Sbjct  125  EAGLECFELECISVEKDAEGKQKVNHVTVFERPGLREFLQQISKFANLVLFTAGLEGYAS  184

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV+N+F  RLYR ST STEYREHVKDLS +S DL RIVIVDNNPFSFLLQPLNG
Sbjct  185  PLVDRIDVDNKFSLRLYRSSTVSTEYREHVKDLSCMSKDLCRIVIVDNNPFSFLLQPLNG  244

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPCIPFSAGQP DEQLM V+LPLLKHLS Q DVRP L ++FHMPEW  +HGIP
Sbjct  245  IPCIPFSAGQPCDEQLMGVLLPLLKHLSIQRDVRPILYEKFHMPEWFRQHGIP  297



>ref|XP_004500494.1| PREDICTED: probable C-terminal domain small phosphatase-like 
[Cicer arietinum]
Length=275

 Score =   271 bits (694),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGLNWFELECV SDK  +GKP I YVTVFERPGL EFL+QL  FADLVLFTAGLEGYAR
Sbjct  100  QAGLNWFELECVCSDKLVEGKPIINYVTVFERPGLKEFLRQLSEFADLVLFTAGLEGYAR  159

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST ST++REHVKDL  IS DL RIV+VDNNPFSFLLQP NG
Sbjct  160  PLVDRIDTENRFSLRLYRPSTVSTKHREHVKDLRCISKDLCRIVLVDNNPFSFLLQPDNG  219

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPC  FSA +PHD QL+DVILPLLK+LS Q+DVR  LN+++HMPEW ++ G P
Sbjct  220  IPCTSFSAWKPHDTQLLDVILPLLKNLSDQKDVRHVLNEKYHMPEWFKQQGTP  272



>ref|XP_002265560.1| PREDICTED: CTD small phosphatase-like protein [Vitis vinifera]
 emb|CBI22795.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKEC+GKP I YVTVFERPGL EFL+Q+  FA+LVLFTA LEGYAR
Sbjct  144  EAGLKWFELECVSSDKECEGKPNISYVTVFERPGLQEFLEQISEFAELVLFTAALEGYAR  203

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID  NRF +RLYRPST ST+YREHVKDLS +S DL RIVIVDNNPFSFLLQPLNG
Sbjct  204  PLVDKIDAGNRFSKRLYRPSTVSTKYREHVKDLSCLSKDLRRIVIVDNNPFSFLLQPLNG  263

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PFSA QP+D+QL++V+LPLLKHLS Q+DVRP L +RFHMP+W + HGIP+S LT
Sbjct  264  IPCVPFSAEQPNDKQLLEVLLPLLKHLSLQKDVRPVLYERFHMPDWFQMHGIPASNLT  321



>gb|KDO68954.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=285

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 143/176 (81%), Gaps = 15/176 (9%)
 Frame = -3

Query  748  AGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARP  569
            AGL WFE+EC+SSDKEC+GKPKI +VTVFERPGL EFLKQL  FADL+LFTAGLEGYARP
Sbjct  125  AGLKWFEMECLSSDKECEGKPKINHVTVFERPGLREFLKQLSEFADLILFTAGLEGYARP  184

Query  568  LVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGI  389
            LVD+ID EN F  RLYRPSTTSTEYREHVKDLS +S DL R +IVDNNPFSFLLQPLNGI
Sbjct  185  LVDRIDGENLFSLRLYRPSTTSTEYREHVKDLSCLSKDLCRTLIVDNNPFSFLLQPLNGI  244

Query  388  PCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGL  221
            PCIPFSAGQPHD                Q+DVRP L +RFHMPEW +K GIP+SGL
Sbjct  245  PCIPFSAGQPHD---------------NQKDVRPELYERFHMPEWFQKQGIPTSGL  285



>ref|XP_007218742.1| hypothetical protein PRUPE_ppa009189mg [Prunus persica]
 gb|EMJ19941.1| hypothetical protein PRUPE_ppa009189mg [Prunus persica]
Length=303

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GL WFELECVSSDKECDGKPK+ YVTVFERPGL +FL+Q+  FA+LVLFTAGLEGYAR
Sbjct  126  EGGLKWFELECVSSDKECDGKPKVNYVTVFERPGLQDFLRQVSQFAELVLFTAGLEGYAR  185

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV+N F  RLYRPSTTSTEYREHVKDLSG++ D+ RIVIVDNNPFSFLLQPLNG
Sbjct  186  PLVDRIDVDNLFSCRLYRPSTTSTEYREHVKDLSGLAKDMRRIVIVDNNPFSFLLQPLNG  245

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
            IPCI FSAGQ HD QL+DV+LPLLKHLS Q+DVRP L +RFHM EW +K GIPS+ 
Sbjct  246  IPCIAFSAGQTHDTQLLDVLLPLLKHLSLQKDVRPVLYERFHMLEWFQKQGIPSTS  301



>ref|XP_002528087.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34266.1| conserved hypothetical protein [Ricinus communis]
Length=279

 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFELEC++SDKEC+GK KI YVTVFERPGL EFLKQ+  FADLVLFTAGLEGYAR
Sbjct  101  QAGLKWFELECITSDKECEGKTKINYVTVFERPGLREFLKQISEFADLVLFTAGLEGYAR  160

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P+VD+ID ENRF  RLYRPST STEYREH+KDLS +S DL RIVIVD+NPFSFLLQPLNG
Sbjct  161  PIVDRIDTENRFSLRLYRPSTISTEYREHMKDLSCLSKDLCRIVIVDDNPFSFLLQPLNG  220

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PFSAGQP+D QL+DV+LPLLKHLS Q+DVRP L + FHMPEW + +GIP+S L 
Sbjct  221  IPCMPFSAGQPYDNQLLDVLLPLLKHLSLQKDVRPVLLEMFHMPEWFQMNGIPASSLV  278



>gb|KJB74327.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=308

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFELECVSSDKE +GKPKI YVTVFERPGL EFL QL  FA+LVLFTAGLEGYAR
Sbjct  130  DAGLKWFELECVSSDKEFEGKPKISYVTVFERPGLQEFLNQLSEFAELVLFTAGLEGYAR  189

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST  TE+REHVKDLS +S +L R VIVDNNPFSFLLQPLNG
Sbjct  190  PLVDRIDAENRFSHRLYRPSTICTEFREHVKDLSCLSKNLCRTVIVDNNPFSFLLQPLNG  249

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFSAGQPHD QL+DV+LPLLKHLS Q+DVRP L  RFHMPEW +K GIPSS  + 
Sbjct  250  IPCIPFSAGQPHDTQLLDVLLPLLKHLSLQKDVRPFLYDRFHMPEWFQKQGIPSSSWSA  308



>emb|CDY07060.1| BnaA04g22550D [Brassica napus]
Length=304

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SS KEC+G+PKI YVTVFERPGLH+FL++L  FA L++FTAGLE YAR
Sbjct  124  EAGLKWFELECISSTKECNGEPKINYVTVFERPGLHDFLEKLSQFAHLIVFTAGLEDYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVDKID ++    RLYR  T ST+YR+HVKDL   S ++ R VIVDNNP+SFLLQPLNG
Sbjct  184  PLVDKIDTKHVLNERLYRHCTVSTQYRDHVKDLLCTSKNMCRTVIVDNNPYSFLLQPLNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSA QPHD QL+D+ILPLLK LS++EDVR AL  RFHMPEW EK GIP S  T+
Sbjct  244  IPCVPFSAEQPHDTQLLDIILPLLKQLSEEEDVRGALYDRFHMPEWFEKQGIPRSCWTS  302



>ref|XP_008793248.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Phoenix dactylifera]
Length=303

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELEC+S +K+ +GK K+ +VTVFERPGL +FL+Q+  FA+LVLFTAGLEGYA 
Sbjct  125  EAGLKCFELECISVEKDAEGKQKVNHVTVFERPGLRDFLQQISEFANLVLFTAGLEGYAS  184

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDV+N+F   LYR ST STEYREHVKDLS +S DL RIVIVDNNPFSFLLQPLNG
Sbjct  185  PLVDRIDVDNKFSLHLYRSSTVSTEYREHVKDLSCVSKDLCRIVIVDNNPFSFLLQPLNG  244

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPCIPFSAGQP D+QLM V+LPLLKHLS Q+DVRP L ++FHMPEW ++HGIP
Sbjct  245  IPCIPFSAGQPCDDQLMGVLLPLLKHLSIQKDVRPILYEKFHMPEWFKQHGIP  297



>ref|XP_002309143.2| hypothetical protein POPTR_0006s10170g [Populus trichocarpa]
 gb|EEE92666.2| hypothetical protein POPTR_0006s10170g [Populus trichocarpa]
Length=325

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+  FELEC SS+K+ +GKP+I YVTVFERPGL EFLKQ+G FADL+LFTAGLEGYAR
Sbjct  147  EAGVKCFELECFSSEKDVEGKPRINYVTVFERPGLKEFLKQIGEFADLILFTAGLEGYAR  206

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PL D+IDVEN+F +RLYRPST STEYREHVKDLS +S DLSR+VIVDNNPFSFLLQPLNG
Sbjct  207  PLFDRIDVENQFSQRLYRPSTVSTEYREHVKDLSCLSKDLSRVVIVDNNPFSFLLQPLNG  266

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSA  P+DEQL+DV+LPLLK+LS Q+DVRP L +RFHMPEW + HGIP+S LT 
Sbjct  267  IPCVPFSARLPYDEQLLDVLLPLLKNLSLQKDVRPVLYERFHMPEWFQMHGIPASALTV  325



>ref|XP_002439933.1| hypothetical protein SORBIDRAFT_09g022940 [Sorghum bicolor]
 gb|EES18363.1| hypothetical protein SORBIDRAFT_09g022940 [Sorghum bicolor]
Length=295

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++ECVSS+K+ DG+ +I +VTVFERPGLHEFL++   FADLVLFTAGLEGYA+
Sbjct  117  EAGLHCFDMECVSSEKDPDGRQRINHVTVFERPGLHEFLQRTSEFADLVLFTAGLEGYAK  176

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  NRF  RLYRPST +TEYREHVKDLS +S D  RIV+VDNNP+SFLLQPLNG
Sbjct  177  PLVDRIDAHNRFTHRLYRPSTVTTEYREHVKDLSCLSKDFQRIVLVDNNPYSFLLQPLNG  236

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            IPCI FSAGQP D+QLM  I PLL+HL+ Q+DVRPAL + FHMPEW ++ GIP +
Sbjct  237  IPCITFSAGQPVDDQLMGTIFPLLEHLALQKDVRPALYETFHMPEWFQRQGIPQT  291



>ref|XP_006655392.1| PREDICTED: CTD small phosphatase-like protein 2-like, partial 
[Oryza brachyantha]
Length=279

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+S++K+ +G+ ++ +VTVFERPGLHEFL++   FADL+LFTAGLEGYA+
Sbjct  101  EAGLHCFDMECISAEKDAEGRQRVNHVTVFERPGLHEFLQRTSEFADLILFTAGLEGYAK  160

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  NR   RLYRPST +TEYREHVKDLS +S D  RIVIVDNNP+SFLLQPLNG
Sbjct  161  PLVDRIDAHNRLRNRLYRPSTVTTEYREHVKDLSCLSKDFRRIVIVDNNPYSFLLQPLNG  220

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPC+ FSAGQP D+QLM VI PLLKHLS Q DVRPAL + FHMPEW ++HGIP
Sbjct  221  IPCLTFSAGQPVDDQLMGVIFPLLKHLSLQNDVRPALYETFHMPEWFQRHGIP  273



>ref|XP_006294652.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
 gb|EOA27550.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
Length=309

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPK  YVTVFERPGLHEFL+QL  FA+L+LFTA LE YAR
Sbjct  123  EAGLKWFELECVSSTKECNGKPKTSYVTVFERPGLHEFLEQLSQFANLILFTAALEDYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ++    RLYRPST +T+YR+HVKDL  +S ++ R VIVDNNPF FLLQPLNG
Sbjct  183  PLVDRIDTQHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNMYRTVIVDNNPFCFLLQPLNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  F+A QP+D QL+DV+LPLLK LS++EDV+ AL  RFHMPEW EK GIP S  T+
Sbjct  243  IPCDSFTAEQPNDTQLLDVVLPLLKQLSEEEDVKLALYDRFHMPEWFEKQGIPLSYWTS  301



>ref|XP_009406928.1| PREDICTED: CTD nuclear envelope phosphatase 1-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  F+LECVSS+++ DG  K+ +VTVFERPGL EFLKQ   FADLVLFTAGLEGYAR
Sbjct  129  EAGLECFDLECVSSEQDADGSQKVNHVTVFERPGLREFLKQSSEFADLVLFTAGLEGYAR  188

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P++D+ID++N+   RLYRP+T ST+YREHVKDLS +S  LSRIVIVDNNPFSFLLQPLNG
Sbjct  189  PVIDRIDIDNKLTHRLYRPATVSTKYREHVKDLSCVSQHLSRIVIVDNNPFSFLLQPLNG  248

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PF A QP D+QLM VILPLLKHLS  +DVRP LN++FHM EW E+ GIP+   T
Sbjct  249  IPCMPFFAAQPCDDQLMGVILPLLKHLSLHKDVRPILNEKFHMREWFEQQGIPTKCWT  306



>dbj|BAK00193.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00947.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score =   267 bits (683),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++EC+SSDK+  G+ ++ +VTVFERPGLHEFL++   FADL+LFTAGLEGYA+
Sbjct  122  EAGLHCFDMECISSDKDAKGRQRVNHVTVFERPGLHEFLQKTSEFADLILFTAGLEGYAK  181

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PL+D+ID  NRF RRLYRPST +TEYR+HVKDLS +S D  R+V+VDNNP+SFLLQPLNG
Sbjct  182  PLIDRIDAHNRFYRRLYRPSTVTTEYRDHVKDLSCLSKDFRRVVLVDNNPYSFLLQPLNG  241

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPC  FSAGQP D+QLM VI PLLKHLS Q DVRPAL   FHMPEW + +GIP
Sbjct  242  IPCHTFSAGQPMDDQLMRVIFPLLKHLSLQNDVRPALRDAFHMPEWFQSNGIP  294



>ref|XP_011019110.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X1 [Populus euphratica]
Length=324

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+  FELEC SS+K+ +GKP+I YVTVFERPGL EFLKQ+G FADL+LFTAGLEGYAR
Sbjct  146  EAGVKCFELECFSSEKDVEGKPRINYVTVFERPGLKEFLKQIGEFADLILFTAGLEGYAR  205

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PL D+IDVENRF +RLYRPST STEYREHVKDLS +S DLSR+VIVDNNPFSFLLQPLNG
Sbjct  206  PLFDRIDVENRFSQRLYRPSTVSTEYREHVKDLSCLSKDLSRVVIVDNNPFSFLLQPLNG  265

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSA  P+DEQL+DV+LPLLK+LS Q+DVRP L +RF MPEW + HGIP+S LT 
Sbjct  266  IPCVPFSARLPYDEQLLDVLLPLLKNLSLQKDVRPVLYERFRMPEWFQMHGIPASALTV  324



>ref|XP_010508910.1| PREDICTED: probable C-terminal domain small phosphatase isoform 
X2 [Camelina sativa]
Length=310

 Score =   268 bits (684),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPKI +VTVFERPGLHEFL+ L  FA L+LFTA LE YAR
Sbjct  123  EAGLKWFELECVSSTKECNGKPKISHVTVFERPGLHEFLENLSQFAHLILFTAALEDYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ++    RLYRPSTTST YR+HVKDL  +S ++ R VIVDNNP+ FLLQP+NG
Sbjct  183  PLVDRIDTKHVLNHRLYRPSTTSTHYRDHVKDLLCVSKNMYRTVIVDNNPYCFLLQPVNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR AL  RFHMPEW EK GIP S  T+
Sbjct  243  IPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDRFHMPEWFEKQGIPQSCWTS  301



>ref|XP_009416286.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog [Musa acuminata 
subsp. malaccensis]
Length=310

 Score =   267 bits (683),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+  F+LECVSS+ + DG+ K  +VTVFERPGL EFLKQ   FADLVLFTAGLEGYA 
Sbjct  132  EAGVKCFDLECVSSENDADGRQKANHVTVFERPGLREFLKQSSEFADLVLFTAGLEGYAS  191

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P++D+IDV+N+ I RLYRP+T STEYREHVKDLS +S DLSR VIVDNNP+SFLLQPLNG
Sbjct  192  PVIDRIDVDNKLIHRLYRPATVSTEYREHVKDLSCVSKDLSRTVIVDNNPYSFLLQPLNG  251

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            IPC+PF A QP DEQLM VILPLLKHLS Q+DVR  L ++FHMPEW E+ GIP+
Sbjct  252  IPCMPFFAAQPCDEQLMGVILPLLKHLSLQKDVRSVLYEKFHMPEWFEQQGIPT  305



>ref|XP_008805436.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Phoenix dactylifera]
Length=291

 Score =   266 bits (680),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 146/178 (82%), Gaps = 10/178 (6%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELEC+S DKE +GK K+ +VTVFERPGL EFL+Q+  FADLVLFTAGLEGYAR
Sbjct  123  EAGLKCFELECISIDKEVEGKQKVNHVTVFERPGLQEFLQQISDFADLVLFTAGLEGYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID+ENRF  RLYRP+T STEYREHVKDL+ +S DL R V+VDNNPFSFLLQPLNG
Sbjct  183  PLVDRIDIENRFSLRLYRPATVSTEYREHVKDLTCLSKDLCRTVLVDNNPFSFLLQPLNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PFSAGQP+DEQ          HLS Q+DVRP L++RFHMPEW +KHGIP S  T
Sbjct  243  IPCVPFSAGQPYDEQ----------HLSLQKDVRPVLHERFHMPEWFQKHGIPPSNQT  290



>ref|XP_010505730.1| PREDICTED: CTD small phosphatase-like protein isoform X4 [Camelina 
sativa]
Length=309

 Score =   267 bits (682),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPKI +VTVFERPGLHEFL+QL  FA L+LFTA LE YAR
Sbjct  123  EAGLKWFELECVSSTKECNGKPKISHVTVFERPGLHEFLEQLSQFAHLILFTAALEDYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  +    RLYRPST +T+YR+HVKDL  +S ++ R VIVDNNP+ FLLQPLNG
Sbjct  183  PLVDRIDTHHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNMCRTVIVDNNPYCFLLQPLNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR  L  RFHMPEW EK GIP S  T+
Sbjct  243  IPCDSFSAEQPNDTQLLDVVLPLLKQLSEEEDVRVTLYDRFHMPEWFEKQGIPRSCWTS  301



>ref|XP_009392189.1| PREDICTED: CTD nuclear envelope phosphatase 1-like [Musa acuminata 
subsp. malaccensis]
Length=308

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  F+LEC+SS+K+ DG+ K+ +VTVFERPGL EFLK    FADLVLFTAGLEGYA 
Sbjct  130  EAGLKCFDLECISSEKDADGRQKVNHVTVFERPGLQEFLKHSSEFADLVLFTAGLEGYAS  189

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P++D+IDV+N+   RLYRP+T  TE+REHVKDLS +S DLSRIVIVDNNPFSFLLQPLNG
Sbjct  190  PVIDRIDVDNKLTHRLYRPATVITEHREHVKDLSCVSKDLSRIVIVDNNPFSFLLQPLNG  249

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSA QP D+QLM VILPLLKHLS Q+DVR  L  +FHMPEW ++ GIP+   T+
Sbjct  250  IPCVPFSASQPCDDQLMGVILPLLKHLSLQKDVRTVLYDKFHMPEWFKQQGIPTISSTS  308



>ref|XP_010505729.1| PREDICTED: CTD small phosphatase-like protein isoform X3 [Camelina 
sativa]
Length=319

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPKI +VTVFERPGLHEFL+QL  FA L+LFTA LE YAR
Sbjct  123  EAGLKWFELECVSSTKECNGKPKISHVTVFERPGLHEFLEQLSQFAHLILFTAALEDYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  +    RLYRPST +T+YR+HVKDL  +S ++ R VIVDNNP+ FLLQPLNG
Sbjct  183  PLVDRIDTHHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNMCRTVIVDNNPYCFLLQPLNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR  L  RFHMPEW EK GIP S  T+
Sbjct  243  IPCDSFSAEQPNDTQLLDVVLPLLKQLSEEEDVRVTLYDRFHMPEWFEKQGIPRSCWTS  301



>ref|XP_006411263.1| hypothetical protein EUTSA_v10016941mg [Eutrema salsugineum]
 gb|ESQ52716.1| hypothetical protein EUTSA_v10016941mg [Eutrema salsugineum]
Length=320

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELEC+SS KEC+G+PKI YVTVFERPGLHEFL+QL  FA+L+LFTAGLE YAR
Sbjct  128  EAGLKSFELECISSTKECNGEPKINYVTVFERPGLHEFLEQLSQFANLILFTAGLEDYAR  187

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD ID ++    RLYRP T ST+YR+HVKDL   S ++ R VIVDNNP+SFLLQPLNG
Sbjct  188  PLVDIIDTKHVLDDRLYRPCTVSTQYRDHVKDLLCASKNMCRTVIVDNNPYSFLLQPLNG  247

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PF+A QP+D QL+D+ILPLLK LS++EDVR AL  RFHMPEW EK GIP S  T
Sbjct  248  IPCVPFTAEQPNDTQLLDIILPLLKQLSEEEDVRSALYDRFHMPEWFEKQGIPRSCWT  305



>ref|XP_010517420.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X4 [Camelina sativa]
Length=311

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPK  +VTVFERPGLHEFL+QL  FA L+LFTA LE YAR
Sbjct  124  EAGLKWFELECVSSTKECNGKPKTSHVTVFERPGLHEFLEQLSQFAHLILFTAALEDYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P+VD+ID +     RLYRPST ST+YR+HVKDL  +S ++ R VIVDNNP+ FLLQPLNG
Sbjct  184  PIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNMCRTVIVDNNPYCFLLQPLNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR AL  RFHMPEW EK GIP S  T+
Sbjct  244  IPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDRFHMPEWFEKQGIPRSCWTS  302



>ref|XP_010517419.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X3 [Camelina sativa]
Length=325

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPK  +VTVFERPGLHEFL+QL  FA L+LFTA LE YAR
Sbjct  124  EAGLKWFELECVSSTKECNGKPKTSHVTVFERPGLHEFLEQLSQFAHLILFTAALEDYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P+VD+ID +     RLYRPST ST+YR+HVKDL  +S ++ R VIVDNNP+ FLLQPLNG
Sbjct  184  PIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNMCRTVIVDNNPYCFLLQPLNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR AL  RFHMPEW EK GIP S  T+
Sbjct  244  IPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDRFHMPEWFEKQGIPRSCWTS  302



>ref|XP_010505722.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505723.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505724.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010505725.1| PREDICTED: CTD small phosphatase-like protein isoform X1 [Camelina 
sativa]
Length=325

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPKI +VTVFERPGLHEFL+QL  FA L+LFTA LE YAR
Sbjct  123  EAGLKWFELECVSSTKECNGKPKISHVTVFERPGLHEFLEQLSQFAHLILFTAALEDYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  +    RLYRPST +T+YR+HVKDL  +S ++ R VIVDNNP+ FLLQPLNG
Sbjct  183  PLVDRIDTHHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNMCRTVIVDNNPYCFLLQPLNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR  L  RFHMPEW EK GIP S  T+
Sbjct  243  IPCDSFSAEQPNDTQLLDVVLPLLKQLSEEEDVRVTLYDRFHMPEWFEKQGIPRSCWTS  301



>ref|XP_010505726.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Camelina 
sativa]
 ref|XP_010505728.1| PREDICTED: CTD small phosphatase-like protein isoform X2 [Camelina 
sativa]
Length=324

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPKI +VTVFERPGLHEFL+QL  FA L+LFTA LE YAR
Sbjct  123  EAGLKWFELECVSSTKECNGKPKISHVTVFERPGLHEFLEQLSQFAHLILFTAALEDYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  +    RLYRPST +T+YR+HVKDL  +S ++ R VIVDNNP+ FLLQPLNG
Sbjct  183  PLVDRIDTHHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNMCRTVIVDNNPYCFLLQPLNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR  L  RFHMPEW EK GIP S  T+
Sbjct  243  IPCDSFSAEQPNDTQLLDVVLPLLKQLSEEEDVRVTLYDRFHMPEWFEKQGIPRSCWTS  301



>ref|XP_010101420.1| CTD small phosphatase-like protein [Morus notabilis]
 gb|EXB88392.1| CTD small phosphatase-like protein [Morus notabilis]
Length=307

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKE +G+PKI +VTVFERPGLHEFLKQL  FADLVLFTAGLEGYAR
Sbjct  126  EAGLKWFELECVSSDKEFEGRPKINHVTVFERPGLHEFLKQLSEFADLVLFTAGLEGYAR  185

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  N F  RLYRPST STE+REHVKDLS IS D+ R VIVDNNPFSFLLQP+NG
Sbjct  186  PLVDRIDEGNLFSLRLYRPSTISTEFREHVKDLSCISKDMCRSVIVDNNPFSFLLQPVNG  245

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPCIPFSAGQPHD QL+DV+LPLLK LS Q+DVRP L++RFHMPEW +K GIP    T
Sbjct  246  IPCIPFSAGQPHDTQLLDVLLPLLKDLSLQKDVRPMLHERFHMPEWFQKQGIPPQCWT  303



>ref|XP_008442416.1| PREDICTED: CTD small phosphatase-like protein 2 [Cucumis melo]
 gb|ADN33794.1| hypothetical protein [Cucumis melo subsp. melo]
Length=301

 Score =   265 bits (676),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGLNWFELECVSSDKE +GKPKI YVTVFERPGLHEFL Q   FA+L+LFTAGLEGYA+
Sbjct  129  EAGLNWFELECVSSDKEVEGKPKISYVTVFERPGLHEFLSQAAEFAELILFTAGLEGYAK  188

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID E RF  RLYRPST STEYREHVKDLS I  DLSR+VI+DNNPFSFLLQP+NG
Sbjct  189  PLVDRIDTEGRFSHRLYRPSTVSTEYREHVKDLSCIQRDLSRVVIIDNNPFSFLLQPMNG  248

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPCIPFS  QP D QL++V+LPLLKHL+ ++DVRP L +RFHMPEW + HGIP
Sbjct  249  IPCIPFSPAQPADNQLLEVLLPLLKHLALEKDVRPILYERFHMPEWFQIHGIP  301



>ref|XP_010517418.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X2 [Camelina sativa]
Length=333

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPK  +VTVFERPGLHEFL+QL  FA L+LFTA LE YAR
Sbjct  124  EAGLKWFELECVSSTKECNGKPKTSHVTVFERPGLHEFLEQLSQFAHLILFTAALEDYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P+VD+ID +     RLYRPST ST+YR+HVKDL  +S ++ R VIVDNNP+ FLLQPLNG
Sbjct  184  PIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNMCRTVIVDNNPYCFLLQPLNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR AL  RFHMPEW EK GIP S  T+
Sbjct  244  IPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDRFHMPEWFEKQGIPRSCWTS  302



>ref|XP_010508909.1| PREDICTED: CTD small phosphatase-like protein 2-B isoform X1 
[Camelina sativa]
Length=385

 Score =   267 bits (683),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 145/179 (81%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPKI +VTVFERPGLHEFL+ L  FA L+LFTA LE YAR
Sbjct  123  EAGLKWFELECVSSTKECNGKPKISHVTVFERPGLHEFLENLSQFAHLILFTAALEDYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ++    RLYRPSTTST YR+HVKDL  +S ++ R VIVDNNP+ FLLQP+NG
Sbjct  183  PLVDRIDTKHVLNHRLYRPSTTSTHYRDHVKDLLCVSKNMYRTVIVDNNPYCFLLQPVNG  242

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR AL  RFHMPEW EK GIP S  T+
Sbjct  243  IPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDRFHMPEWFEKQGIPQSCWTS  301



>ref|XP_010517411.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517412.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517413.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517414.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517415.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010517417.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X1 [Camelina sativa]
Length=341

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPK  +VTVFERPGLHEFL+QL  FA L+LFTA LE YAR
Sbjct  124  EAGLKWFELECVSSTKECNGKPKTSHVTVFERPGLHEFLEQLSQFAHLILFTAALEDYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P+VD+ID +     RLYRPST ST+YR+HVKDL  +S ++ R VIVDNNP+ FLLQPLNG
Sbjct  184  PIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNMCRTVIVDNNPYCFLLQPLNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC  FSA QP+D QL+DV+LPLLK LS++EDVR AL  RFHMPEW EK GIP S  T+
Sbjct  244  IPCESFSAEQPNDTQLLDVVLPLLKQLSEEEDVRLALYDRFHMPEWFEKQGIPRSCWTS  302



>ref|XP_004961795.1| PREDICTED: CTD small phosphatase-like protein 2-like [Setaria 
italica]
Length=300

 Score =   264 bits (675),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  F++EC S++K+ +G+ ++  VTVFERPGLHEFL++   FADLVLFTAGLEGYA+
Sbjct  122  EAGLRCFDMECTSAEKDAEGRQRVNRVTVFERPGLHEFLQRTSEFADLVLFTAGLEGYAK  181

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID  NRFI RLYRPST +TEYR+HVKDLS +S D  RIV+VDNNP+SFLLQPLNG
Sbjct  182  PLVDRIDAHNRFIHRLYRPSTVTTEYRDHVKDLSCLSKDFQRIVLVDNNPYSFLLQPLNG  241

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPCI FSAGQP D+QLM  I PLLKHLS Q+DVRPAL + FHMPEW +  GIP
Sbjct  242  IPCITFSAGQPIDDQLMGTIFPLLKHLSLQKDVRPALYETFHMPEWFQGQGIP  294



>ref|XP_004137719.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 ref|XP_004168574.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis 
sativus]
 gb|KGN58757.1| hypothetical protein Csa_3G731190 [Cucumis sativus]
Length=301

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGLNWFELECVSSDKE +GKPKI YVTVFERPGLHEFL Q   FADL+LFTAGLEGYA+
Sbjct  129  EAGLNWFELECVSSDKEIEGKPKISYVTVFERPGLHEFLSQAAEFADLILFTAGLEGYAK  188

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID E RF  RLYRPST STEYREHVKDLS I  DLSR+VI+DNNPFSFLLQP NG
Sbjct  189  PLVDRIDTEGRFSHRLYRPSTVSTEYREHVKDLSCIQRDLSRVVIIDNNPFSFLLQPTNG  248

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            IPC+PFS  QP D QL++V+LPLLKHL+ ++DVRP L +RFHMPEW + HGIP
Sbjct  249  IPCLPFSPAQPADNQLLEVLLPLLKHLALEKDVRPILYERFHMPEWFQIHGIP  301



>ref|XP_011019111.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Populus euphratica]
Length=323

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 156/179 (87%), Gaps = 1/179 (1%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+  FELEC SS+ + +GKP+I YVTVFERPGL EFLKQ+G FADL+LFTAGLEGYAR
Sbjct  146  EAGVKCFELECFSSE-DVEGKPRINYVTVFERPGLKEFLKQIGEFADLILFTAGLEGYAR  204

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PL D+IDVENRF +RLYRPST STEYREHVKDLS +S DLSR+VIVDNNPFSFLLQPLNG
Sbjct  205  PLFDRIDVENRFSQRLYRPSTVSTEYREHVKDLSCLSKDLSRVVIVDNNPFSFLLQPLNG  264

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPC+PFSA  P+DEQL+DV+LPLLK+LS Q+DVRP L +RF MPEW + HGIP+S LT 
Sbjct  265  IPCVPFSARLPYDEQLLDVLLPLLKNLSLQKDVRPVLYERFRMPEWFQMHGIPASALTV  323



>gb|EAY98360.1| hypothetical protein OsI_20271 [Oryza sativa Indica Group]
Length=326

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 146/182 (80%), Gaps = 9/182 (5%)
 Frame = -3

Query  751  EAGLNWFELECVSSDK---------ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLF  599
            EAGL+ FE+EC+S++K         + +G  ++  VTVFERPGLHEFL++   FADL+LF
Sbjct  139  EAGLHCFEMECISAEKASCIFLDIKDAEGSQRVNRVTVFERPGLHEFLQRTSEFADLILF  198

Query  598  TAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPF  419
            TAGLEGYA+PLVD+ID  NRF  RLYRPST +TEYREHVKDLS +S D  RIV+VDNNP+
Sbjct  199  TAGLEGYAKPLVDRIDAHNRFCHRLYRPSTVTTEYREHVKDLSCLSKDFHRIVLVDNNPY  258

Query  418  SFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHG  239
            SFLLQPLNGIPC+ FSAGQP D+QLM VI PLLKHLS Q DVRPAL + FHMPEW ++HG
Sbjct  259  SFLLQPLNGIPCLTFSAGQPVDDQLMGVIFPLLKHLSLQNDVRPALYETFHMPEWFQRHG  318

Query  238  IP  233
            IP
Sbjct  319  IP  320



>gb|EEE64021.1| hypothetical protein OsJ_18850 [Oryza sativa Japonica Group]
Length=326

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 146/182 (80%), Gaps = 9/182 (5%)
 Frame = -3

Query  751  EAGLNWFELECVSSDK---------ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLF  599
            EAGL+ F++EC+S++K         + +G  ++  VTVFERPGLHEFL++   FADL+LF
Sbjct  139  EAGLHCFDMECISAEKAICIFLDIKDAEGSQRVNRVTVFERPGLHEFLQRTSEFADLILF  198

Query  598  TAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPF  419
            TAGLEGYA+PLVD+ID  NRF  RLYRPST +TEYREHVKDLS +S D  RIV+VDNNP+
Sbjct  199  TAGLEGYAKPLVDRIDAHNRFCHRLYRPSTVTTEYREHVKDLSCLSKDFHRIVLVDNNPY  258

Query  418  SFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHG  239
            SFLLQPLNGIPC+ FSAGQP D+QLM VI PLLKHLS Q DVRPAL + FHMPEW ++HG
Sbjct  259  SFLLQPLNGIPCLTFSAGQPVDDQLMGVIFPLLKHLSLQNDVRPALYETFHMPEWFQRHG  318

Query  238  IP  233
            IP
Sbjct  319  IP  320



>gb|KHG26951.1| putative phosphatase PSR2 [Gossypium arboreum]
Length=307

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFELECVSSDKEC+GKPKI YVTVFERPGL +FL QL  FA+LVLFTAGLEGYAR
Sbjct  124  DAGLKWFELECVSSDKECEGKPKINYVTVFERPGLQDFLNQLSEFAELVLFTAGLEGYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST STEYREHVKDL+ I  DL R VIVDNNPFSFLLQP+NG
Sbjct  184  PLVDRIDAENRFSLRLYRPSTVSTEYREHVKDLTCIFKDLCRTVIVDNNPFSFLLQPVNG  243

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQR  272
            IPCIPFSAGQPHD QL+ V+LPLLKHLSQ++DVRP L  R
Sbjct  244  IPCIPFSAGQPHDTQLLGVLLPLLKHLSQEKDVRPVLYDR  283



>ref|XP_002323581.2| hypothetical protein POPTR_0016s12400g [Populus trichocarpa]
 gb|EEF05342.2| hypothetical protein POPTR_0016s12400g [Populus trichocarpa]
Length=292

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+  FELEC SS+K+ +GKP+I +VTVFERPGL EFLKQ+G FADL+LFTAG+EGYA 
Sbjct  114  EAGVKCFELECFSSEKDVEGKPEINHVTVFERPGLKEFLKQIGEFADLILFTAGIEGYAS  173

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PL D+IDVEN+F +RL+RPST STEYRE VKDLS +S DLSR+VIVDNNPFSFLLQ LNG
Sbjct  174  PLFDRIDVENQFSQRLFRPSTVSTEYRELVKDLSCLSKDLSRVVIVDNNPFSFLLQTLNG  233

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLT  218
            IPC+PFSAG P+D+QL+DV+LPLLK+LS Q+DVRP L++RFHMPEW + HGIP+S LT
Sbjct  234  IPCVPFSAGLPYDDQLLDVLLPLLKNLSLQKDVRPVLHKRFHMPEWFQMHGIPASALT  291



>ref|XP_008370103.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Malus domestica]
Length=275

 Score =   248 bits (633),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFE+EC+SS KE DGKPK+ YVTVFERPGL EFLK++  FADLVLFTAGLE YAR
Sbjct  122  EAGLKWFEIECLSSGKESDGKPKVNYVTVFERPGLREFLKRVCEFADLVLFTAGLEDYAR  181

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+IDVEN F  RLYRPST STE+REHVKDLS +S D SRIVIVDNNPFSFLLQPLNG
Sbjct  182  PLVDRIDVENLFKLRLYRPSTVSTEFREHVKDLSCLSKDFSRIVIVDNNPFSFLLQPLNG  241

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDV  293
            IPC+PFSAGQP+D+QL++V+ PLL  LS Q+DV
Sbjct  242  IPCVPFSAGQPYDDQLLEVLHPLLMQLSLQKDV  274



>gb|EMT12311.1| CTD small phosphatase-like protein 2 [Aegilops tauschii]
Length=350

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 146/196 (74%), Gaps = 23/196 (12%)
 Frame = -3

Query  751  EAGLNWFELECVSSDK-----------------------ECDGKPKIXYVTVFERPGLHE  641
            EAGL+ F++E +SSDK                       +  G+ ++ +VTVFERPGLHE
Sbjct  120  EAGLHCFDMEGISSDKASMWPSFPPFPMILLLSSHFLKKDAKGRQRVNHVTVFERPGLHE  179

Query  640  FLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGIS  461
            FL++   FADL+LFTAGLEGYA+PLVD+ID  NRF RRLYRPST +TEYR+HVKDLS +S
Sbjct  180  FLQKTSEFADLILFTAGLEGYAKPLVDRIDAHNRFCRRLYRPSTVTTEYRDHVKDLSCLS  239

Query  460  NDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPAL  281
             D  RIV+VDNNP+SFLLQPLNGIPC+ FSAGQP D+QLM VI PLLK LS Q DVRPAL
Sbjct  240  KDFRRIVLVDNNPYSFLLQPLNGIPCLTFSAGQPMDDQLMRVIFPLLKRLSLQNDVRPAL  299

Query  280  NQRFHMPEWXEKHGIP  233
            +  FHMPEW +++GIP
Sbjct  300  HDAFHMPEWFQRNGIP  315



>ref|XP_011019112.1| PREDICTED: CTD small phosphatase-like protein isoform X3 [Populus 
euphratica]
Length=281

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -3

Query  703  ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRL  524
            + +GKP+I YVTVFERPGL EFLKQ+G FADL+LFTAGLEGYARPL D+IDVENRF +RL
Sbjct  119  DVEGKPRINYVTVFERPGLKEFLKQIGEFADLILFTAGLEGYARPLFDRIDVENRFSQRL  178

Query  523  YRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQL  344
            YRPST STEYREHVKDLS +S DLSR+VIVDNNPFSFLLQPLNGIPC+PFSA  P+DEQL
Sbjct  179  YRPSTVSTEYREHVKDLSCLSKDLSRVVIVDNNPFSFLLQPLNGIPCVPFSARLPYDEQL  238

Query  343  MDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            +DV+LPLLK+LS Q+DVRP L +RF MPEW + HGIP+S LT 
Sbjct  239  LDVLLPLLKNLSLQKDVRPVLYERFRMPEWFQMHGIPASALTV  281



>ref|XP_002315157.2| NLI interacting factor family protein [Populus trichocarpa]
 gb|EEF01328.2| NLI interacting factor family protein [Populus trichocarpa]
Length=258

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFEL+C+SSDKEC+GKPKI YVTVFERPGL EFLKQL  FA+LVLFTAGLEGYAR
Sbjct  117  EAGLKWFELDCISSDKECEGKPKINYVTVFERPGLDEFLKQLSEFAELVLFTAGLEGYAR  176

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST+STEYREHVKDLS IS D  RIVIVDNNPFSFLLQPLNG
Sbjct  177  PLVDRIDTENRFSLRLYRPSTSSTEYREHVKDLSCISKDPCRIVIVDNNPFSFLLQPLNG  236

Query  391  IPCIPFSAGQPHDEQL  344
            IPC+PFSAGQPHD Q+
Sbjct  237  IPCVPFSAGQPHDTQV  252



>ref|XP_002312160.2| NLI interacting factor family protein [Populus trichocarpa]
 gb|EEE89527.2| NLI interacting factor family protein [Populus trichocarpa]
Length=307

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKEC+GK KI YVTVFERPGL EFLKQL  FA+LVLFTAGLEGYAR
Sbjct  118  EAGLKWFELECVSSDKECEGKLKINYVTVFERPGLDEFLKQLSEFAELVLFTAGLEGYAR  177

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPSTTSTEY+EHVKDLS ISND  RIVIVDNNPFSFLLQPLNG
Sbjct  178  PLVDRIDTENRFSLRLYRPSTTSTEYQEHVKDLSCISNDPCRIVIVDNNPFSFLLQPLNG  237

Query  391  IPCIPFSAGQPHDEQL  344
            IPC+PFSAGQPHD Q+
Sbjct  238  IPCVPFSAGQPHDTQV  253



>gb|KDO68955.1| hypothetical protein CISIN_1g022258mg [Citrus sinensis]
Length=276

 Score =   241 bits (614),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = -3

Query  748  AGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARP  569
            AGL WFE+EC+SSDKEC+GKPKI +VTVFERPGL EFLKQL  FADL+LFTAGLEGYARP
Sbjct  125  AGLKWFEMECLSSDKECEGKPKINHVTVFERPGLREFLKQLSEFADLILFTAGLEGYARP  184

Query  568  LVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGI  389
            LVD+ID EN F  RLYRPSTTSTEYREHVKDLS +S DL R +IVDNNPFSFLLQPLNGI
Sbjct  185  LVDRIDGENLFSLRLYRPSTTSTEYREHVKDLSCLSKDLCRTLIVDNNPFSFLLQPLNGI  244

Query  388  PCIPFSAGQPHDEQLMDVILPLLKHL  311
            PCIPFSAGQPHD Q++  +  LLK L
Sbjct  245  PCIPFSAGQPHDNQVLTNV-TLLKFL  269



>gb|KJB74328.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=294

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 140/179 (78%), Gaps = 14/179 (8%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFELECVSSDKE +GKPKI YVTVFERPGL EFL QL               YAR
Sbjct  130  DAGLKWFELECVSSDKEFEGKPKISYVTVFERPGLQEFLNQLS--------------YAR  175

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ENRF  RLYRPST  TE+REHVKDLS +S +L R VIVDNNPFSFLLQPLNG
Sbjct  176  PLVDRIDAENRFSHRLYRPSTICTEFREHVKDLSCLSKNLCRTVIVDNNPFSFLLQPLNG  235

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            IPCIPFSAGQPHD QL+DV+LPLLKHLS Q+DVRP L  RFHMPEW +K GIPSS  + 
Sbjct  236  IPCIPFSAGQPHDTQLLDVLLPLLKHLSLQKDVRPFLYDRFHMPEWFQKQGIPSSSWSA  294



>ref|XP_006843565.1| hypothetical protein AMTR_s00007p00087260 [Amborella trichopoda]
 gb|ERN05240.1| hypothetical protein AMTR_s00007p00087260 [Amborella trichopoda]
Length=254

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGLNWFELECVS+D E DGK K+ +VTVFERPGLHEFL +L  FA+L+LFTAGLE YAR
Sbjct  118  QAGLNWFELECVSTDTEGDGKQKVNHVTVFERPGLHEFLAKLSEFAELILFTAGLEAYAR  177

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID+ENRF  RLYRPSTTST+YREHVKDLS +S DL RIVIVDNNPFSFLLQPLNG
Sbjct  178  PLVDRIDLENRFSHRLYRPSTTSTKYREHVKDLSCLSKDLCRIVIVDNNPFSFLLQPLNG  237

Query  391  IPCIPFSAGQPHDEQLM  341
            IPC+PFSAGQP+DEQ++
Sbjct  238  IPCLPFSAGQPNDEQVV  254



>gb|KCW65681.1| hypothetical protein EUGRSUZ_G03062 [Eucalyptus grandis]
Length=252

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E+GL WF+LEC+SS+K+ +GKPK+  VTVFERPGL EFL+QL  FADLVLFTAGLEGYA+
Sbjct  111  ESGLEWFDLECISSEKDSEGKPKVNLVTVFERPGLQEFLEQLHEFADLVLFTAGLEGYAK  170

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD IDVENRF  RLYRPST STEYREHVKDLS +S DLSRIVIVDNNPFSFLLQP+NG
Sbjct  171  PLVDTIDVENRFSLRLYRPSTISTEYREHVKDLSCLSKDLSRIVIVDNNPFSFLLQPVNG  230

Query  391  IPCIPFSAGQPHDEQLM  341
            IPCIPF+AGQPHD Q++
Sbjct  231  IPCIPFTAGQPHDNQVV  247



>ref|XP_006294651.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
 gb|EOA27549.1| hypothetical protein CARUB_v10023688mg [Capsella rubella]
Length=272

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPK  YVTVFERPGLHEFL+QL  FA+L+LFTA LE YAR
Sbjct  123  EAGLKWFELECVSSTKECNGKPKTSYVTVFERPGLHEFLEQLSQFANLILFTAALEDYAR  182

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            PLVD+ID ++    RLYRPST +T+YR+HVKDL  +S ++ R VIVDNNPF FLLQPLNG
Sbjct  183  PLVDRIDTQHVLNHRLYRPSTVTTQYRDHVKDLLCVSKNMYRTVIVDNNPFCFLLQPLNG  242

Query  391  IPCIPFSAGQPHDEQLM  341
            IPC  F+A QP+D Q++
Sbjct  243  IPCDSFTAEQPNDTQML  259



>ref|XP_002990146.1| hypothetical protein SELMODRAFT_131171, partial [Selaginella 
moellendorffii]
 gb|EFJ08706.1| hypothetical protein SELMODRAFT_131171, partial [Selaginella 
moellendorffii]
Length=206

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = -3

Query  748  AGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARP  569
             G+ WF+LEC+++DK+ +G  KI  V V+ERPGL EFL ++  FA+LVLFTAGLEGYARP
Sbjct  29   TGMTWFQLECLAADKDKEGNVKINCVMVYERPGLREFLARVSQFAELVLFTAGLEGYARP  88

Query  568  LVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGI  389
            LVD+ID ENR   RLYRP+T  T YREH+KDLS +  DL R VI+DNNP SF+LQP NGI
Sbjct  89   LVDRIDPENRISARLYRPATLVTCYREHIKDLSRLGRDLRRTVIIDNNPCSFILQPSNGI  148

Query  388  PCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGI  236
            PC+PF+A  P+D QL+DV+LPLL+ L+ QEDVRP L  R+ M  W    GI
Sbjct  149  PCVPFTAENPNDSQLLDVLLPLLELLAAQEDVRPTLKDRYEMAAWFHSRGI  199



>ref|XP_010231274.1| PREDICTED: uncharacterized protein LOC100829084 [Brachypodium 
distachyon]
Length=268

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 123/177 (69%), Gaps = 32/177 (18%)
 Frame = -3

Query  751  EAGLNWFELECVSSDK----ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLE  584
            EAGL+ F++EC+SSDK    + DG+ ++ +VTVFERPGLH FL+Q   FADL+LFTAGLE
Sbjct  114  EAGLHCFDMECISSDKASRRDADGRRRVNHVTVFERPGLHAFLQQTTEFADLILFTAGLE  173

Query  583  GYARPLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQ  404
            GYARPLVD+ID  NRF  RLYRPST +T                            FLLQ
Sbjct  174  GYARPLVDRIDAHNRFCHRLYRPSTVTT----------------------------FLLQ  205

Query  403  PLNGIPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            PLNGIPC+ FSAGQP D+QLM V+ PLLKHLS Q+DVRPAL   FHMPEW ++HGIP
Sbjct  206  PLNGIPCLTFSAGQPMDDQLMGVVFPLLKHLSLQKDVRPALYDTFHMPEWFQRHGIP  262



>ref|XP_002992543.1| hypothetical protein SELMODRAFT_135380, partial [Selaginella 
moellendorffii]
 gb|EFJ06481.1| hypothetical protein SELMODRAFT_135380, partial [Selaginella 
moellendorffii]
Length=206

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 129/170 (76%), Gaps = 0/170 (0%)
 Frame = -3

Query  745  GLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPL  566
            G+ WF+LEC+++DK+ +G  KI  V V+ERPGL EFL +   FA+LVLFTAGLEGYARPL
Sbjct  30   GMTWFQLECLAADKDKEGNVKINCVMVYERPGLREFLARASQFAELVLFTAGLEGYARPL  89

Query  565  VDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIP  386
            VD+ID ENR   RLYRP+T  T YREH+KDLS +  DL R VI+DNNP SF+LQP NGIP
Sbjct  90   VDRIDPENRISARLYRPATLVTCYREHIKDLSRLGRDLRRTVIIDNNPCSFILQPSNGIP  149

Query  385  CIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGI  236
            C+PF+A  P+D QL+DV+LPLL+ L+ QEDVRP L  R+ M  W    GI
Sbjct  150  CVPFTAENPNDSQLLDVLLPLLELLAAQEDVRPTLKDRYEMAAWFHSRGI  199



>ref|XP_010517421.1| PREDICTED: CTD nuclear envelope phosphatase 1 homolog isoform 
X5 [Camelina sativa]
Length=273

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSS KEC+GKPK  +VTVFERPGLHEFL+QL  FA L+LFTA LE YAR
Sbjct  124  EAGLKWFELECVSSTKECNGKPKTSHVTVFERPGLHEFLEQLSQFAHLILFTAALEDYAR  183

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
            P+VD+ID +     RLYRPST ST+YR+HVKDL  +S ++ R VIVDNNP+ FLLQPLNG
Sbjct  184  PIVDRIDTKRVLNHRLYRPSTISTQYRDHVKDLLCVSKNMCRTVIVDNNPYCFLLQPLNG  243

Query  391  IPCIPFSAGQPHDEQLM  341
            IPC  FSA QP+D Q +
Sbjct  244  IPCESFSAEQPNDTQTL  260



>gb|AAT58765.1| unknown protein, contains NLI interacting factor-like phosphatase, 
PF03031 [Oryza sativa Japonica Group]
 gb|AAT58787.1| unknown protein, contains NLI interacting factor-like phosphatase, 
PF03031 [Oryza sativa Japonica Group]
Length=278

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 106/140 (76%), Gaps = 8/140 (6%)
 Frame = -3

Query  652  GLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYREHVKDL  473
            GLH F        D+   +A    YA+PLVD+ID  NRF  RLYRPST +TEYREHVKDL
Sbjct  141  GLHCF--------DMECISAEKARYAKPLVDRIDAHNRFCHRLYRPSTVTTEYREHVKDL  192

Query  472  SGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDV  293
            S +S D  RIV+VDNNP+SFLLQPLNGIPC+ FSAGQP D+QLM VI PLLKHLS Q DV
Sbjct  193  SCLSKDFHRIVLVDNNPYSFLLQPLNGIPCLTFSAGQPVDDQLMGVIFPLLKHLSLQNDV  252

Query  292  RPALNQRFHMPEWXEKHGIP  233
            RPAL + FHMPEW ++HGIP
Sbjct  253  RPALYETFHMPEWFQRHGIP  272



>gb|AAW22871.1| hypothetical protein 56B23-g1 [Solanum lycopersicum]
Length=98

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 1/96 (1%)
 Frame = -3

Query  499  EYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHD-EQLMDVILPL  323
            EYREHVKDL  IS DLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHD +QL++VILPL
Sbjct  1    EYREHVKDLVCISKDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDIQQLLEVILPL  60

Query  322  LKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSGLTT  215
            LKHLS+Q+DVRP L  RFHMPE  +KHGIP+S LT+
Sbjct  61   LKHLSKQKDVRPELYDRFHMPECLQKHGIPASALTS  96



>ref|XP_009609474.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM50-like, partial [Nicotiana tomentosiformis]
Length=95

 Score =   157 bits (397),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -3

Query  499  EYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLL  320
            E+REHVKDLS IS DL RIVIVDNNPFSFLLQPLNGIPCIPFS GQPHDEQL++VILPLL
Sbjct  1    EFREHVKDLSSISTDLCRIVIVDNNPFSFLLQPLNGIPCIPFSPGQPHDEQLLEVILPLL  60

Query  319  KHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            KHLS+Q+DVRP L++RF MPEW + HGIP+
Sbjct  61   KHLSEQKDVRPVLHERFQMPEWFQNHGIPA  90



>ref|XP_009762549.1| PREDICTED: mitochondrial import inner membrane translocase subunit 
TIM50-like [Nicotiana sylvestris]
Length=134

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -3

Query  499  EYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLL  320
            E+REHVKDLS IS DL RIVIVDNNPFSFLLQPLNGIPCIPFS GQP DEQL++VILPLL
Sbjct  40   EFREHVKDLSSISKDLCRIVIVDNNPFSFLLQPLNGIPCIPFSPGQPDDEQLLEVILPLL  99

Query  319  KHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            KHLS+Q+DVRP L++RF MPEW + HGIP+
Sbjct  100  KHLSEQKDVRPMLHERFQMPEWFQNHGIPA  129



>ref|XP_009610469.1| PREDICTED: nuclear envelope morphology protein 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=264

 Score =   158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SSDKECD KPKI YVTVFERPGLH+FLK+LG FADLVLFTAGLEGYAR
Sbjct  145  EAGLKWFELECISSDKECDSKPKINYVTVFERPGLHDFLKELGEFADLVLFTAGLEGYAR  204

Query  571  PLVDKIDVENRFIRRLYRPSTTSTE  497
            PLVDKID+ NRF  RLYRPSTTST 
Sbjct  205  PLVDKIDLGNRFSMRLYRPSTTSTS  229



>ref|XP_009760937.1| PREDICTED: nuclear envelope morphology protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=264

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC SSDKECD KPKI YVTVFERPGLH+FLK+L  FADLVLFTAGLEGYAR
Sbjct  145  EAGLKWFELECTSSDKECDSKPKINYVTVFERPGLHDFLKELSEFADLVLFTAGLEGYAR  204

Query  571  PLVDKIDVENRFIRRLYRPSTTSTE  497
            PLVDKID+ NRF  R YRPSTTST 
Sbjct  205  PLVDKIDLGNRFSMRFYRPSTTSTS  229



>ref|XP_009805067.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X2 [Nicotiana 
sylvestris]
Length=212

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SSDKE DGKPKI YVTVFERPGLHEFLKQL  FA+LVLFTAGLEGYAR
Sbjct  125  EAGLKWFELECISSDKEYDGKPKINYVTVFERPGLHEFLKQLSKFANLVLFTAGLEGYAR  184

Query  571  PLVDKIDVENRFIRRLYRPSTTST  500
            PLVDKID EN F  RLYRPST ST
Sbjct  185  PLVDKIDPENWFSHRLYRPSTIST  208



>ref|XP_009805066.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X1 [Nicotiana 
sylvestris]
Length=226

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELEC+SSDKE DGKPKI YVTVFERPGLHEFLKQL  FA+LVLFTAGLEGYAR
Sbjct  125  EAGLKWFELECISSDKEYDGKPKINYVTVFERPGLHEFLKQLSKFANLVLFTAGLEGYAR  184

Query  571  PLVDKIDVENRFIRRLYRPSTTST  500
            PLVDKID EN F  RLYRPST ST
Sbjct  185  PLVDKIDPENWFSHRLYRPSTIST  208



>ref|XP_005648282.1| hypothetical protein COCSUDRAFT_63263 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23738.1| hypothetical protein COCSUDRAFT_63263 [Coccomyxa subellipsoidea 
C-169]
Length=209

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 8/166 (5%)
 Frame = -3

Query  733  FELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKI  554
            FE+ CV       G  ++  V VF RPG+  FL+ L  FA+L+LFTAG  GYA+ +++ +
Sbjct  32   FEVSCVL------GNGRMGDVVVFPRPGVQAFLESLAEFAELILFTAGHPGYAQLVIEML  85

Query  553  DVENR-FIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIP  377
            D +NR F  +LYRP T  T  +++VKDL  +   LSR V+VDN+PFS LLQP N +P  P
Sbjct  86   DPDNRLFAAKLYRPETVRTHMQDYVKDLRRVGRCLSRTVLVDNDPFSGLLQPCNVVPARP  145

Query  376  FSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHG  239
            F  G PHD QLM  +LP L+ LS   DVRP L + F++PE+  +HG
Sbjct  146  FY-GDPHDRQLMRDLLPFLRGLSTLPDVRPTLAESFNVPEYFSRHG  190



>gb|KDO56646.1| hypothetical protein CISIN_1g020937mg [Citrus sinensis]
Length=224

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL  FELECVSSDKECDGKPKI YVTVFERPGLHEFLK+L  FADLVLFTAGLEGYAR
Sbjct  141  EAGLKLFELECVSSDKECDGKPKINYVTVFERPGLHEFLKKLAEFADLVLFTAGLEGYAR  200

Query  571  PLVDKIDVENRFIRRLYRPSTTST  500
            PLVDKID EN F  RLYRPST ST
Sbjct  201  PLVDKIDRENLFSLRLYRPSTVST  224



>ref|XP_002533382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29000.1| conserved hypothetical protein [Ricinus communis]
Length=267

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -3

Query  748  AGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARP  569
            AG+ WFELECVSSDKEC+GKPKI YVTVFERPGL EFLKQL  FADLVLFTAGLEGYA+P
Sbjct  132  AGVKWFELECVSSDKECEGKPKINYVTVFERPGLAEFLKQLSEFADLVLFTAGLEGYAKP  191

Query  568  LVDKIDVENRFIRRLYRPSTTSTEY  494
            LVD+ID EN F  RLYRPST ST Y
Sbjct  192  LVDRIDTENVFSHRLYRPSTISTLY  216



>ref|XP_001699661.1| hypothetical protein CHLREDRAFT_111940 [Chlamydomonas reinhardtii]
 gb|EDP07357.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=202

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 102/148 (69%), Gaps = 2/148 (1%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENR-FIRRLYRPSTTSTE  497
            V V ERPGL EFL++L TFA++++FTAGLE YA+P++D ID  NR F  R+YR  T  T+
Sbjct  53   VFVVERPGLTEFLEELATFAEVIIFTAGLEDYAKPIIDAIDPSNRLFAHRIYREGTLRTD  112

Query  496  YREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLK  317
            Y + VKD++ ++ DL R V+VD+ P +FL QP NG+P + F  G P D  L++ +LPL++
Sbjct  113  YYQCVKDMARLNRDLRRTVLVDDTPLAFLHQPDNGVPVLGFR-GDPDDRLLLEAVLPLMQ  171

Query  316  HLSQQEDVRPALNQRFHMPEWXEKHGIP  233
             L+++ DVR  L +RF M  W  ++  P
Sbjct  172  VLAKEGDVRHTLQRRFDMTTWFRRNNFP  199



>gb|KCW86105.1| hypothetical protein EUGRSUZ_B02803 [Eucalyptus grandis]
Length=238

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKECDGKPK+ YVTVFERPGLHEFLK++G FA+L+LFTAGLE YAR
Sbjct  155  EAGLKWFELECVSSDKECDGKPKVNYVTVFERPGLHEFLKRVGEFANLILFTAGLEDYAR  214

Query  571  PLVDKIDVENRFIRRLYRPSTTST  500
            PLVD+ID +N    RLYRPST ST
Sbjct  215  PLVDRIDKDNLIGERLYRPSTVST  238



>ref|XP_002501116.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO62374.1| predicted protein, partial [Micromonas sp. RCC299]
Length=144

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 98/141 (70%), Gaps = 6/141 (4%)
 Frame = -3

Query  670  TVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIR-RLYRPSTTSTEY  494
            TV ERPG+ EFL QL TFA++ +FTAG+EGYA+PL+D ID     I  RLYR +   T  
Sbjct  5    TVIERPGVREFLAQLATFAEVCVFTAGMEGYAKPLLDAIDPAGDSIHHRLYRQACVKTPI  64

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
            R+HVKD+S +  DLS  VIVDNNPFSFLLQP NGIP + F+ G P D+ L+  +LP+L+ 
Sbjct  65   RDHVKDISRLGRDLSATVIVDNNPFSFLLQPHNGIPIVSFT-GDPGDDGLLRQLLPVLRR  123

Query  313  L----SQQEDVRPALNQRFHM  263
            L    ++ EDVRP   ++F +
Sbjct  124  LGDAVARGEDVRPFCRRQFKI  144



>emb|CAN74278.1| hypothetical protein VITISV_004711 [Vitis vinifera]
Length=388

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL WFELECVSSDKEC+GKP I YVTVFERPGL EFL+Q+  FA+LVLFTA LEGYAR
Sbjct  276  EAGLKWFELECVSSDKECEGKPNISYVTVFERPGLQEFLEQISEFAELVLFTAALEGYAR  335

Query  571  PLVDKIDVENRFIRRLYRPSTTST  500
            PLVDKID  NRF +RLYRPST ST
Sbjct  336  PLVDKIDAGNRFSKRLYRPSTVST  359



>gb|AFW82277.1| hypothetical protein ZEAMMB73_719646 [Zea mays]
Length=295

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -3

Query  499  EYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLL  320
            EYREHVKDLS +S D  RIV+VDNNP+SFLLQPLNGIPC+ FSAGQP D+QLM  + PLL
Sbjct  201  EYREHVKDLSCLSKDFQRIVLVDNNPYSFLLQPLNGIPCVTFSAGQPVDDQLMGTMFPLL  260

Query  319  KHLSQQEDVRPALNQRFHMPEWXEKHGIP  233
            KHL+ Q+DVRPAL + FHMPEW ++ GIP
Sbjct  261  KHLALQKDVRPALYEAFHMPEWFQRQGIP  289



>ref|XP_007008963.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 2, partial [Theobroma cacao]
 gb|EOY17773.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
isoform 2, partial [Theobroma cacao]
Length=213

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            +AGL WFELECVSSDKE +GKPKI YVTVFERPGL EFL QL  FA+LVLFTAGLEGYAR
Sbjct  132  DAGLKWFELECVSSDKEFEGKPKINYVTVFERPGLQEFLNQLSEFAELVLFTAGLEGYAR  191

Query  571  PLVDKIDVENRFIRRLYRPST  509
            PLVD+ID ENRF  RLYRPST
Sbjct  192  PLVDRIDAENRFSLRLYRPST  212



>emb|CDP11904.1| unnamed protein product [Coffea canephora]
 emb|CDP04240.1| unnamed protein product [Coffea canephora]
Length=108

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = -3

Query  487  HVKDLSG--ISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
             V+D +G  +     RI++ DNNPFSFLLQPLNGIPCIPFSAGQP DEQL++VILPLLKH
Sbjct  9    QVRDATGNQLLGSPWRIILGDNNPFSFLLQPLNGIPCIPFSAGQPQDEQLLEVILPLLKH  68

Query  313  LSQQEDVRPALNQRFHMPEWXEKHGIPSS  227
            LSQQ+DVRP L +RFHMPE  ++HGIP+S
Sbjct  69   LSQQKDVRPVLYERFHMPEGFQRHGIPAS  97



>ref|XP_008656380.1| PREDICTED: probable phosphatase PSR2 isoform X1 [Zea mays]
Length=194

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAGL+ F++ECV S+K+ +G+ +I  VTVFERPGLHEFL++   FADLVLFTAGLEGYA+
Sbjct  111  EAGLHRFDMECVLSEKDTEGRQRINRVTVFERPGLHEFLQRTSEFADLVLFTAGLEGYAK  170

Query  571  PLVDKIDVENRFIRRLYRPSTTST  500
            PLVD+ID  NRF  RLYRPST +T
Sbjct  171  PLVDRIDAHNRFTHRLYRPSTVNT  194



>ref|XP_008388217.1| PREDICTED: uncharacterized protein LOC103450630 [Malus domestica]
Length=216

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 96/176 (55%), Gaps = 60/176 (34%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            EAG+ WFE+EC+SS+KE DGKPKI YVTVFERPGL EFLK++  FADL LF         
Sbjct  101  EAGMKWFEMECLSSEKESDGKPKINYVTVFERPGLGEFLKRVSEFADLALF---------  151

Query  571  PLVDKIDVENRFIRRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNG  392
                      RF+                ++ L+GI                        
Sbjct  152  ----------RFL----------------LQPLNGI------------------------  161

Query  391  IPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPSSG  224
             PC+PFSAGQP+D+ L++V+LPLLK LS Q+DVRP L +RFHM EW + HG    G
Sbjct  162  -PCVPFSAGQPYDDLLLEVLLPLLKQLSLQKDVRPTLQERFHMAEWFQMHGFHVCG  216



>ref|XP_002956598.1| hypothetical protein VOLCADRAFT_36131 [Volvox carteri f. nagariensis]
 gb|EFJ42365.1| hypothetical protein VOLCADRAFT_36131 [Volvox carteri f. nagariensis]
Length=119

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 78/115 (68%), Gaps = 2/115 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENR-FIRRLYRPSTTSTE  497
            V V ERPGL EFL++L +FA++V+FTAGLE YA+P++D +D   + F  R+YR  T  TE
Sbjct  6    VFVVERPGLQEFLEELASFAEVVIFTAGLEDYAKPIIDALDPSGKLFAHRIYREGTLRTE  65

Query  496  YREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVI  332
            + + VKD++ +  DL++ V+VD+ P +FL QP NG+P + F  G   D  L + +
Sbjct  66   FYQCVKDMARVGRDLAKTVLVDDTPLAFLHQPDNGVPVLGFR-GDMDDRLLAEAV  119



>ref|XP_011401617.1| CTD small phosphatase-like protein, partial [Auxenochlorella 
protothecoides]
 gb|KFM28581.1| CTD small phosphatase-like protein, partial [Auxenochlorella 
protothecoides]
Length=185

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 83/142 (58%), Gaps = 3/142 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVE--NRFIRRLYRPSTTST  500
            V V ERPGL EFL +    A++VLFTAGL  YA P+ D+++      F  RLYRP+T  +
Sbjct  44   VVVVERPGLGEFLARCVRCAEVVLFTAGLAEYAVPICDELEARYPACFHHRLYRPATVPS  103

Query  499  EYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLL  320
                 VKDL+ +   L R V+VD+ P +F  QP NGIP + F  G   D  L + + PL+
Sbjct  104  ADYPCVKDLARLGRPLGRTVLVDDTPLAFSFQPDNGIPVLQFR-GDVDDRLLNEALAPLI  162

Query  319  KHLSQQEDVRPALNQRFHMPEW  254
            + L+   DVR  L+ RF+M  W
Sbjct  163  ETLAAAHDVRSVLHARFNMRAW  184



>gb|KIZ04779.1| hypothetical protein MNEG_3173 [Monoraphidium neglectum]
Length=669

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTE  497
            V V ERPGL +FL +L  FA++V+FTAGL+ YA P++D ID  ++++  R+YR  TT T+
Sbjct  504  VFVVERPGLTDFLAELAAFAEVVVFTAGLQEYAAPIIDAIDPGSKYVAARVYREGTTRTD  563

Query  496  YREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLK  317
            + + VKD+  +   LSR V+VD+ P +FL QP NG+P + F  G P D  L + +LPLL+
Sbjct  564  HYQCVKDMRRVGRALSRTVLVDDTPLAFLHQPSNGVPVLGFR-GDPEDRLLGEAVLPLLQ  622



>ref|XP_005845048.1| hypothetical protein CHLNCDRAFT_137319 [Chlorella variabilis]
 gb|EFN52946.1| hypothetical protein CHLNCDRAFT_137319 [Chlorella variabilis]
Length=670

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 86/146 (59%), Gaps = 3/146 (2%)
 Frame = -3

Query  694  GKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVE--NRFIRRLY  521
            GK     V V ERPGL +FL+++  F+++VLFTAGL+ YA P+ D I+      F  RLY
Sbjct  524  GKLNPNGVFVVERPGLGDFLRRIAPFSEVVLFTAGLKDYAAPICDAIEARYPGAFHHRLY  583

Query  520  RPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLM  341
            R +T + +    +KD+S +  DL R V+VD+ P +F  QP +G+P + F  G   D  L 
Sbjct  584  RTATVAEDVYPCIKDMSRLGRDLGRCVLVDDTPLAFFRQPDHGVPVLQFR-GDMDDRMLP  642

Query  340  DVILPLLKHLSQQEDVRPALNQRFHM  263
            + + PLL+ L    DV   L +RF+M
Sbjct  643  EAVAPLLESLHGCADVTVPLARRFNM  668



>ref|XP_007141763.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
 gb|ESW13757.1| hypothetical protein PHAVU_008G223800g [Phaseolus vulgaris]
Length=212

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYAR  572
            E GLNWFELECVS DKE +GKPKI YVTVFERPGL EFLK+L  FA+LVLFTAGLEG ++
Sbjct  125  EGGLNWFELECVSIDKEGEGKPKINYVTVFERPGLKEFLKKLSEFANLVLFTAGLEGLSQ  184



>gb|KJB74329.1| hypothetical protein B456_011G288400 [Gossypium raimondii]
Length=243

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEG  581
            +AGL WFELECVSSDKE +GKPKI YVTVFERPGL EFL QL  FA+LVLFTAGLEG
Sbjct  130  DAGLKWFELECVSSDKEFEGKPKISYVTVFERPGLQEFLNQLSEFAELVLFTAGLEG  186



>ref|XP_008895497.1| hypothetical protein PPTG_04907 [Phytophthora parasitica INRA-310]
 gb|ETL85190.1| hypothetical protein L917_15170 [Phytophthora parasitica]
 gb|ETN19675.1| hypothetical protein PPTG_04907 [Phytophthora parasitica INRA-310]
 gb|ETP36286.1| hypothetical protein F442_15739 [Phytophthora parasitica P10297]
Length=237

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 86/146 (59%), Gaps = 5/146 (3%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVE-NRFIRRLYRPSTTSTE  497
              V +RPGL  FL++     D+ +FTAGLE Y +P++D +D + N F  R +R S    +
Sbjct  89   AVVNKRPGLDRFLEEAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRK  148

Query  496  YREHVKDLSGI-SNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLL  320
                +KDLS +   DLSR+++VDNNP SFL+QP NGIP   F      +++ ++ +  +L
Sbjct  149  GM-FLKDLSVVRGGDLSRVILVDNNPVSFLMQPSNGIPVPSFY--DDANDRTLESLTKVL  205

Query  319  KHLSQQEDVRPALNQRFHMPEWXEKH  242
              L   EDVRP L+Q F + +   +H
Sbjct  206  ASLQDVEDVRPRLHQLFRLADLLAEH  231



>ref|XP_008614870.1| hypothetical protein SDRG_10647 [Saprolegnia diclina VS20]
 gb|EQC31863.1| hypothetical protein SDRG_10647 [Saprolegnia diclina VS20]
Length=227

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 85/145 (59%), Gaps = 4/145 (3%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIR-RLYRPSTTSTE  497
            V V +RPGL  FL +     DL +FTAGLE Y +P++D +D  N   + R +R S T  +
Sbjct  79   VVVNKRPGLDAFLLEASQHFDLYVFTAGLEIYGKPILDALDPTNTLFKGRFFRTSCTQ-K  137

Query  496  YREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLK  317
                +KDL  I +DLS++V+VDNNP SFL QP NGIP +P      HD+ L + +  ++ 
Sbjct  138  SGFFMKDLRSIRSDLSKVVLVDNNPVSFLPQPSNGIP-VPSFYDDVHDKTL-ESLTKVVM  195

Query  316  HLSQQEDVRPALNQRFHMPEWXEKH  242
             L    DVRP L+Q F + +   +H
Sbjct  196  TLRNVTDVRPRLHQLFRLADLLAEH  220



>ref|XP_009538580.1| hypothetical protein PHYSODRAFT_551168 [Phytophthora sojae]
 gb|AAV63948.1| putative nuclear LIM interactor-interacting protein [Phytophthora 
sojae]
 gb|EGZ05719.1| hypothetical protein PHYSODRAFT_551168 [Phytophthora sojae]
Length=237

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 86/146 (59%), Gaps = 5/146 (3%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVE-NRFIRRLYRPSTTSTE  497
              V +RPGL  FL++     D+ +FTAGLE Y +P++D +D + N F  R +R S    +
Sbjct  89   AVVNKRPGLDRFLEEAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRK  148

Query  496  YREHVKDLSGI-SNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLL  320
                +KDLS +   DLSR+++VDNNP SFL+QP NGIP   F      +++ ++ +  +L
Sbjct  149  GM-FLKDLSVVRGGDLSRVILVDNNPVSFLMQPSNGIPVPSFY--DDANDRTLESLSKVL  205

Query  319  KHLSQQEDVRPALNQRFHMPEWXEKH  242
              L   EDVRP L+Q F + +   +H
Sbjct  206  ASLQDVEDVRPRLHQLFRLADLLAEH  231



>ref|WP_028833278.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=229

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 96/175 (55%), Gaps = 14/175 (8%)
 Frame = -3

Query  742  LNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLV  563
            +N  E+   +SD        +  V V +RPG+  FLK+L    D+  FTA  E YARP++
Sbjct  59   VNGIEVSIKTSDGT------VHQVVVRKRPGVDGFLKKLAMEHDVYAFTASEEYYARPIL  112

Query  562  DKIDVENRFIRRLY-RPSTTSTEYREHVKDLSGI-SNDLSRIVIVDNNPFSFLLQPLNGI  389
              +D E +  +  Y R   T  + +  VKDL  + + D++R V+VDNNP SFL QP NGI
Sbjct  113  KMLDPEKKIFKGCYFRTDCTQIKGKTFVKDLGKVEAPDMARTVLVDNNPMSFLCQPRNGI  172

Query  388  PCIPF--SAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQRFHMPEWXEKHGIPS  230
            P + +  SAG    +  ++++   L+ L   EDVRP LN+ F + +   K+  P+
Sbjct  173  PILSWYGSAG----DTALNILDNFLRRLQPLEDVRPFLNKTFGVEKALAKYQNPT  223



>gb|KDO32623.1| hypothetical protein SPRG_02324 [Saprolegnia parasitica CBS 223.65]
Length=227

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 85/145 (59%), Gaps = 4/145 (3%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIR-RLYRPSTTSTE  497
            V V +RPGL  FL +     DL +FTAGLE Y +P++D +D  N   + R +R S T  +
Sbjct  79   VIVNKRPGLDAFLLEASQHFDLYVFTAGLEIYGKPILDALDPTNTLFKGRFFRTSCTQ-K  137

Query  496  YREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLK  317
                +KDL  I +DLS++V+VDNNP SFL QP NGIP +P      HD+ L + +  ++ 
Sbjct  138  SGFFMKDLRSIRSDLSKVVLVDNNPVSFLPQPSNGIP-VPSFYDDVHDKTL-ESLTKVVM  195

Query  316  HLSQQEDVRPALNQRFHMPEWXEKH  242
             L    DVRP L+Q F + +   +H
Sbjct  196  TLRDVTDVRPRLHQLFRLADLLAEH  220



>ref|XP_009834767.1| hypothetical protein H257_10034 [Aphanomyces astaci]
 gb|ETV75636.1| hypothetical protein H257_10034 [Aphanomyces astaci]
Length=229

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 83/144 (58%), Gaps = 2/144 (1%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPGL  FL++     D+ +FTAGLE Y RP+++ +D      +  +  ++ + + 
Sbjct  81   VVVNKRPGLDAFLQKASQHFDVYVFTAGLEMYGRPILEALDPSKSLFKGHFFRTSCTLKS  140

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
               +KDL  +  DLS++V+VDNNP SFL QP NGIP +P      HD+ L D +  +L +
Sbjct  141  GFFMKDLRSVRTDLSKVVLVDNNPVSFLPQPSNGIP-VPSFYDDIHDKTL-DSLTKVLMN  198

Query  313  LSQQEDVRPALNQRFHMPEWXEKH  242
            L    DVRP L+Q F + +    H
Sbjct  199  LLNLSDVRPRLHQLFRLSDLLADH  222



>gb|AAV63941.1| putative nuclear LIM factor interactor-interacting protein hyphal 
form [Phytophthora infestans]
Length=237

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 86/144 (60%), Gaps = 5/144 (3%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVE-NRFIRRLYRPSTTSTEYR  491
            V +RPGL  FL++     D+ +FTAGLE Y +P++D +D + N F  R +R S    +  
Sbjct  91   VNKRPGLDRFLEEAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGM  150

Query  490  EHVKDLSGI-SNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +KDL+ +   DLSR+++VDNNP SFL+QP NGIP   F      +++ ++ +  +L  
Sbjct  151  -FLKDLNVVRGGDLSRVILVDNNPVSFLMQPSNGIPVPSFY--DDANDRTLESLSKVLAS  207

Query  313  LSQQEDVRPALNQRFHMPEWXEKH  242
            L   EDVRP L+Q F + +   +H
Sbjct  208  LQDDEDVRPRLHQLFRLADLLAEH  231



>gb|ETO67065.1| hypothetical protein F444_15879 [Phytophthora parasitica P1976]
Length=237

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 86/146 (59%), Gaps = 5/146 (3%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVE-NRFIRRLYRPSTTSTE  497
              V +RPGL  FL++     D+ +FTAGLE Y +P++D +D + N F  R +R S    +
Sbjct  89   AVVNKRPGLDRFLEEAVKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRK  148

Query  496  YREHVKDLSGI-SNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLL  320
                +KDLS +   DLSR+++VDNNP SFL+QP NGIP   F      +++ ++ +  +L
Sbjct  149  GM-FLKDLSVVRGGDLSRVILVDNNPVSFLMQPSNGIPVPSFY--DDANDRTLESLTKVL  205

Query  319  KHLSQQEDVRPALNQRFHMPEWXEKH  242
              L   EDVRP L+Q F + +   +H
Sbjct  206  ASLQDVEDVRPRLHQLFRLADLLAEH  231



>gb|ETI38295.1| hypothetical protein F443_15895 [Phytophthora parasitica P1569]
 gb|ETK78533.1| hypothetical protein L915_15448 [Phytophthora parasitica]
 gb|ETL31971.1| hypothetical protein L916_15343 [Phytophthora parasitica]
 gb|ETM38354.1| hypothetical protein L914_15308 [Phytophthora parasitica]
 gb|ETP08221.1| hypothetical protein F441_15730 [Phytophthora parasitica CJ01A1]
Length=237

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 86/146 (59%), Gaps = 5/146 (3%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVE-NRFIRRLYRPSTTSTE  497
              V +RPGL  FL++     D+ +FTAGLE Y +P++D +D + N F  R +R S    +
Sbjct  89   AVVNKRPGLDRFLEEAVKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRK  148

Query  496  YREHVKDLSGI-SNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLL  320
                +KDLS +   DLSR+++VDNNP SFL+QP NGIP   F      +++ ++ +  +L
Sbjct  149  GM-FLKDLSVVRGGDLSRVILVDNNPVSFLMQPSNGIPVPSFY--DDANDRTLESLTKVL  205

Query  319  KHLSQQEDVRPALNQRFHMPEWXEKH  242
              L   EDVRP L+Q F + +   +H
Sbjct  206  ASLQDVEDVRPRLHQLFRLADLLAEH  231



>ref|XP_008864818.1| hypothetical protein H310_02908 [Aphanomyces invadans]
 gb|ETW06743.1| hypothetical protein H310_02908 [Aphanomyces invadans]
Length=225

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 84/144 (58%), Gaps = 2/144 (1%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPGL  FL++     D+ +FTAGLE Y RP+++ +D      +  +  ++ + + 
Sbjct  77   VVVNKRPGLDAFLQKASQHFDVYVFTAGLEMYGRPILEALDPSKSLFKGHFFRTSCTLKS  136

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
               +KDL  + +DLS++V+VDNNP SFL QP NGIP +P      HD+ L D +  +L +
Sbjct  137  GFFMKDLRSVRSDLSKVVLVDNNPVSFLPQPSNGIP-VPSFYDDIHDKTL-DSLTKVLMN  194

Query  313  LSQQEDVRPALNQRFHMPEWXEKH  242
            L    DVRP L+Q F + +    H
Sbjct  195  LLNLSDVRPRLHQLFRLSDLLADH  218



>gb|KFK44809.1| hypothetical protein AALP_AA1G305500 [Arabis alpina]
Length=197

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 82/132 (62%), Gaps = 5/132 (4%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTEYR  491
            V +RPG+ EFL ++G    + +FTAGL  YA  ++DK+D +NR I +RLYR S T T  R
Sbjct  64   VVKRPGVTEFLDRIGKKYRVAVFTAGLPEYASQVLDKMD-KNRVISQRLYRDSCTETNGR  122

Query  490  EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHL  311
             + KDLS ++ DL  ++IVD+NPFS+ LQP NG+P  PF      D++LM  +       
Sbjct  123  -YAKDLSLVAKDLGSVLIVDDNPFSYSLQPDNGVPIKPF-VNDMEDQELMK-LADFFDGC  179

Query  310  SQQEDVRPALNQ  275
             Q ED+R A  +
Sbjct  180  YQYEDLRDAATE  191



>ref|XP_002906966.1| CTD small phosphatase-like protein, putative [Phytophthora infestans 
T30-4]
 ref|XP_002909873.1| CTD small phosphatase-like protein, putative [Phytophthora infestans 
T30-4]
 gb|EEY59479.1| CTD small phosphatase-like protein, putative [Phytophthora infestans 
T30-4]
 gb|EEY66367.1| CTD small phosphatase-like protein, putative [Phytophthora infestans 
T30-4]
Length=237

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 86/144 (60%), Gaps = 5/144 (3%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVE-NRFIRRLYRPSTTSTEYR  491
            V +RPGL  FL++     D+ +FTAGLE Y +P++D +D + N F  R +R S    +  
Sbjct  91   VNKRPGLDRFLEEAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGM  150

Query  490  EHVKDLSGI-SNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +KDL+ +   DLSR+++VDNNP SFL+QP NGIP   F      +++ ++ +  +L  
Sbjct  151  -FLKDLNVVRGGDLSRVILVDNNPVSFLMQPSNGIPVPSFY--DDANDRTLESLSKVLAS  207

Query  313  LSQQEDVRPALNQRFHMPEWXEKH  242
            L   EDVRP L+Q F + +   +H
Sbjct  208  LQDVEDVRPRLHQLFRLADLLAEH  231



>ref|XP_007908504.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Callorhinchus milii]
Length=135

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RP + EFLK++G   + +LFTA L  Y  P+VD +D  N F  RL+R +    + 
Sbjct  2    VYVLKRPHVDEFLKRVGQLFECILFTASLAKYGDPVVDVLDKWNTFRSRLFREACVYHQ-  60

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +  +L+R++I+DN+P S++  P N IP   +     +D +L+D ILPLL+ 
Sbjct  61   GSYVKDLSLLGRNLNRVIIIDNSPLSYIFHPNNAIPVTSWFDDM-YDTELLD-ILPLLEK  118

Query  313  LSQQEDVRPALNQ  275
            L+  +D+   L Q
Sbjct  119  LAVTDDIYQVLQQ  131



>ref|XP_007861736.1| hypothetical protein GLOTRDRAFT_34014 [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ58988.1| hypothetical protein GLOTRDRAFT_34014 [Gloeophyllum trabeum ATCC 
11539]
Length=207

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 89/168 (53%), Gaps = 13/168 (8%)
 Frame = -3

Query  745  GLNWFELECVSSDKECDGKPKIXYVT---------VFERPGLHEFLKQLGTFADLVLFTA  593
            G  WF L  +   K   G  KI  V          V++RP    FL+++ T+  LV+FTA
Sbjct  40   GRGWFGLSGLFGRKN-KGAGKIVEVVLGGRSTLYHVYKRPFADYFLRKVSTWYTLVIFTA  98

Query  592  GLEGYARPLVDKIDVENRFI-RRLYRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFS  416
             ++ YA P++D +D     + RRL+R S T      + KDLS +  DL+R+ +VDN+P S
Sbjct  99   SMQEYADPVIDWLDAGRGILARRLFRESCTLLPNGSYSKDLSKVEQDLARVFLVDNSPIS  158

Query  415  FLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLSQQEDVRPALNQR  272
            + +   NG+P I      PHDE L+D +LP+L  L    DVR  L  R
Sbjct  159  YSINEANGVP-IEGWTDDPHDEALLD-LLPMLDSLRFTSDVRRVLGIR  204



>ref|XP_005647998.1| hypothetical protein COCSUDRAFT_62990 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23454.1| hypothetical protein COCSUDRAFT_62990 [Coccomyxa subellipsoidea 
C-169]
Length=561

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKID--VENRFIRRLYRPSTTST  500
            V V ERPGL  F  QL  FA++VLFTAGLE YA+P++D++D      F  RLYRP+T + 
Sbjct  454  VFVVERPGLTAFFDQLCKFAEVVLFTAGLEDYAKPILDELDRRYNGVFEYRLYRPATVAC  513

Query  499  EYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPF  374
                 +KDLS +  DL R V+VD+ P +FL QP NGIP   F
Sbjct  514  SAYPCLKDLSRLGRDLRRTVLVDDTPLAFLRQPDNGIPIFNF  555



>ref|XP_002961880.1| hypothetical protein SELMODRAFT_77112 [Selaginella moellendorffii]
 gb|EFJ37140.1| hypothetical protein SELMODRAFT_77112 [Selaginella moellendorffii]
Length=240

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 85/141 (60%), Gaps = 11/141 (8%)
 Frame = -3

Query  685  KIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTT  506
            K+  V V +RPG+ +FL+ +    ++VLFTA L+ YA PLVD++D  +    RLYR S  
Sbjct  98   KLQTVYVVKRPGVEQFLRAMADKFEVVLFTASLQKYADPLVDRLDYYSAIRHRLYRESC-  156

Query  505  STEYREH----VKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMD  338
                R +    VKDLS +  DL +++IVDN+P S+ LQP N +P   F    P D +L++
Sbjct  157  ----RLYGGGLVKDLSILGRDLHKVIIVDNSPHSYALQPQNAVPITSF-IDNPRDRELLE  211

Query  337  VILPLLKHLSQQEDVRPALNQ  275
            +I P L  LS+ ++V  ALN 
Sbjct  212  LI-PYLSVLSEFDNVTAALNS  231



>emb|CDS08568.1| hypothetical protein LRAMOSA09929 [Absidia idahoensis var. thermophila]
Length=184

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 83/136 (61%), Gaps = 3/136 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+ EF++++G   ++V+FTA L  YA P++DK+D+ N    RL+R +  + + 
Sbjct  45   VYVLKRPGVDEFMRKMGEQYEIVVFTASLSKYADPVLDKLDIHNVVKHRLFREACCNYK-  103

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +  DLS  +I+DN+P S+L    N +P I      PHD +L D++   L+ 
Sbjct  104  GTYVKDLSQLGRDLSGAIILDNSPASYLFHTANAVP-ISTWFNDPHDTELSDLV-DFLQD  161

Query  313  LSQQEDVRPALNQRFH  266
            LS+ +DV   LN   +
Sbjct  162  LSKVDDVTSILNTSLN  177



>gb|KIK48253.1| hypothetical protein CY34DRAFT_798350 [Suillus luteus UH-Slu-Lm8-n1]
Length=445

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 81/131 (62%), Gaps = 5/131 (4%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYR-  491
            V +RPG+ EFL+Q+G   ++V++TA L  YA P++D +D+ N    RL+R S     YR 
Sbjct  316  VQKRPGVDEFLRQMGELYEVVVYTASLGSYADPVLDHLDIYNAVSHRLFRESC--FRYRG  373

Query  490  EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHL  311
             +VKDLS +   ++  +I+DN+P S++    N +P I      PHD +L+D I PLL  L
Sbjct  374  NYVKDLSQLGRPMADTIIIDNSPASYIFHSTNAVP-ISSWFNDPHDSELID-ICPLLADL  431

Query  310  SQQEDVRPALN  278
            S  +DVR ALN
Sbjct  432  SDTKDVRSALN  442



>ref|XP_004309632.1| PREDICTED: CTD small phosphatase-like protein [Fragaria vesca 
subsp. vesca]
Length=355

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 81/140 (58%), Gaps = 7/140 (5%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+ +FL++L    ++V FTAG+  YA  ++D++D +     RLYR S     Y +
Sbjct  120  VIKRPGVDQFLQKLAEKYEVVAFTAGMREYASLVLDRLDSQGFISHRLYRDSCKEV-YGK  178

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
             VKDLSG+  DL R+VIVD+NP S+ LQP NGIP  PF      D +L      LLK   
Sbjct  179  FVKDLSGLGRDLRRVVIVDDNPNSYFLQPDNGIPVRPFVYDDMEDWELGR----LLKFFE  234

Query  307  QQ--EDVRPALNQRFHMPEW  254
             +  ED+R A+ +  +   W
Sbjct  235  GEGSEDIRDAVREYVNDEGW  254



>ref|XP_008327260.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like, partial [Cynoglossus semilaevis]
Length=154

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 84/144 (58%), Gaps = 5/144 (3%)
 Frame = -3

Query  703  ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRL  524
            E DG   +  V V +RP + EFL+++G   + VLFTA L  YA P+ D +D+   F  RL
Sbjct  12   ELDGS--VYQVYVLKRPHVDEFLRRMGELFECVLFTASLAKYADPVSDLLDISGAFQSRL  69

Query  523  YRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQL  344
            +R S    +   +VKDLS +  DL++++I+DN+P S++  P N I    +   Q  D +L
Sbjct  70   FRESCVFHK-GNYVKDLSRLGRDLNKVIIIDNSPASYVFHPENAIAVESWFDDQ-SDTEL  127

Query  343  MDVILPLLKHLSQQEDVRPALNQR  272
            +D+I P  + LSQ +D+   L QR
Sbjct  128  LDLI-PFFESLSQMDDIYDMLKQR  150



>ref|XP_002990255.1| hypothetical protein SELMODRAFT_131302 [Selaginella moellendorffii]
 gb|EFJ08670.1| hypothetical protein SELMODRAFT_131302 [Selaginella moellendorffii]
Length=240

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 84/141 (60%), Gaps = 11/141 (8%)
 Frame = -3

Query  685  KIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTT  506
            K+  V V +RPG+ +FL  +    ++VLFTA L+ YA PLVD++D  +    RLYR S  
Sbjct  98   KLQTVYVVKRPGVEQFLSAMADKFEVVLFTASLQKYADPLVDRLDYYSAIRHRLYRESC-  156

Query  505  STEYREH----VKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMD  338
                R +    VKDLS +  DL +++IVDN+P S+ LQP N +P   F    P D +L++
Sbjct  157  ----RLYGGGLVKDLSILGRDLHKVIIVDNSPHSYALQPQNAVPITSF-IDNPRDRELLE  211

Query  337  VILPLLKHLSQQEDVRPALNQ  275
            +I P L  LS+ ++V  ALN 
Sbjct  212  LI-PYLSVLSEFDNVTAALNS  231



>gb|KIP07696.1| hypothetical protein PHLGIDRAFT_70560 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=171

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 77/133 (58%), Gaps = 3/133 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTEYR  491
            V++RP    FL+++  +  LV+FTA ++ YA P++D +D     + RRL+R S T     
Sbjct  38   VYKRPFADYFLRKVSAWYTLVIFTASMQEYADPVIDWLDAGRGILGRRLFRESCTQLPNG  97

Query  490  EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHL  311
             + KDLS I  DLSR+ +VDN+P  + +   NGIP I      PHDE L+D +LP+L  L
Sbjct  98   SYTKDLSIIEQDLSRVCLVDNSPICYTINEANGIP-IEGWTNDPHDEALLD-LLPVLDSL  155

Query  310  SQQEDVRPALNQR  272
                DVR  L  R
Sbjct  156  RFTSDVRRVLGIR  168



>ref|XP_007302351.1| NLI interacting factor [Stereum hirsutum FP-91666 SS1]
 gb|EIM88361.1| NLI interacting factor [Stereum hirsutum FP-91666 SS1]
Length=149

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 78/133 (59%), Gaps = 3/133 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTEYR  491
            V++RP +  FL+++  +  LV+FTA ++ YA P++D +D     + RR +R S T     
Sbjct  15   VYKRPYVDYFLRKVSAWYTLVIFTASMQEYADPVIDWLDAGRGILGRRFFRESCTLMPNG  74

Query  490  EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHL  311
             + KDLS I  DLSR+ ++DN+P  +++   NGIP I      PHDE L+D +LP+L  L
Sbjct  75   SYTKDLSIIEQDLSRVCLIDNSPVCYVVNETNGIP-IEGWTHDPHDEALLD-LLPVLDSL  132

Query  310  SQQEDVRPALNQR  272
                DVR  L  R
Sbjct  133  RFTSDVRHVLGIR  145



>ref|XP_001877699.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR11802.1| predicted protein, partial [Laccaria bicolor S238N-H82]
Length=182

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+D+      RL+R S  + + 
Sbjct  51   VYVIKRPGVDNFLKKMGEIYEVVVFTASLSKYADPVLDKLDIHQVVSHRLFRESCYNHK-  109

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   +S  +I+DN+P S++  P N +P   +    PHD +L D++ P L  
Sbjct  110  GNYVKDLSQLGRPISDTIILDNSPASYIFHPNNAVPVSSW-FNDPHDTELTDLV-PFLAD  167

Query  313  LSQQEDVRPALN  278
            LS  +DVR  L+
Sbjct  168  LSTVDDVRGVLD  179



>ref|XP_009346338.1| PREDICTED: uncharacterized protein LOC103938066 [Pyrus x bretschneideri]
Length=191

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  751  EAGLNWFELECVSSDKECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLE  584
            EAG+ WFE+EC+SS+KE DGKPKI YVTVFERPGL EFLK++  FADL LFTAGLE
Sbjct  121  EAGMKWFEIECLSSEKESDGKPKINYVTVFERPGLGEFLKRVSEFADLALFTAGLE  176



>ref|XP_007025282.1| Haloacid dehalogenase hydrolase domain-containing protein [Theobroma 
cacao]
 gb|EOY27904.1| Haloacid dehalogenase hydrolase domain-containing protein [Theobroma 
cacao]
Length=304

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 76/131 (58%), Gaps = 2/131 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+ EFL+ +    +LV+FTAG   YA  ++D +D +     RLYR S      R 
Sbjct  171  VLKRPGIDEFLETISKKYELVVFTAGHVAYASKVLDTLDPKGLISHRLYRDSCKQVRGR-  229

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
             VKDLS +  DL + VIVD+NP SF LQP NGIP  PF   Q  D +LM + +   +  +
Sbjct  230  FVKDLSRLGRDLRKTVIVDDNPKSFALQPKNGIPIKPFVGDQLWDNELMKLTV-FFETCN  288

Query  307  QQEDVRPALNQ  275
              ED+R  +NQ
Sbjct  289  VFEDMRDTVNQ  299



>gb|KIM45038.1| hypothetical protein M413DRAFT_66696, partial [Hebeloma cylindrosporum 
h7]
Length=182

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+D+      RL+R S  + + 
Sbjct  51   VYVIKRPGVDNFLKKMGEIYEVVVFTASLSKYADPVLDKLDIHQVVTHRLFRESCYNHK-  109

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   ++  +I+DN+P S++  P N +P   +    PHD +L D++ P L  
Sbjct  110  GNYVKDLSQLGRPIADTIILDNSPASYIFHPNNAVPVSSW-FNDPHDTELTDLV-PFLAD  167

Query  313  LSQQEDVRPALN  278
            LS  +DVR  L+
Sbjct  168  LSAGDDVRGILD  179



>ref|XP_003029995.1| hypothetical protein SCHCODRAFT_57677 [Schizophyllum commune 
H4-8]
 gb|EFI95092.1| hypothetical protein SCHCODRAFT_57677 [Schizophyllum commune 
H4-8]
Length=182

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+  FLK++G   ++V+FTA L  YA P++DK+DV +    RL+R S  S     
Sbjct  53   VLKRPGVDNFLKRMGELYEVVVFTASLSKYADPVLDKLDVHHAVAHRLFRESCYSHR-GN  111

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
            +VKDLS +   ++  +I+DN+P S++  P N +P   +    PHD +L D+I P L  L+
Sbjct  112  YVKDLSQLGRPVADTIILDNSPASYIFHPNNAVPVSSW-FNDPHDAELTDLI-PFLADLT  169

Query  307  QQEDVRPALN  278
              +DVR  L+
Sbjct  170  AVDDVRGVLS  179



>ref|XP_006957876.1| NIF-domain-containing protein [Wallemia sebi CBS 633.66]
 gb|EIM22072.1| NIF-domain-containing protein [Wallemia sebi CBS 633.66]
Length=393

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 3/133 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTEYR  491
            V++RP L  FLK++ ++  LV+FTA ++ YA P++D ID     + +RL+R S T     
Sbjct  260  VYKRPHLDFFLKKVASWYTLVIFTASMQEYADPVIDWIDAGRGILTKRLFRESCTQAPNG  319

Query  490  EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHL  311
             ++KDL  I  DLSR+ +VDN+P S+ + P NGIP I      P+DE L+D +LP L  L
Sbjct  320  SYMKDLDIIDKDLSRVALVDNSPISYNINPANGIP-ISGWISDPNDEALLD-LLPFLDSL  377

Query  310  SQQEDVRPALNQR  272
                DVR  L  R
Sbjct  378  RFTTDVRRVLGVR  390



>ref|XP_010538232.1| PREDICTED: probable C-terminal domain small phosphatase [Tarenaya 
hassleriana]
Length=255

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 83/136 (61%), Gaps = 4/136 (3%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPGL +FL+++G    + +FTAG+  YA  ++DK+D+++   +RLYR S      
Sbjct  118  VFVVKRPGLDKFLERIGENFKVAIFTAGISEYASQVLDKLDMKHVISQRLYRDSCKEVVT  177

Query  493  REHVKDLSGI-SNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLK  317
             ++VKDLS +  NDL  +++VD+NPFSF L P NG+P  PF      D +LM ++     
Sbjct  178  GKYVKDLSLVEGNDLGNVLMVDDNPFSFSLHPENGLPIKPF-VDDMKDRELMKLV-EFFD  235

Query  316  HLSQQEDVRPALNQRF  269
               Q ED+R A  +RF
Sbjct  236  GCDQYEDMRAA-AKRF  250



>ref|XP_001457501.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK90104.1| unnamed protein product [Paramecium tetraurelia]
Length=289

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 77/130 (59%), Gaps = 3/130 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V  RPG+ +F  QL  F D++L+TA L+ YA P++D ID + + + RL+R S T  + 
Sbjct  90   VFVIVRPGIKQFFDQLNQFYDIILWTASLKEYAMPVMDYIDPDRKAVERLFRDSCTPLK-  148

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
                KDL+ +  DL  +VIVDN+ FSF++ P NG+    F   +   E  ++ ILP L  
Sbjct  149  NGLTKDLTKLGRDLKDVVIVDNSVFSFIMNPENGLKIKDFYFDKFDKE--LETILPFLIW  206

Query  313  LSQQEDVRPA  284
            +SQ  DVRP 
Sbjct  207  ISQLSDVRPV  216



>emb|CDX90211.1| BnaA08g17730D [Brassica napus]
Length=237

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 85/139 (61%), Gaps = 4/139 (3%)
 Frame = -3

Query  691  KPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPS  512
            + +I  + V +RPGL EFL++LG   ++V+FTAGLE YA  ++DKID +    +RLYR S
Sbjct  97   ESEIMPIFVVKRPGLTEFLERLGESFEVVVFTAGLEDYASQVLDKIDRKGVITQRLYRDS  156

Query  511  TTSTEYREHVKDLSG-ISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDV  335
                  R +VKDLS  +  DL  ++IVD+NP S+ LQP NG+P   F      D++LM +
Sbjct  157  CREVNGR-YVKDLSMVVGEDLGSVLIVDDNPSSYSLQPENGVPIKAF-VDDLRDQELMKL  214

Query  334  ILPLLKHLSQQEDVRPALN  278
            +   L+     ED+R A+ 
Sbjct  215  V-EFLEICYMYEDMRDAVQ  232



>ref|XP_006461039.1| hypothetical protein AGABI2DRAFT_68868, partial [Agaricus bisporus 
var. bisporus H97]
 ref|XP_007328033.1| hypothetical protein AGABI1DRAFT_37801, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM80901.1| hypothetical protein AGABI1DRAFT_37801, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKV47389.1| hypothetical protein AGABI2DRAFT_68868, partial [Agaricus bisporus 
var. bisporus H97]
Length=182

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 79/132 (60%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+DV      RL+R S  +   
Sbjct  51   VYVIKRPGVDNFLKKMGEIYEIVVFTASLSKYADPVLDKLDVHKVVTHRLFRESCYNHR-  109

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   ++  +I+DN+P S++  P N +P   +    PHD +L D++ P L  
Sbjct  110  GNYVKDLSQLGRPITDTIILDNSPASYIFHPNNAVPVSSW-FNDPHDTELTDLV-PFLAD  167

Query  313  LSQQEDVRPALN  278
            L+  +DVR  L+
Sbjct  168  LTSVDDVRGVLD  179



>ref|XP_003962166.1| PREDICTED: uncharacterized protein LOC101077160 [Takifugu rubripes]
Length=934

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -3

Query  682  IXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTS  503
            +  V V +RP + EFLK++G   + VLFTA L  YA P+ D +D    F  RL+R S   
Sbjct  797  VHQVYVLKRPHVDEFLKRMGELFECVLFTASLSKYADPVSDMLDTWGAFRNRLFRESCVF  856

Query  502  TEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPL  323
             +   +VKDLS +  DL +++I+DN+P S++ QP N +P + +   +  D +L+D+I P 
Sbjct  857  HKGN-YVKDLSRLGRDLDKVIIIDNSPVSYIFQPENAVPVVSWFDDKS-DTELLDLI-PF  913

Query  322  LKHLSQQEDVRPALNQR  272
             + LSQ +D+ P L ++
Sbjct  914  FERLSQADDIYPFLTEQ  930



>gb|KIO19513.1| hypothetical protein M407DRAFT_16113 [Tulasnella calospora MUT 
4182]
Length=148

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 78/133 (59%), Gaps = 3/133 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTEYR  491
            V++RP +  FLK++ T+  LV+FTA ++ YA P++D +D     + +R +R S T     
Sbjct  15   VYKRPFVDYFLKKVSTWYTLVIFTASMQEYADPVIDWLDAGRGILAKRFFRESCTQLPNG  74

Query  490  EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHL  311
             + KDL+ I +DLSR+ ++DN+P S+     NGIP I      PHDE L+D +LP L  L
Sbjct  75   SYAKDLTIIESDLSRVALLDNSPVSYSSCQANGIP-IEGWTNDPHDEALLD-LLPFLDSL  132

Query  310  SQQEDVRPALNQR  272
                DVR  L  R
Sbjct  133  RFTSDVRRVLGIR  145



>gb|KIY51614.1| NLI interacting factor, partial [Fistulina hepatica ATCC 64428]
Length=145

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 79/134 (59%), Gaps = 3/134 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTEYR  491
            V++RP +  FL+ + T+  LV+FTA ++ YA P++D +D     + RRL+R S T     
Sbjct  10   VYKRPFVDFFLRTVSTWYTLVIFTASMQEYADPVIDWLDAGRGILERRLFRDSCTQLPNG  69

Query  490  EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHL  311
             + KDLS +  DLSR+ +VDN+P S+ +   NGIP I      P+DE L+D +LP+L  L
Sbjct  70   SYTKDLSLVDLDLSRVCLVDNSPVSYRVNEANGIP-IEGWTHDPYDEALLD-LLPVLDSL  127

Query  310  SQQEDVRPALNQRF  269
                DVR  L  R 
Sbjct  128  RFTSDVRRVLGLRI  141



>ref|XP_008371514.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Malus domestica]
Length=288

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 71/110 (65%), Gaps = 5/110 (5%)
 Frame = -3

Query  691  KPKIXYVT----VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRL  524
            +PKI  +     V +RPG+ E L++LG   ++V+FTAGL  YA  ++D++D +     RL
Sbjct  131  RPKIDGIEMNFYVLKRPGVDELLEKLGAMYEVVVFTAGLREYASLVLDRLDRKRAISHRL  190

Query  523  YRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPF  374
            YR +    + +  VKDLSG+  DLSR+VIVD+NP S+L QP N +P  PF
Sbjct  191  YRDACKEVDGK-FVKDLSGLGRDLSRVVIVDDNPNSYLFQPENAVPVRPF  239



>ref|XP_009351769.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Pyrus x bretschneideri]
Length=288

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 71/110 (65%), Gaps = 5/110 (5%)
 Frame = -3

Query  691  KPKIXYVT----VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRL  524
            +PKI  +     V +RPG+ E L++LG   ++V+FTAGL  YA  ++D++D +     RL
Sbjct  131  RPKIDGIEMNFYVLKRPGVDELLEKLGAMYEVVVFTAGLREYASLVLDRLDRKRAISHRL  190

Query  523  YRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPF  374
            YR +    + +  VKDLSG+  DLSR+VIVD+NP S+L QP N +P  PF
Sbjct  191  YRDACKEVDGK-FVKDLSGLGRDLSRVVIVDDNPNSYLFQPENAVPVRPF  239



>emb|CAF98978.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=180

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 82/134 (61%), Gaps = 3/134 (2%)
 Frame = -3

Query  682  IXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTS  503
            I  V V +RP + EFLK++G   + VLFTA L  YA P+ D +D    F +RL+R S   
Sbjct  50   IHQVYVLKRPHVDEFLKRMGELFECVLFTASLSKYADPVSDMLDKWGAFRKRLFRESCVF  109

Query  502  TEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPL  323
             +   +VKDLS +  DL++++I+DN+P S++  P N +P + +   +  D +L+++I P 
Sbjct  110  HQ-GNYVKDLSRLGRDLNKVIIIDNSPVSYIFHPENAVPVVSWFDDK-SDTELLNLI-PF  166

Query  322  LKHLSQQEDVRPAL  281
             + LS+ +D+ P L
Sbjct  167  FERLSKADDIYPFL  180



>ref|XP_009352935.1| PREDICTED: CTD small phosphatase-like protein [Pyrus x bretschneideri]
Length=283

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = -3

Query  691  KPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPS  512
            + KI    V +RPG+ EFL++LG   ++V+FTAGL  YA  ++D++D +     RLYR +
Sbjct  119  RGKIMTFYVVKRPGVDEFLEKLGNKYEVVVFTAGLREYATLVLDRLDRKRVISHRLYRDT  178

Query  511  TTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPF  374
             T    R  VKDLSG+  DLSR+VIVD+NP ++  QP N +P  PF
Sbjct  179  CTEVNGR-FVKDLSGLGRDLSRLVIVDDNPNAYCFQPENAVPIRPF  223



>gb|KFH71123.1| protein phosphatase [Mortierella verticillata NRRL 6337]
Length=337

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 79/132 (60%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++D +DV      RL+R S  + + 
Sbjct  204  VYVIKRPGVDTFLKRMGEIYEVVIFTASLSKYADPVLDMLDVHQVVKHRLFRESCLNHK-  262

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS I  DL   +I+DN+P S++    N +P I      PHD +L+D+I P L  
Sbjct  263  GNYVKDLSVIGRDLKNTIIIDNSPASYIFHQSNAVP-ISSWFNDPHDTELLDLI-PFLAD  320

Query  313  LSQQEDVRPALN  278
            L+  +DV P L+
Sbjct  321  LTVVDDVNPVLD  332



>gb|KFV18538.1| Carboxy-terminal domain RNA polymerase II polypeptide A small 
phosphatase 1, partial [Tauraco erythrolophus]
Length=131

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 76/133 (57%), Gaps = 3/133 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RP + EFL+++G   + VLFTA L  YA P+ D +D    F  RL+R S      
Sbjct  2    VYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHR-  60

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +  DL RI+IVDN+P S++  P N +P   +      D +L+D +LP  + 
Sbjct  61   GNYVKDLSRLGRDLHRIIIVDNSPASYIFHPDNAVPVASWFDNMA-DTELLD-LLPFFER  118

Query  313  LSQQEDVRPALNQ  275
            LS+ EDV   L +
Sbjct  119  LSKVEDVYAVLKK  131



>gb|KFQ94722.1| Carboxy-terminal domain RNA polymerase II polypeptide A small 
phosphatase 1, partial [Nipponia nippon]
Length=131

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 76/133 (57%), Gaps = 3/133 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RP + EFL+++G   + VLFTA L  YA P+ D +D    F  RL+R S      
Sbjct  2    VYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHR-  60

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +  DL RI+IVDN+P S++  P N +P   +      D +L+D +LP  + 
Sbjct  61   GNYVKDLSRLGRDLRRIIIVDNSPASYIFHPDNAVPVASWFDNMA-DTELLD-LLPFFER  118

Query  313  LSQQEDVRPALNQ  275
            LS+ EDV   L +
Sbjct  119  LSKVEDVYAVLKK  131



>gb|KIK67046.1| hypothetical protein GYMLUDRAFT_156868 [Gymnopus luxurians FD-317 
M1]
Length=209

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 81/132 (61%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++D++D+ +    RL+R S  + + 
Sbjct  78   VYVIKRPGVDNFLKKMGELYEIVVFTASLSKYADPVLDRLDIGHTITHRLFRESCYNHK-  136

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   +S  +I+DN+P S++  P N +P   +    PHD +L D++ P L  
Sbjct  137  GNYVKDLSQLGRPISDTIILDNSPASYIFHPNNAVPVSSW-FNDPHDTELTDLV-PFLGD  194

Query  313  LSQQEDVRPALN  278
            L + +DVR  L+
Sbjct  195  LGEVDDVRGVLD  206



>gb|EPT04500.1| hypothetical protein FOMPIDRAFT_1027771 [Fomitopsis pinicola 
FP-58527 SS1]
Length=258

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 78/132 (59%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+DV      RL+R S  +   
Sbjct  127  VYVIKRPGVDNFLKRMGEIYEVVVFTASLSKYADPVLDKLDVHRVVTHRLFRESCYN-HR  185

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   ++  +I+DN+P S++  P N +P   +    PHD +L D + P L  
Sbjct  186  GNYVKDLSQLGRPIADTIIIDNSPASYIFHPNNAVPVSSW-FNDPHDTELTD-LCPFLAD  243

Query  313  LSQQEDVRPALN  278
            L Q +DVR  L+
Sbjct  244  LGQVDDVRGVLD  255



>ref|XP_007266541.1| NLI interacting factor [Fomitiporia mediterranea MF3/22]
 gb|EJD02830.1| NLI interacting factor [Fomitiporia mediterranea MF3/22]
Length=208

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 79/132 (60%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+D+ N    RL+R S  + + 
Sbjct  77   VYVIKRPGVDSFLKKMGEIYEVVVFTASLSKYADPVLDKLDIHNVVAHRLFRESCYNHK-  135

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   +   +I+DN+P S++  P N +P   +    PHD +L D + P L  
Sbjct  136  GNYVKDLSQLGRPIEDTIILDNSPASYIFHPNNAVPVSSW-FNDPHDTELTD-LCPFLAD  193

Query  313  LSQQEDVRPALN  278
            L+  +DVR  L+
Sbjct  194  LATVDDVRGVLD  205



>ref|XP_009985333.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1, partial [Tauraco erythrolophus]
Length=135

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RP + EFL+++G   + VLFTA L  YA P+ D +D    F  RL+R S      
Sbjct  1    VYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHR-  59

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +  DL RI+IVDN+P S++  P N +P   +      D +L+D +LP  + 
Sbjct  60   GNYVKDLSRLGRDLHRIIIVDNSPASYIFHPDNAVPVASWFDNMA-DTELLD-LLPFFER  117

Query  313  LSQQEDVRPALNQR  272
            LS+ EDV   L ++
Sbjct  118  LSKVEDVYAVLKKQ  131



>ref|XP_002985448.1| hypothetical protein SELMODRAFT_5502, partial [Selaginella moellendorffii]
 gb|EFJ13578.1| hypothetical protein SELMODRAFT_5502, partial [Selaginella moellendorffii]
Length=146

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+ EFL+ +    ++V+FTA ++ YA  ++DK+D E     RLYR S  S +  E
Sbjct  48   VAKRPGVDEFLRDMAKLYEIVVFTAAMQYYADKILDKLDPEGLITHRLYRDSCVSCDGGE  107

Query  487  -HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPF  374
              +KDLS +  DL R+VIVD+NP SF LQP NGIP   F
Sbjct  108  TMIKDLSRLGRDLKRVVIVDDNPHSFSLQPRNGIPIPAF  146



>ref|XP_007767400.1| NLI interacting factor [Coniophora puteana RWD-64-598 SS2]
 gb|EIW82362.1| NLI interacting factor [Coniophora puteana RWD-64-598 SS2]
Length=173

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTEYR  491
            V++RP +  FL+++  +  LV+FTA ++ YA P++D +D     + +RL+R S T     
Sbjct  37   VYKRPFVDYFLRKVSGWYTLVIFTASMQEYADPVIDWLDAGRGILAKRLFRESCTVLSNG  96

Query  490  EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHL  311
             ++KDLS I  DLSR+ ++DN+P S+ +   NGIP   ++   P DE L+D +LP+L  L
Sbjct  97   SYIKDLSLIEEDLSRVCLIDNSPISYSINEANGIPIEGWTH-DPSDEALLD-LLPVLDSL  154

Query  310  SQQEDVRPALNQR  272
               +DVR  L  R
Sbjct  155  RFTKDVRRVLGLR  167



>ref|XP_007362124.1| NLI interacting factor [Dichomitus squalens LYAD-421 SS1]
 gb|EJF65488.1| NLI interacting factor [Dichomitus squalens LYAD-421 SS1]
Length=197

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 79/132 (60%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+D+      RL+R S  +   
Sbjct  66   VYVIKRPGVDNFLKKMGEIYEVVVFTASLSKYADPVLDKLDIHRVVSHRLFRESCYNHR-  124

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   ++  +I+DN+P S++  P N +P   +    PHD +L D + P L  
Sbjct  125  GNYVKDLSQLGRPIADTIIIDNSPASYIFHPNNAVPVSSW-FNDPHDTELTD-LCPFLAD  182

Query  313  LSQQEDVRPALN  278
            LS+ +DVR  L+
Sbjct  183  LSEVDDVRGVLD  194



>ref|XP_001427839.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK60441.1| unnamed protein product [Paramecium tetraurelia]
Length=308

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 84/140 (60%), Gaps = 7/140 (5%)
 Frame = -3

Query  676  YVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTE  497
            +VTV  RPG+  FL+QL    D+VL+TA L+ YA P++D ID + R   RLYR S T   
Sbjct  93   FVTV--RPGVETFLEQLSEHFDIVLWTASLKEYADPVIDIIDPQRRIQTRLYRESCTPIR  150

Query  496  YREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLK  317
                 K+L+ +  +L  ++I+DN+  SFL QP NG     F   Q  +++ +D++LP L 
Sbjct  151  -GGLTKNLNKLGRNLKEVLIIDNSQMSFLFQPENGFLIKDFI--QDKNDKELDMLLPFLI  207

Query  316  HLSQQEDVRPA--LNQRFHM  263
             LSQQ DVRP   L Q+F +
Sbjct  208  WLSQQSDVRPVQKLCQQFML  227



>ref|XP_009109641.1| PREDICTED: CTD small phosphatase-like protein [Brassica rapa]
Length=221

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 85/139 (61%), Gaps = 4/139 (3%)
 Frame = -3

Query  691  KPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPS  512
            + +I  + V +RPGL EFL++LG   ++V+FTAGLE YA  ++DKID +    +RLYR S
Sbjct  81   ESEIMPIFVVKRPGLTEFLERLGESFEVVVFTAGLEDYASQVLDKIDRKGVITQRLYRDS  140

Query  511  TTSTEYREHVKDLSG-ISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDV  335
                  R +VKDL+  +  DL  ++IVD+NP S+ LQP NG+P   F      D++LM +
Sbjct  141  CREVNGR-YVKDLAMVVGEDLGSVLIVDDNPSSYALQPENGVPIKAF-VDDLRDQELMKL  198

Query  334  ILPLLKHLSQQEDVRPALN  278
            +   L+     ED+R A+ 
Sbjct  199  V-EFLEISYAYEDMRDAVQ  216



>ref|XP_001877698.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR11801.1| predicted protein, partial [Laccaria bicolor S238N-H82]
Length=182

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+  FLK++G   ++V+FTA L  YA P++DK+D+ +    RL+R S  S +   
Sbjct  53   VLKRPGVDNFLKKMGEIYEVVVFTASLSKYADPVLDKLDIHHVVAHRLFRESCFSHK-GN  111

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
            +VKDLS +   ++  +I+DN+P S++  P N +P   +    PHD +L D+I P L  L+
Sbjct  112  YVKDLSQLGRPIADTIILDNSPASYIFHPNNAVPVSSW-FNDPHDAELTDLI-PFLADLT  169

Query  307  QQEDVRPALN  278
               D+R  L+
Sbjct  170  SVSDIRGILD  179



>ref|XP_002979786.1| hypothetical protein SELMODRAFT_5501, partial [Selaginella moellendorffii]
 gb|EFJ19188.1| hypothetical protein SELMODRAFT_5501, partial [Selaginella moellendorffii]
Length=146

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+ EFL+ +    ++V+FTA ++ YA  ++DK+D E     RLYR S  S +  E
Sbjct  48   VAKRPGVDEFLRDMAKLYEIVVFTAAMQYYADKILDKLDPEGLITHRLYRDSCVSCDGGE  107

Query  487  -HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPF  374
              +KDLS +  DL R+VIVD+NP SF LQP NGIP   F
Sbjct  108  TMIKDLSRLGRDLKRVVIVDDNPHSFSLQPRNGIPIPAF  146



>ref|XP_011462148.1| PREDICTED: CTD small phosphatase-like protein [Fragaria vesca 
subsp. vesca]
Length=352

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 82/140 (59%), Gaps = 8/140 (6%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+ +FL++L    ++V+FTAG+  YA  ++D++D +     RLYR S     Y +
Sbjct  121  VIKRPGVDQFLQKLAEKYEVVVFTAGMREYASLVLDRLDRQGFISHRLYRDSCKEV-YGK  179

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
             VKDLSG+  DL R+VIVD+NP S+ LQ  NGIP  PF  G   D +L      LLK   
Sbjct  180  FVKDLSGLGRDLRRVVIVDDNPNSYFLQSENGIPVRPF-VGDMEDGELGR----LLKFFE  234

Query  307  QQ--EDVRPALNQRFHMPEW  254
             +  ED+R A+ +  +   W
Sbjct  235  GEGSEDIRDAVREYVNDEGW  254



>emb|CCF49449.1| related to PSR1-plasma membrane phosphatase required for sodium 
stress response [Ustilago hordei]
Length=599

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 85/142 (60%), Gaps = 5/142 (4%)
 Frame = -3

Query  703  ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRL  524
            E DG   +  V V +RPG+ EF++Q+G   ++V+FTA L  YA P++D +D+ +    RL
Sbjct  460  EIDGT--VHKVYVIKRPGVDEFMRQMGLIYEVVVFTASLSKYADPVLDMLDIHHSVRHRL  517

Query  523  YRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQL  344
            +R S  +     +VKDLS +  D+ + +I+DN+P S++  P N +P   +    PHD +L
Sbjct  518  FRESCYN-HKGNYVKDLSQLGRDVGKSIIIDNSPASYIFHPNNAVPVSSW-FNDPHDTEL  575

Query  343  MDVILPLLKHLSQQEDVRPALN  278
             D ++P L  L+  +DVR  L+
Sbjct  576  TD-LMPFLADLANVDDVRAVLD  596



>emb|CBJ29851.1| putative nuclear LIM interactor-interacting protein [Ectocarpus 
siliculosus]
Length=324

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 81/139 (58%), Gaps = 7/139 (5%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENR-FIRRLYRPSTTSTEYR  491
            V +RPGL  FL+ L    + ++FTA +  YA P++D ID +   F RRLYR S    +  
Sbjct  54   VNKRPGLDPFLEALARDYNTIVFTAAMPDYAGPVLDYIDPKGTLFHRRLYRSSCRQVK-G  112

Query  490  EHVKDLS--GI-SNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLL  320
              +KDLS  G+ S D+SR V+VDNNP SF+ QP NGI    F    P+D  L  V + L+
Sbjct  113  AFLKDLSVLGVESTDMSRTVLVDNNPLSFICQPTNGILVASFY-DDPNDTALASV-MQLI  170

Query  319  KHLSQQEDVRPALNQRFHM  263
            +HL Q  DVRP L   F +
Sbjct  171  RHLDQAGDVRPILKDMFRL  189



>gb|KIY44365.1| NLI interacting factor [Fistulina hepatica ATCC 64428]
Length=209

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 81/133 (61%), Gaps = 4/133 (3%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+D+      RL+R S  + + 
Sbjct  77   VYVIKRPGVDNFLKRMGEIYEIVVFTASLSKYADPVLDKLDIHQVVSHRLFRESCYNHK-  135

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   +S  +I+DN+P S++  P N +P   +    PHD +L D++ P LK 
Sbjct  136  GNYVKDLSQLGRPISSCIILDNSPASYIFHPNNAVPVSSW-FNDPHDTELTDLV-PFLKD  193

Query  313  LSQQ-EDVRPALN  278
            L +  EDVR  L+
Sbjct  194  LGEDVEDVRGVLD  206



>ref|XP_010790522.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like isoform X2 [Notothenia coriiceps]
Length=262

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 84/144 (58%), Gaps = 5/144 (3%)
 Frame = -3

Query  703  ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRL  524
            E DG   +  V V +RP + EFLK++G   + VLFTA L  YA P+ D +D    F  RL
Sbjct  120  EIDGT--VHQVYVLKRPHVDEFLKRMGELFECVLFTASLSKYADPVSDLLDKWGAFRYRL  177

Query  523  YRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQL  344
            +R S    +   +VKDLS I  DL++++I+DN+P S++  P N +P + +      D +L
Sbjct  178  FRESCVFHK-GNYVKDLSRIGRDLNKVIIIDNSPASYVFHPDNAVPVVSWFDDM-SDTEL  235

Query  343  MDVILPLLKHLSQQEDVRPALNQR  272
            +D+I P  + LS+ EDV   L Q+
Sbjct  236  LDLI-PFFERLSKVEDVYEVLQQQ  258



>gb|KIM68582.1| hypothetical protein SCLCIDRAFT_104632, partial [Scleroderma 
citrinum Foug A]
Length=168

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 80/133 (60%), Gaps = 3/133 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTEYR  491
            V++RP +  FL+++ ++  LV+FTA ++ YA P++D +D  +  + RRL+R S T     
Sbjct  34   VYKRPFVDYFLRKVSSWYTLVVFTASMQEYADPVIDWLDAGHGILTRRLFRESCTLLPNG  93

Query  490  EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHL  311
             + KDLS +  DLSR+ +VDN+P S+ +   NGIP I      P DE L+D +LP+L  L
Sbjct  94   SYTKDLSVVEQDLSRVCLVDNSPISYRVNQANGIP-IEGWTHDPSDEALLD-LLPILDSL  151

Query  310  SQQEDVRPALNQR  272
                DVR  L  R
Sbjct  152  RFTSDVRRVLGLR  164



>ref|NP_001043640.2| Os01g0629400 [Oryza sativa Japonica Group]
 dbj|BAF05554.2| Os01g0629400, partial [Oryza sativa Japonica Group]
Length=177

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 84/137 (61%), Gaps = 4/137 (3%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYRPSTTSTE  497
            V V +RP L  FL+++    DLV+FTA    YA  L+D++D + R I  R+YR S   +E
Sbjct  38   VYVRQRPHLKMFLEKVAQMFDLVIFTASQRIYAEQLIDRLDPDGRLISHRIYRESCIFSE  97

Query  496  YREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLK  317
               + KDL+ +  DL+++VIVDN P  F LQ  NGIP I      P D++L++ +LP L+
Sbjct  98   -GCYTKDLTILGVDLAKVVIVDNTPQVFQLQVDNGIP-IKSWFDDPSDQELVE-LLPFLE  154

Query  316  HLSQQEDVRPALNQRFH  266
             L   EDVRP +++ FH
Sbjct  155  TLVGVEDVRPIISKTFH  171



>ref|XP_002683148.1| CTD phosphatase [Naegleria gruberi]
 gb|EFC50404.1| CTD phosphatase [Naegleria gruberi]
Length=311

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 83/132 (63%), Gaps = 1/132 (1%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V ERP L  F++++  + ++V+FTA ++ YA P++D++   ++ ++RL+R S   TE+  
Sbjct  178  VSERPHLKLFMEKVCEWYNVVIFTASVKNYANPVIDRLYHSDKIVKRLFRSSCYVTEHGV  237

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
            +VKDL  +++DLS+ +I+DN+P S++    N IP   +      D  L++ +LP L+ + 
Sbjct  238  YVKDLKTVTDDLSKCMIIDNSPISYMWYQENAIPISNWMGDNERDRALLN-LLPFLEAMR  296

Query  307  QQEDVRPALNQR  272
              EDV+  L+ R
Sbjct  297  HLEDVKSILSFR  308



>ref|XP_002128680.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Ciona intestinalis]
Length=312

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 83/141 (59%), Gaps = 5/141 (4%)
 Frame = -3

Query  703  ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRL  524
            E DG   +  V V +RP + E+LK++G   + VLFTA L  YA P+ D +D    F  RL
Sbjct  149  EIDGT--VHQVYVLKRPHVDEYLKRMGEMFECVLFTASLAKYADPVSDLLDKSGVFSSRL  206

Query  523  YRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQL  344
            +R S        +VKDLS I  DL++++I+DN+P S++  P N +P I +    P D +L
Sbjct  207  FRESCV-FHRGNYVKDLSLIGRDLNKVIIIDNSPASYIFHPDNAVPVISW-FDDPTDTEL  264

Query  343  MDVILPLLKHLSQQEDVRPAL  281
            +D +LP L+ +++ EDV   L
Sbjct  265  LD-LLPFLEAIAESEDVYSVL  284



>ref|XP_001439574.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK72177.1| unnamed protein product [Paramecium tetraurelia]
Length=596

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 82/131 (63%), Gaps = 3/131 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V  RP    FL+Q+G   ++V+FTAG++ YA  ++DKIDV N    RLYR  T S +   
Sbjct  457  VLIRPYTEIFLEQMGKHFEIVIFTAGIQSYADKIIDKIDVMNVVKHRLYRHHTFS-QGNV  515

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
             +KDLS +   LS+ +IVDNNP++F+LQP NGI  I    G   D  L++++  L+K L+
Sbjct  516  MLKDLSTLGRPLSKTIIVDNNPYNFVLQPHNGIK-IKAWVGDEKDRALVELMQYLIK-LT  573

Query  307  QQEDVRPALNQ  275
            + ED+R  L +
Sbjct  574  KYEDIRIGLKE  584



>gb|KIL68965.1| hypothetical protein M378DRAFT_184815 [Amanita muscaria Koide 
BX008]
Length=254

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 81/132 (61%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+D+ +    RL+R S  + + 
Sbjct  123  VYVIKRPGVDNFLKRMGEIYEVVVFTASLSKYADPVLDKLDIHHVVSHRLFRESCYNHK-  181

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   +S  +I+DN+P S++  P N +P   +    PHD +L D++ P L  
Sbjct  182  GNYVKDLSQLGRPISDTIILDNSPASYIFHPNNAVPVSSW-FNDPHDTELTDLV-PFLAD  239

Query  313  LSQQEDVRPALN  278
            L+  +DVR  L+
Sbjct  240  LATADDVRGVLD  251



>ref|XP_002991478.1| hypothetical protein SELMODRAFT_133639, partial [Selaginella 
moellendorffii]
 gb|EFJ07400.1| hypothetical protein SELMODRAFT_133639, partial [Selaginella 
moellendorffii]
Length=219

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 79/134 (59%), Gaps = 3/134 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKID-VENRFIRRLYRPSTTSTEYR  491
            V +RPG++ FL ++    ++V+FT  ++ YA  ++D++D V N F  RLYR S  + E R
Sbjct  38   VAKRPGVNTFLDEMSKIYEIVVFTRVVKPYADRILDRLDPVGNLFTHRLYRDSCLTKEVR  97

Query  490  --EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLK  317
              + VKDLS +  DL   VIVD+ P SF LQP NGI    F   + H    +  I  LLK
Sbjct  98   GRKVVKDLSRLGRDLRHTVIVDDKPESFCLQPNNGIVIRAFKNRKGHKYDELKTISNLLK  157

Query  316  HLSQQEDVRPALNQ  275
             +++ ED+R AL +
Sbjct  158  EIARVEDIRQALEK  171



>ref|XP_001783372.1| predicted protein [Physcomitrella patens]
 gb|EDQ51817.1| predicted protein [Physcomitrella patens]
Length=182

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 81/138 (59%), Gaps = 3/138 (2%)
 Frame = -3

Query  685  KIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTT  506
            +I  V V +RP +  FL+ +    ++V+FTA L  YA PL+D +D EN    RLYR S  
Sbjct  46   RITTVYVLKRPYVDRFLQAVSQKFEVVVFTASLRKYADPLLDVLDRENLVQYRLYRNSCR  105

Query  505  STEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILP  326
              +    VKDLS +   LS+ +IVDNNP S+LLQP N IP   +    PHD++L+D+I  
Sbjct  106  PMQ-GGFVKDLSRLGRPLSKTIIVDNNPHSYLLQPHNAIPISTY-IDNPHDQELLDLI-D  162

Query  325  LLKHLSQQEDVRPALNQR  272
             L ++   E+V  A+  R
Sbjct  163  YLDNIDLFENVTTAIASR  180



>ref|XP_002191656.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1 [Taeniopygia guttata]
Length=168

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RP + EFLK++G   + VLFTA L  YA P+ D +D    F  RL+R S      
Sbjct  34   VYVLKRPHVDEFLKRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCV-FHR  92

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +  DL RI+IVDN+P S++  P N +P   +      D +L+D +LP  + 
Sbjct  93   GNYVKDLSRLGRDLRRIIIVDNSPASYIFHPDNAVPVASWFDNMA-DTELLD-LLPFFER  150

Query  313  LSQQEDVRPALNQR  272
            LS+ EDV   L ++
Sbjct  151  LSKVEDVYAVLKKQ  164



>gb|EIE92518.1| hypothetical protein RO3G_17116 [Rhizopus delemar RA 99-880]
Length=224

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 82/136 (60%), Gaps = 5/136 (4%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+ EF+K++    ++V+FTA L  YA P++D  D+      RL+R +  +  Y
Sbjct  92   VFVLKRPGVDEFMKRMSELYEIVIFTASLSKYADPVLDNFDLHKVIQHRLFREACCN--Y  149

Query  493  R-EHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLK  317
            R   +KDLS +  DL+ +VI+DN P S+ L P N IP   +   Q HD +L+D+I P L+
Sbjct  150  RGGFIKDLSRLGRDLNHVVILDNTPASYSLHPSNAIPISTWFNDQ-HDSELLDLI-PFLE  207

Query  316  HLSQQEDVRPALNQRF  269
             L++ ++V   LN  F
Sbjct  208  DLAKVDNVVEVLNISF  223



>ref|XP_006636766.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1-like [Lepisosteus oculatus]
Length=264

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 82/144 (57%), Gaps = 5/144 (3%)
 Frame = -3

Query  703  ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRL  524
            E DG   +  V V +RP + EFLK++G   + VLFTA L  YA P+ D +D    F  RL
Sbjct  122  EIDGT--VHQVYVLKRPHVDEFLKRMGELFECVLFTASLAKYADPVADLLDKWGAFRSRL  179

Query  523  YRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQL  344
            +R S        +VKDLS +  DL++I+IVDN+P S++  P N +P   +      D +L
Sbjct  180  FRESCV-FHRGNYVKDLSRLGRDLNKIIIVDNSPASYIFHPDNAVPVASWFDDM-SDTEL  237

Query  343  MDVILPLLKHLSQQEDVRPALNQR  272
            +D+I P  + LS+ EDV   L Q+
Sbjct  238  LDLI-PFFERLSKVEDVYTVLKQQ  260



>gb|AAV63937.1| putative nuclear LIM factor interactor-interacting protein spore-specific 
form [Phytophthora infestans]
Length=297

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 78/143 (55%), Gaps = 9/143 (6%)
 Frame = -3

Query  682  IXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTS  503
            + +V V +RPG  EFL ++  + ++V++TA L  YA PL+DK+D E     RLYR     
Sbjct  160  VHHVYVCKRPGAEEFLIEMAKYYEIVIYTASLSKYADPLLDKLDPEGTIRYRLYREHCVQ  219

Query  502  TEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPL  323
             E   +VKDLS +  D+++++IVDN+P ++   P N I C  F    P+D +L D I   
Sbjct  220  YE-GSYVKDLSLLDRDITQMIIVDNSPMAYAFHPRNAIGCSSF-IDDPNDREL-DSIARF  276

Query  322  LKHLSQQEDVRPALNQRFHMPEW  254
            L      EDVR       HM  W
Sbjct  277  LTKFQDVEDVRN------HMQLW  293



>ref|XP_007381158.1| NLI interacting factor [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN11631.1| NLI interacting factor [Punctularia strigosozonata HHB-11173 
SS5]
Length=184

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 78/132 (59%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+DV      RL+R S  +   
Sbjct  53   VYVIKRPGVDAFLKKMGEIYEIVVFTASLSKYADPVLDKLDVHRVVTHRLFRESCYNHR-  111

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   ++  +I+DN+P S++  P N +P   +    PHD +L D + P L  
Sbjct  112  GSYVKDLSQLGRPIADTIILDNSPASYIFHPNNAVPVSSW-FNDPHDTELTD-LCPFLAD  169

Query  313  LSQQEDVRPALN  278
            L+  +DVR  L+
Sbjct  170  LATVDDVRGVLD  181



>gb|KJA29065.1| hypothetical protein HYPSUDRAFT_128731 [Hypholoma sublateritium 
FD-334 SS-4]
Length=200

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 78/130 (60%), Gaps = 3/130 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+  FLKQ+G   ++V+FTA L  YA P++DK+D+      RL+R S  + +   
Sbjct  71   VLKRPGVDNFLKQMGEIYEVVIFTASLSKYADPVLDKLDIHRVVAHRLFRESCFNHK-GN  129

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
            +VKDLS +   ++  +I+DN+P S++  P N +P   +    PHD +L D+I P L  L+
Sbjct  130  YVKDLSQLGRPIADTIILDNSPASYIFHPNNAVPVSSW-FNDPHDAELTDLI-PFLADLT  187

Query  307  QQEDVRPALN  278
               DVR  L+
Sbjct  188  AVPDVRGILD  197



>gb|KDQ27827.1| hypothetical protein PLEOSDRAFT_1056370 [Pleurotus ostreatus 
PC15]
Length=206

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 79/132 (60%), Gaps = 3/132 (2%)
 Frame = -3

Query  673  VTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEY  494
            V V +RPG+  FLK++G   ++V+FTA L  YA P++DK+D+      RL+R S  + + 
Sbjct  75   VYVIKRPGVDNFLKKMGEIYEVVVFTASLSKYADPVLDKLDIHQVVSHRLFRESCYNHK-  133

Query  493  REHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKH  314
              +VKDLS +   +   +I+DN+P S++  P N +P   +    PHD +L D++ P L  
Sbjct  134  GNYVKDLSQLGRPIGDTIILDNSPASYIFHPNNAVPVSSW-FNDPHDTELTDLV-PFLTD  191

Query  313  LSQQEDVRPALN  278
            LS  +DVR  L+
Sbjct  192  LSTVDDVRGVLD  203



>ref|XP_006461036.1| hypothetical protein AGABI2DRAFT_185336 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV47386.1| hypothetical protein AGABI2DRAFT_185336 [Agaricus bisporus var. 
bisporus H97]
Length=273

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+ EFL+++G   ++V+FTA L  YA P++DK+D+      RL+R S  S +   
Sbjct  144  VLKRPGVDEFLRKMGEIYEVVIFTASLSKYADPVLDKLDIHRVVAHRLFRESCFSHK-GN  202

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
            +VKDLS +   +S  +I+DN+P S++  P N +P   +    PHD +L D+I P L  L+
Sbjct  203  YVKDLSQLGRPISDTIILDNSPASYIFHPHNAVPVSSW-FNDPHDAELTDLI-PFLADLT  260

Query  307  QQEDVRPALN  278
               DVR  L+
Sbjct  261  GVSDVRGILD  270



>ref|XP_008933692.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide 
A small phosphatase 1, partial [Merops nubicus]
Length=222

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 80/144 (56%), Gaps = 3/144 (2%)
 Frame = -3

Query  703  ECDGKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRL  524
            E DG      V V +RP + EFL+++G   + VLFTA L  YA P+ D +D    F  RL
Sbjct  78   EIDGVMNPHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARL  137

Query  523  YRPSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQL  344
            +R S        +VKDLS +  DL RI+IVDN+P S++  P N +P   +      D +L
Sbjct  138  FRESCV-FHRGNYVKDLSRLGRDLRRIIIVDNSPASYIFHPDNAVPVASWFDNMA-DTEL  195

Query  343  MDVILPLLKHLSQQEDVRPALNQR  272
            +D +LP  + LS+ EDV   L ++
Sbjct  196  LD-LLPFFERLSKVEDVYAVLKKQ  218



>ref|XP_007328072.1| hypothetical protein AGABI1DRAFT_56063 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM80898.1| hypothetical protein AGABI1DRAFT_56063 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=271

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = -3

Query  667  VFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTSTEYRE  488
            V +RPG+ EFL+++G   ++V+FTA L  YA P++DK+D+      RL+R S  S +   
Sbjct  142  VLKRPGVDEFLRKMGEIYEVVIFTASLSKYADPVLDKLDIHRVVAHRLFRESCFSHK-GN  200

Query  487  HVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPLLKHLS  308
            +VKDLS +   +S  +I+DN+P S++  P N +P   +    PHD +L D+I P L  L+
Sbjct  201  YVKDLSQLGRPISDTIILDNSPASYIFHPHNAVPVSSW-FNDPHDAELTDLI-PFLADLT  258

Query  307  QQEDVRPALN  278
               DVR  L+
Sbjct  259  GVSDVRGILD  268



>ref|XP_002902000.1| nuclear LIM factor interactor-interacting protein spore-specific 
form, putative [Phytophthora infestans T30-4]
 gb|EEY57390.1| nuclear LIM factor interactor-interacting protein spore-specific 
form, putative [Phytophthora infestans T30-4]
Length=261

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 79/147 (54%), Gaps = 9/147 (6%)
 Frame = -3

Query  682  IXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFIRRLYRPSTTS  503
            + +V V +RPG  EFL ++  + ++V++TA L  YA PL+DK+D E     RLYR     
Sbjct  124  VHHVYVCKRPGAEEFLIEMAKYYEIVIYTASLSKYADPLLDKLDPEGTIRYRLYREHCVQ  183

Query  502  TEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMDVILPL  323
             E   +VKDLS +  D+++++IVDN+P ++   P N I C  F    P+D +L D I   
Sbjct  184  YE-GSYVKDLSLLDRDITQMIIVDNSPMAYAFHPRNAIGCSSF-IDDPNDREL-DSIARF  240

Query  322  LKHLSQQEDVRPALNQRFHMPEWXEKH  242
            L      EDVR       HM  W   +
Sbjct  241  LTKFQDVEDVRN------HMQLWDANY  261



>gb|KDO71957.1| hypothetical protein CISIN_1g0212542mg, partial [Citrus sinensis]
Length=164

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 85/147 (58%), Gaps = 4/147 (3%)
 Frame = -3

Query  694  GKPKIXYVTVFERPGLHEFLKQLGTFADLVLFTAGLEGYARPLVDKIDVENRFI-RRLYR  518
             K ++  V V +RP LH FL+ + +  D+V+FTAG   YA  L+D +D     I +R+YR
Sbjct  21   SKMEVQTVFVRQRPYLHMFLEAVASMFDVVIFTAGQSIYAGQLLDILDPNQTLIGQRVYR  80

Query  517  PSTTSTEYREHVKDLSGISNDLSRIVIVDNNPFSFLLQPLNGIPCIPFSAGQPHDEQLMD  338
             S    +  E++KDL+ +  DL+RI IVDN P  F LQ  NGIP I    G P D  L+ 
Sbjct  81   DSCVFAD-GEYLKDLTILGRDLARIAIVDNTPQVFQLQVDNGIP-IESWFGDPSDSALLS  138

Query  337  VILPLLKHLSQQEDVRPALNQRFHMPE  257
            +++  L+ L   +DVRP + Q++   E
Sbjct  139  LLM-FLETLVGADDVRPIIKQKYGSQE  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050