BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020N13

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626166.1|  PREDICTED: serine carboxypeptidase-like 20         315   5e-101   Nicotiana tomentosiformis
ref|XP_009785823.1|  PREDICTED: serine carboxypeptidase-like 20         310   3e-99    Nicotiana sylvestris
gb|ACJ85811.1|  unknown                                                 302   7e-99    Medicago truncatula
ref|XP_010251666.1|  PREDICTED: serine carboxypeptidase-like 20         311   8e-99    Nelumbo nucifera [Indian lotus]
emb|CBI35583.3|  unnamed protein product                                308   2e-98    Vitis vinifera
ref|XP_002264454.2|  PREDICTED: serine carboxypeptidase 1               307   4e-98    Vitis vinifera
gb|KCW57985.1|  hypothetical protein EUGRSUZ_H00716                     306   2e-97    Eucalyptus grandis [rose gum]
gb|KDP45241.1|  hypothetical protein JCGZ_15106                         305   2e-97    Jatropha curcas
gb|KHG18698.1|  Serine carboxypeptidase-like 20                         305   2e-97    Gossypium arboreum [tree cotton]
gb|KJB42610.1|  hypothetical protein B456_007G160000                    305   3e-97    Gossypium raimondii
ref|XP_004242440.1|  PREDICTED: serine carboxypeptidase-like 20         304   6e-97    Solanum lycopersicum
gb|KCW57986.1|  hypothetical protein EUGRSUZ_H00716                     304   8e-97    Eucalyptus grandis [rose gum]
ref|XP_010069589.1|  PREDICTED: serine carboxypeptidase-like 20         304   9e-97    Eucalyptus grandis [rose gum]
ref|XP_007049587.1|  Serine carboxypeptidase-like 20 isoform 1          303   2e-96    
ref|XP_002527263.1|  serine carboxypeptidase, putative                  302   4e-96    Ricinus communis
emb|CDP03970.1|  unnamed protein product                                302   4e-96    Coffea canephora [robusta coffee]
gb|KCW57988.1|  hypothetical protein EUGRSUZ_H00717                     301   5e-96    Eucalyptus grandis [rose gum]
ref|XP_003626861.1|  Serine carboxypeptidase-like protein               302   5e-96    Medicago truncatula
ref|XP_010245947.1|  PREDICTED: serine carboxypeptidase 1               301   1e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010026006.1|  PREDICTED: serine carboxypeptidase-like 20         301   1e-95    Eucalyptus grandis [rose gum]
ref|XP_006447985.1|  hypothetical protein CICLE_v10014996mg             301   1e-95    Citrus clementina [clementine]
gb|KDO58562.1|  hypothetical protein CISIN_1g010880mg                   301   1e-95    Citrus sinensis [apfelsine]
ref|XP_004510209.1|  PREDICTED: serine carboxypeptidase-like 20-like    300   2e-95    Cicer arietinum [garbanzo]
ref|XP_004242437.1|  PREDICTED: serine carboxypeptidase-like 20         300   2e-95    Solanum lycopersicum
ref|XP_006352654.1|  PREDICTED: serine carboxypeptidase-like 20-like    299   5e-95    Solanum tuberosum [potatoes]
emb|CAN64572.1|  hypothetical protein VITISV_010382                     298   6e-95    Vitis vinifera
ref|XP_006366824.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    299   9e-95    
gb|KCW57984.1|  hypothetical protein EUGRSUZ_H00716                     298   1e-94    Eucalyptus grandis [rose gum]
ref|XP_011089617.1|  PREDICTED: serine carboxypeptidase 1               298   2e-94    Sesamum indicum [beniseed]
gb|EYU40664.1|  hypothetical protein MIMGU_mgv1a004824mg                298   3e-94    Erythranthe guttata [common monkey flower]
ref|XP_006366825.1|  PREDICTED: serine carboxypeptidase-like 20-like    297   4e-94    Solanum tuberosum [potatoes]
gb|KGN66663.1|  hypothetical protein Csa_1G654920                       290   7e-94    Cucumis sativus [cucumbers]
gb|KCW57982.1|  hypothetical protein EUGRSUZ_H00716                     295   1e-93    Eucalyptus grandis [rose gum]
gb|KCW57981.1|  hypothetical protein EUGRSUZ_H00716                     295   2e-93    Eucalyptus grandis [rose gum]
gb|KCW57980.1|  hypothetical protein EUGRSUZ_H00716                     295   2e-93    Eucalyptus grandis [rose gum]
ref|XP_010069585.1|  PREDICTED: serine carboxypeptidase-like 20         295   2e-93    Eucalyptus grandis [rose gum]
ref|XP_010678976.1|  PREDICTED: serine carboxypeptidase-like 20         295   4e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006366830.1|  PREDICTED: serine carboxypeptidase-like 20-like    295   4e-93    Solanum tuberosum [potatoes]
gb|AFK43580.1|  unknown                                                 283   5e-93    Lotus japonicus
ref|XP_002321240.1|  serine carboxypeptidase S10 family protein         294   6e-93    Populus trichocarpa [western balsam poplar]
ref|XP_004170750.1|  PREDICTED: serine carboxypeptidase 1-like          291   6e-93    
ref|XP_007205172.1|  hypothetical protein PRUPE_ppa005545mg             292   8e-93    
ref|XP_008218456.1|  PREDICTED: serine carboxypeptidase-like 20         293   2e-92    Prunus mume [ume]
ref|XP_011009329.1|  PREDICTED: serine carboxypeptidase-like 20         292   2e-92    Populus euphratica
ref|NP_001234691.1|  wound-inducible carboxypeptidase precursor         292   3e-92    
ref|XP_008443686.1|  PREDICTED: serine carboxypeptidase 1-like is...    290   5e-92    
ref|XP_008443685.1|  PREDICTED: serine carboxypeptidase 1-like is...    291   9e-92    Cucumis melo [Oriental melon]
ref|XP_004139101.1|  PREDICTED: serine carboxypeptidase 1-like          291   1e-91    Cucumis sativus [cucumbers]
gb|AFK39478.1|  unknown                                                 283   1e-91    Lotus japonicus
ref|XP_010095610.1|  Serine carboxypeptidase-like 20                    290   3e-91    Morus notabilis
ref|XP_008794935.1|  PREDICTED: serine carboxypeptidase 1-like          289   4e-91    Phoenix dactylifera
ref|XP_008235895.1|  PREDICTED: serine carboxypeptidase-like 20         288   1e-90    Prunus mume [ume]
ref|XP_007199794.1|  hypothetical protein PRUPE_ppa004538mg             288   1e-90    Prunus persica
ref|XP_007134260.1|  hypothetical protein PHAVU_010G032200g             287   3e-90    Phaseolus vulgaris [French bean]
ref|XP_006414998.1|  hypothetical protein EUTSA_v10025701mg             281   4e-90    
ref|XP_003547759.1|  PREDICTED: serine carboxypeptidase-like 20-l...    285   1e-89    
ref|XP_009416609.1|  PREDICTED: serine carboxypeptidase 1-like          284   4e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003552449.1|  PREDICTED: serine carboxypeptidase-like 20-l...    283   8e-89    Glycine max [soybeans]
ref|XP_004290128.1|  PREDICTED: serine carboxypeptidase-like 20         283   1e-88    Fragaria vesca subsp. vesca
ref|XP_006283616.1|  hypothetical protein CARUB_v10004672mg             282   2e-88    Capsella rubella
gb|AFK43037.1|  unknown                                                 271   3e-88    Medicago truncatula
ref|XP_004492844.1|  PREDICTED: serine carboxypeptidase-like 20-like    281   4e-88    Cicer arietinum [garbanzo]
ref|XP_010649230.1|  PREDICTED: serine carboxypeptidase-like 20         281   4e-88    Vitis vinifera
ref|XP_006847478.1|  hypothetical protein AMTR_s00163p00053930          282   4e-88    
emb|CBI17613.3|  unnamed protein product                                281   5e-88    Vitis vinifera
gb|AAM97031.1|  serine carboxypeptidase 1 precursor-like protein        280   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193027.5|  serine carboxypeptidase-like 20                       280   1e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009358971.1|  PREDICTED: serine carboxypeptidase-like 20 i...    280   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_006428612.1|  hypothetical protein CICLE_v10013875mg             280   1e-87    
gb|KHN40479.1|  Serine carboxypeptidase-like 20                         280   1e-87    Glycine soja [wild soybean]
ref|XP_006480515.1|  PREDICTED: serine carboxypeptidase-like 20-like    280   2e-87    Citrus sinensis [apfelsine]
ref|XP_010435332.1|  PREDICTED: serine carboxypeptidase-like 20         279   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_006366827.1|  PREDICTED: serine carboxypeptidase-like 20-like    279   3e-87    Solanum tuberosum [potatoes]
gb|KDP26878.1|  hypothetical protein JCGZ_18036                         279   4e-87    Jatropha curcas
ref|XP_008365929.1|  PREDICTED: serine carboxypeptidase-like 20         279   4e-87    
ref|XP_010649231.1|  PREDICTED: serine carboxypeptidase-like 20 i...    278   8e-87    Vitis vinifera
ref|XP_003624187.1|  Serine carboxypeptidase-like protein               278   8e-87    Medicago truncatula
ref|XP_010649232.1|  PREDICTED: serine carboxypeptidase-like 20 i...    278   9e-87    
emb|CBI17614.3|  unnamed protein product                                278   2e-86    Vitis vinifera
gb|KHN29264.1|  Serine carboxypeptidase-like 20                         276   2e-86    Glycine soja [wild soybean]
tpg|DAA55429.1|  TPA: hypothetical protein ZEAMMB73_969275              270   3e-86    
ref|XP_010111090.1|  Serine carboxypeptidase-like 20                    276   3e-86    Morus notabilis
ref|XP_003534508.1|  PREDICTED: serine carboxypeptidase-like 20-like    277   3e-86    Glycine max [soybeans]
ref|XP_010323102.1|  PREDICTED: serine carboxypeptidase-like 20         276   4e-86    Solanum lycopersicum
ref|XP_009334243.1|  PREDICTED: serine carboxypeptidase-like 20         276   5e-86    Pyrus x bretschneideri [bai li]
ref|XP_009340398.1|  PREDICTED: serine carboxypeptidase-like 20         275   1e-85    Pyrus x bretschneideri [bai li]
ref|XP_009340341.1|  PREDICTED: serine carboxypeptidase-like 20         275   1e-85    
gb|KFK23486.1|  hypothetical protein AALP_AAs46213U000900               275   1e-85    Arabis alpina [alpine rockcress]
ref|XP_008451218.1|  PREDICTED: serine carboxypeptidase-like 20         274   2e-85    Cucumis melo [Oriental melon]
ref|XP_009139654.1|  PREDICTED: serine carboxypeptidase-like 20         274   3e-85    Brassica rapa
ref|XP_007139719.1|  hypothetical protein PHAVU_008G053600g             274   3e-85    Phaseolus vulgaris [French bean]
ref|XP_008370931.1|  PREDICTED: serine carboxypeptidase-like 20         274   5e-85    
gb|AGV54426.1|  serine carboxypeptidase-like protein                    273   5e-85    Phaseolus vulgaris [French bean]
dbj|BAB01313.1|  serine carboxypeptidase I                              273   8e-85    Arabidopsis thaliana [mouse-ear cress]
sp|Q9LSV8.2|SCP21_ARATH  RecName: Full=Serine carboxypeptidase-li...    273   9e-85    Arabidopsis thaliana [mouse-ear cress]
emb|CDY27895.1|  BnaA07g04850D                                          273   9e-85    Brassica napus [oilseed rape]
ref|XP_009102414.1|  PREDICTED: serine carboxypeptidase-like 21         273   1e-84    Brassica rapa
emb|CDY00837.1|  BnaCnng00370D                                          273   1e-84    
ref|XP_004148941.1|  PREDICTED: serine carboxypeptidase-like 20-like    272   1e-84    Cucumis sativus [cucumbers]
ref|XP_011013065.1|  PREDICTED: serine carboxypeptidase 1-like is...    270   2e-84    Populus euphratica
ref|XP_004302166.1|  PREDICTED: serine carboxypeptidase-like 20         272   3e-84    Fragaria vesca subsp. vesca
ref|XP_006418631.1|  hypothetical protein EUTSA_v10002940mg             271   3e-84    
gb|KHG03245.1|  Serine carboxypeptidase 1                               270   7e-84    Gossypium arboreum [tree cotton]
ref|XP_002514836.1|  serine carboxypeptidase, putative                  270   8e-84    
gb|EMS65217.1|  Serine carboxypeptidase 1                               267   1e-83    Triticum urartu
ref|XP_008388814.1|  PREDICTED: serine carboxypeptidase-like 20         270   1e-83    
ref|XP_011013064.1|  PREDICTED: serine carboxypeptidase-like 20 i...    270   2e-83    Populus euphratica
gb|ACN29329.1|  unknown                                                 270   2e-83    Zea mays [maize]
ref|NP_001149341.1|  serine carboxypeptidase 1 precursor                270   2e-83    
ref|XP_010527287.1|  PREDICTED: serine carboxypeptidase-like 20 i...    269   2e-83    Tarenaya hassleriana [spider flower]
ref|XP_010070328.1|  PREDICTED: serine carboxypeptidase-like 21         269   3e-83    
gb|KDP26877.1|  hypothetical protein JCGZ_18035                         268   3e-83    Jatropha curcas
ref|XP_010527286.1|  PREDICTED: serine carboxypeptidase-like 20 i...    268   4e-83    Tarenaya hassleriana [spider flower]
ref|XP_006366826.1|  PREDICTED: serine carboxypeptidase-like 20-like    268   4e-83    Solanum tuberosum [potatoes]
ref|XP_006299687.1|  hypothetical protein CARUB_v10015878mg             263   5e-83    
ref|XP_010527284.1|  PREDICTED: serine carboxypeptidase-like 20 i...    268   5e-83    Tarenaya hassleriana [spider flower]
ref|XP_003578731.1|  PREDICTED: serine carboxypeptidase 1               268   8e-83    Brachypodium distachyon [annual false brome]
gb|KJB26857.1|  hypothetical protein B456_004G263400                    268   9e-83    Gossypium raimondii
ref|XP_007029289.1|  Serine carboxypeptidase-like 20 isoform 1          267   2e-82    
gb|AAA32940.1|  carboxypeptidase I precursor                            264   2e-82    Hordeum vulgare [barley]
ref|XP_010466954.1|  PREDICTED: serine carboxypeptidase-like 21 i...    267   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010466953.1|  PREDICTED: serine carboxypeptidase-like 21 i...    267   2e-82    
ref|XP_010466955.1|  PREDICTED: serine carboxypeptidase-like 21 i...    266   2e-82    Camelina sativa [gold-of-pleasure]
gb|ABR17809.1|  unknown                                                 266   5e-82    Picea sitchensis
ref|XP_002325905.2|  hypothetical protein POPTR_0019s08160g             266   5e-82    
ref|XP_002443027.1|  hypothetical protein SORBIDRAFT_08g006540          265   1e-81    Sorghum bicolor [broomcorn]
ref|XP_010514125.1|  PREDICTED: serine carboxypeptidase-like 21         265   1e-81    
ref|XP_004960778.1|  PREDICTED: serine carboxypeptidase 1-like          265   1e-81    Setaria italica
ref|XP_004515043.1|  PREDICTED: serine carboxypeptidase-like 20-like    265   1e-81    Cicer arietinum [garbanzo]
dbj|BAJ95123.1|  predicted protein                                      264   3e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P07519.4|CBP1_HORVU  RecName: Full=Serine carboxypeptidase 1; ...    264   3e-81    Hordeum vulgare [barley]
ref|XP_010557747.1|  PREDICTED: serine carboxypeptidase-like 20         263   4e-81    Tarenaya hassleriana [spider flower]
ref|XP_010520852.1|  PREDICTED: serine carboxypeptidase-like 20 i...    263   4e-81    Tarenaya hassleriana [spider flower]
ref|NP_189169.1|  serine carboxypeptidase-like 21                       263   5e-81    
ref|XP_010527288.1|  PREDICTED: serine carboxypeptidase-like 20         263   6e-81    Tarenaya hassleriana [spider flower]
ref|XP_010520851.1|  PREDICTED: serine carboxypeptidase-like 20 i...    264   7e-81    Tarenaya hassleriana [spider flower]
ref|XP_002514833.1|  serine carboxypeptidase, putative                  261   2e-80    
ref|XP_002443031.1|  hypothetical protein SORBIDRAFT_08g006610          251   2e-80    
ref|NP_001167902.1|  hypothetical protein precursor                     261   3e-80    Zea mays [maize]
ref|XP_004492244.1|  PREDICTED: serine carboxypeptidase-like 20-like    260   5e-80    
gb|KEH18097.1|  serine carboxypeptidase-like protein                    260   5e-80    Medicago truncatula
ref|XP_002883604.1|  hypothetical protein ARALYDRAFT_480041             261   7e-80    
ref|XP_003622732.1|  Serine carboxypeptidase-like protein               263   7e-80    
ref|XP_010673905.1|  PREDICTED: serine carboxypeptidase-like 20         259   3e-79    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY39716.1|  BnaA04g07190D                                          258   4e-79    Brassica napus [oilseed rape]
ref|XP_006664470.1|  PREDICTED: serine carboxypeptidase 1-like          255   4e-79    Oryza brachyantha
emb|CDY33713.1|  BnaC04g29380D                                          258   6e-79    Brassica napus [oilseed rape]
emb|CDP04192.1|  unnamed protein product                                250   8e-79    Coffea canephora [robusta coffee]
ref|XP_002514834.1|  serine carboxypeptidase, putative                  255   2e-78    
emb|CDP04193.1|  unnamed protein product                                256   2e-78    Coffea canephora [robusta coffee]
ref|XP_011077160.1|  PREDICTED: serine carboxypeptidase-like 20         255   4e-78    Sesamum indicum [beniseed]
ref|XP_004492215.1|  PREDICTED: serine carboxypeptidase-like 20-like    254   7e-78    Cicer arietinum [garbanzo]
ref|NP_001066510.1|  Os12g0257000                                       253   4e-77    
gb|EEC69080.1|  hypothetical protein OsI_37959                          253   4e-77    Oryza sativa Indica Group [Indian rice]
gb|EEE53029.1|  hypothetical protein OsJ_35748                          253   5e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EYU39461.1|  hypothetical protein MIMGU_mgv1a005253mg                252   6e-77    Erythranthe guttata [common monkey flower]
gb|KFK36172.1|  hypothetical protein AALP_AA4G087600                    257   3e-76    Arabis alpina [alpine rockcress]
gb|KFK39839.1|  hypothetical protein AALP_AA3G294800                    249   8e-76    Arabis alpina [alpine rockcress]
gb|KFK23485.1|  hypothetical protein AALP_AAs46213U000800               247   2e-75    Arabis alpina [alpine rockcress]
gb|AES78951.2|  serine carboxypeptidase-like protein                    249   2e-75    Medicago truncatula
ref|XP_003622733.1|  Serine carboxypeptidase-like protein               249   2e-75    
emb|CAB53091.1|  SERINE CARBOXYPEPTIDASE I PRECURSOR-like protein       246   7e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770944.1|  predicted protein                                  246   1e-74    
ref|XP_002514835.1|  serine carboxypeptidase, putative                  246   2e-74    Ricinus communis
ref|XP_006652175.1|  PREDICTED: serine carboxypeptidase 1-like          242   2e-74    Oryza brachyantha
emb|CDJ26557.1|  unnamed protein product                                237   2e-72    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001052464.1|  Os04g0321700                                       241   2e-72    
ref|XP_002447646.1|  hypothetical protein SORBIDRAFT_06g011100          241   2e-72    Sorghum bicolor [broomcorn]
ref|XP_004975273.1|  PREDICTED: serine carboxypeptidase 1-like is...    240   3e-72    Setaria italica
ref|XP_004975272.1|  PREDICTED: serine carboxypeptidase 1-like is...    240   5e-72    
ref|XP_008663135.1|  PREDICTED: serine carboxypeptidase 1-like          240   6e-72    Zea mays [maize]
ref|XP_004975271.1|  PREDICTED: serine carboxypeptidase 1-like          239   6e-72    Setaria italica
ref|XP_002863203.1|  hypothetical protein ARALYDRAFT_333040             238   1e-71    
prf||1314177B  CPase I B                                                226   4e-71 
gb|KDO58563.1|  hypothetical protein CISIN_1g010880mg                   236   6e-71    Citrus sinensis [apfelsine]
gb|EMT23913.1|  Serine carboxypeptidase 1                               234   2e-70    
ref|XP_006447984.1|  hypothetical protein CICLE_v10014996mg             233   1e-69    
ref|XP_007049588.1|  Serine carboxypeptidase-like 20 isoform 2          232   1e-69    
ref|XP_007029290.1|  Serine carboxypeptidase-like 20 isoform 2          231   4e-69    
ref|XP_007029291.1|  Serine carboxypeptidase-like 20 isoform 3          231   4e-69    
emb|CDM85928.1|  unnamed protein product                                231   4e-69    Triticum aestivum [Canadian hard winter wheat]
gb|KCW63274.1|  hypothetical protein EUGRSUZ_G00901                     229   3e-68    Eucalyptus grandis [rose gum]
ref|XP_011016540.1|  PREDICTED: serine carboxypeptidase 1-like is...    224   3e-67    Populus euphratica
ref|XP_011016537.1|  PREDICTED: serine carboxypeptidase 1-like is...    224   6e-67    Populus euphratica
ref|XP_011016538.1|  PREDICTED: serine carboxypeptidase 1-like is...    224   6e-67    Populus euphratica
ref|XP_010070327.1|  PREDICTED: serine carboxypeptidase-like 20         223   2e-65    Eucalyptus grandis [rose gum]
gb|KCW63276.1|  hypothetical protein EUGRSUZ_G00904                     222   2e-65    Eucalyptus grandis [rose gum]
gb|KCW58999.1|  hypothetical protein EUGRSUZ_H01627                     221   3e-65    Eucalyptus grandis [rose gum]
ref|XP_010070157.1|  PREDICTED: serine carboxypeptidase 1-like          221   4e-65    Eucalyptus grandis [rose gum]
gb|EPS74136.1|  hypothetical protein M569_00619                         221   4e-65    Genlisea aurea
ref|XP_010068275.1|  PREDICTED: serine carboxypeptidase-like 20         222   7e-64    
gb|KCW58759.1|  hypothetical protein EUGRSUZ_H01396                     209   1e-62    Eucalyptus grandis [rose gum]
ref|XP_008382766.1|  PREDICTED: serine carboxypeptidase-like 20         204   1e-61    
tpg|DAA55432.1|  TPA: hypothetical protein ZEAMMB73_969275              210   6e-61    
gb|KFK39840.1|  hypothetical protein AALP_AA3G294800                    206   2e-59    Arabis alpina [alpine rockcress]
gb|EMT03686.1|  Serine carboxypeptidase 1                               206   2e-59    
gb|EMT11230.1|  Serine carboxypeptidase 1                               199   2e-59    
gb|KEH23401.1|  serine carboxypeptidase-like protein                    205   4e-59    Medicago truncatula
gb|KCW58761.1|  hypothetical protein EUGRSUZ_H01398                     201   7e-58    Eucalyptus grandis [rose gum]
ref|XP_010026201.1|  PREDICTED: serine carboxypeptidase-like 20         201   2e-57    
emb|CCW28854.1|  putative serine carboxypeptidase                       194   3e-55    Arachis duranensis
ref|XP_010026283.1|  PREDICTED: serine carboxypeptidase-like 20         187   2e-51    
ref|XP_008350580.1|  PREDICTED: serine carboxypeptidase-like 20         171   3e-50    
gb|KCW58998.1|  hypothetical protein EUGRSUZ_H01623                     169   2e-49    Eucalyptus grandis [rose gum]
ref|XP_010042090.1|  PREDICTED: serine carboxypeptidase 1-like          177   2e-48    Eucalyptus grandis [rose gum]
ref|XP_005646632.1|  peptidase S10, serine carboxypeptidase             176   6e-48    Coccomyxa subellipsoidea C-169
gb|ABR16352.1|  unknown                                                 174   5e-47    Picea sitchensis
emb|CDX83111.1|  BnaA01g21110D                                          160   2e-43    
gb|KCW58763.1|  hypothetical protein EUGRSUZ_H01399                     155   2e-40    Eucalyptus grandis [rose gum]
gb|AAL73563.1|AC079632_7  Putative serine carboxypeptidase              154   4e-40    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064014.1|  Os10g0101100                                       154   6e-40    
ref|XP_003571685.1|  PREDICTED: serine carboxypeptidase-like 17         150   1e-38    Brachypodium distachyon [annual false brome]
ref|XP_006662125.1|  PREDICTED: serine carboxypeptidase-like 18-like    150   2e-38    
ref|XP_010321497.1|  PREDICTED: serine carboxypeptidase-like 12         149   5e-38    Solanum lycopersicum
ref|XP_008790304.1|  PREDICTED: uncharacterized protein LOC103707550    152   6e-38    
ref|XP_009384628.1|  PREDICTED: serine carboxypeptidase-like 18         149   6e-38    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936154.1|  PREDICTED: serine carboxypeptidase-like 18         148   1e-37    
ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          148   1e-37    Eucalyptus grandis [rose gum]
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    151   1e-37    
ref|XP_010237149.1|  PREDICTED: serine carboxypeptidase-like 18         145   1e-37    
gb|KHG16860.1|  Serine carboxypeptidase-like 19                         145   1e-37    Gossypium arboreum [tree cotton]
tpg|DAA39924.1|  TPA: hypothetical protein ZEAMMB73_827985              139   1e-37    
emb|CDY11114.1|  BnaC06g23660D                                          147   1e-37    Brassica napus [oilseed rape]
ref|XP_010936148.1|  PREDICTED: serine carboxypeptidase-like 18 i...    145   2e-37    
ref|XP_006390568.1|  hypothetical protein EUTSA_v10018572mg             147   2e-37    Eutrema salsugineum [saltwater cress]
ref|XP_002460078.1|  hypothetical protein SORBIDRAFT_02g022430          147   2e-37    
ref|XP_007018463.1|  Serine carboxypeptidase-like 7, putative           145   3e-37    
ref|XP_002878647.1|  hypothetical protein ARALYDRAFT_900755             140   4e-37    
ref|XP_010108030.1|  Serine carboxypeptidase-like 3                     142   4e-37    
ref|XP_010936146.1|  PREDICTED: serine carboxypeptidase-like 18 i...    145   5e-37    
ref|XP_003573759.1|  PREDICTED: serine carboxypeptidase-like 18         146   6e-37    Brachypodium distachyon [annual false brome]
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    145   6e-37    
ref|XP_010936145.1|  PREDICTED: serine carboxypeptidase-like 18 i...    144   7e-37    
ref|XP_010936147.1|  PREDICTED: serine carboxypeptidase-like 18 i...    144   8e-37    
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             145   9e-37    Citrus clementina [clementine]
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   145   9e-37    Citrus sinensis [apfelsine]
ref|XP_009382032.1|  PREDICTED: serine carboxypeptidase-like 7          145   9e-37    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF86146.1|  unknown                                                 142   1e-36    Zea mays [maize]
ref|XP_002464850.1|  hypothetical protein SORBIDRAFT_01g027540          145   1e-36    Sorghum bicolor [broomcorn]
gb|EMS46782.1|  Serine carboxypeptidase-like 18                         143   1e-36    Triticum urartu
ref|XP_008644920.1|  PREDICTED: serine carboxypeptidase-like 2          145   1e-36    Zea mays [maize]
gb|AFW69059.1|  hypothetical protein ZEAMMB73_397726                    145   1e-36    
ref|XP_010320198.1|  PREDICTED: serine carboxypeptidase-like 17         144   2e-36    
ref|XP_009395245.1|  PREDICTED: serine carboxypeptidase-like 12         144   2e-36    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005851231.1|  hypothetical protein CHLNCDRAFT_33865              142   2e-36    Chlorella variabilis
ref|XP_010936155.1|  PREDICTED: serine carboxypeptidase-like 18         144   2e-36    Elaeis guineensis
ref|XP_009105991.1|  PREDICTED: serine carboxypeptidase-like 2 is...    144   2e-36    Brassica rapa
ref|XP_008799202.1|  PREDICTED: serine carboxypeptidase 1               144   3e-36    Phoenix dactylifera
gb|KJB58677.1|  hypothetical protein B456_009G221000                    144   3e-36    Gossypium raimondii
ref|XP_008778119.1|  PREDICTED: serine carboxypeptidase-like 18         140   3e-36    
dbj|BAJ94430.1|  predicted protein                                      144   3e-36    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001151152.1|  serine carboxypeptidase 1 precursor                144   4e-36    Zea mays [maize]
ref|XP_004983496.1|  PREDICTED: serine carboxypeptidase-like 18-like    144   4e-36    
ref|XP_007159376.1|  hypothetical protein PHAVU_002G233100g             144   4e-36    Phaseolus vulgaris [French bean]
ref|XP_004292764.2|  PREDICTED: serine carboxypeptidase-like 7 is...    144   4e-36    Fragaria vesca subsp. vesca
tpg|DAA39921.1|  TPA: Serine carboxypeptidase 1                         144   4e-36    
ref|XP_003573757.1|  PREDICTED: serine carboxypeptidase-like 13         144   5e-36    Brachypodium distachyon [annual false brome]
ref|XP_010936156.1|  PREDICTED: serine carboxypeptidase-like 18         142   5e-36    
ref|XP_003602921.1|  Serine carboxypeptidase-like protein               139   6e-36    
ref|XP_009139929.1|  PREDICTED: serine carboxypeptidase-like 7 is...    139   6e-36    Brassica rapa
ref|XP_008644916.1|  PREDICTED: serine carboxypeptidase-like 18 i...    143   6e-36    Zea mays [maize]
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    143   6e-36    
gb|ACF84441.1|  unknown                                                 142   7e-36    Zea mays [maize]
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    143   8e-36    
gb|EMT02053.1|  Serine carboxypeptidase-like 18                         143   8e-36    
gb|KJB48748.1|  hypothetical protein B456_008G084200                    142   8e-36    Gossypium raimondii
ref|XP_010939017.1|  PREDICTED: serine carboxypeptidase-like 12 i...    142   8e-36    
ref|XP_010515304.1|  PREDICTED: serine carboxypeptidase-like 7          142   9e-36    Camelina sativa [gold-of-pleasure]
emb|CDX72978.1|  BnaC06g34260D                                          142   1e-35    
emb|CDX96466.1|  BnaA07g30770D                                          142   1e-35    
gb|EMT21721.1|  Serine carboxypeptidase-like 17                         142   1e-35    
dbj|BAF99694.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          142   1e-35    Clitoria ternatea
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    142   1e-35    
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    142   1e-35    Elaeis guineensis
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    142   2e-35    Elaeis guineensis
ref|XP_010426467.1|  PREDICTED: serine carboxypeptidase-like 7          141   2e-35    Camelina sativa [gold-of-pleasure]
gb|ACF79685.1|  unknown                                                 141   2e-35    Zea mays [maize]
ref|NP_001130406.1|  uncharacterized protein LOC100191502 precursor     142   2e-35    Zea mays [maize]
gb|KJB73512.1|  hypothetical protein B456_011G236800                    141   3e-35    Gossypium raimondii
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           141   3e-35    
gb|KJB73511.1|  hypothetical protein B456_011G236800                    141   3e-35    
ref|XP_010503611.1|  PREDICTED: serine carboxypeptidase-like 7          140   3e-35    
gb|KJB73510.1|  hypothetical protein B456_011G236800                    141   3e-35    
gb|AAL73565.1|AC079632_9  Putative acyltransferase                      140   3e-35    
ref|XP_010689038.1|  PREDICTED: uncharacterized mitochondrial pro...    139   4e-35    
ref|XP_010556473.1|  PREDICTED: serine carboxypeptidase-like 18 i...    140   4e-35    
ref|XP_010556472.1|  PREDICTED: serine carboxypeptidase-like 18 i...    140   4e-35    
gb|ACN27602.1|  unknown                                                 141   4e-35    
emb|CDY67053.1|  BnaA04g27850D                                          139   4e-35    
ref|XP_009126133.1|  PREDICTED: serine carboxypeptidase-like 3 is...    139   5e-35    
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    140   5e-35    
ref|XP_009126131.1|  PREDICTED: serine carboxypeptidase-like 3 is...    139   5e-35    
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   140   5e-35    
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    140   6e-35    
ref|XP_009768014.1|  PREDICTED: serine carboxypeptidase-like 17         140   6e-35    
ref|XP_006855958.1|  hypothetical protein AMTR_s00037p00227730          140   6e-35    
ref|XP_004252000.2|  PREDICTED: serine carboxypeptidase-like 7          140   7e-35    
ref|XP_007138067.1|  hypothetical protein PHAVU_009G177800g             140   7e-35    
ref|XP_002510077.1|  serine carboxypeptidase, putative                  140   7e-35    
ref|XP_002510076.1|  serine carboxypeptidase, putative                  140   7e-35    
dbj|BAF99695.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          140   8e-35    
ref|XP_003604935.1|  Serine carboxypeptidase                            135   8e-35    
gb|EEE50445.1|  hypothetical protein OsJ_30452                          140   9e-35    
gb|KFK44963.1|  hypothetical protein AALP_AA1G326300                    139   9e-35    
ref|NP_001064015.1|  Os10g0101200                                       140   9e-35    
ref|XP_006594522.1|  PREDICTED: serine carboxypeptidase-like 12-like    139   1e-34    
ref|XP_004486284.1|  PREDICTED: serine carboxypeptidase-like 12-like    139   1e-34    
emb|CDY01415.1|  BnaA07g11880D                                          133   1e-34    
ref|XP_009120828.1|  PREDICTED: serine carboxypeptidase-like 15 i...    139   1e-34    
gb|AAM14928.1|  putative serine carboxypeptidase I                      134   1e-34    
gb|KFK38433.1|  hypothetical protein AALP_AA3G112700                    138   1e-34    
gb|KFK44962.1|  hypothetical protein AALP_AA1G326200                    139   1e-34    
ref|XP_009139927.1|  PREDICTED: serine carboxypeptidase-like 7 is...    139   1e-34    
ref|XP_009139928.1|  PREDICTED: serine carboxypeptidase-like 7 is...    139   1e-34    
dbj|BAO04182.1|  hypothetical protein                                   139   2e-34    
ref|XP_008452663.1|  PREDICTED: serine carboxypeptidase-like 13         139   2e-34    
ref|XP_009120822.1|  PREDICTED: serine carboxypeptidase-like 15 i...    139   2e-34    
gb|AES73172.2|  1-O-acylglucose:anthocyanin acyltransferase             139   2e-34    
ref|XP_006581277.1|  PREDICTED: serine carboxypeptidase-like 19-l...    139   2e-34    
gb|KEH36682.1|  1-O-acylglucose:anthocyanin acyltransferase             137   2e-34    
ref|XP_009126130.1|  PREDICTED: serine carboxypeptidase-like 12 i...    139   2e-34    
ref|XP_003525944.2|  PREDICTED: serine carboxypeptidase-like 19-l...    139   2e-34    
ref|XP_007136774.1|  hypothetical protein PHAVU_009G072900g             139   2e-34    
gb|KHN45135.1|  Serine carboxypeptidase-like 19                         139   2e-34    
gb|KJB48749.1|  hypothetical protein B456_008G084200                    139   2e-34    
gb|AFW69058.1|  hypothetical protein ZEAMMB73_415108                    138   2e-34    
ref|XP_006581276.1|  PREDICTED: serine carboxypeptidase-like 19-l...    139   2e-34    
ref|NP_001030669.1|  serine carboxypeptidase-like 7                     138   2e-34    
gb|KHN45449.1|  Serine carboxypeptidase-like 11                         138   2e-34    
ref|XP_003520964.1|  PREDICTED: serine carboxypeptidase-like 11-like    139   2e-34    
ref|XP_006376415.1|  serine carboxypeptidase S10 family protein         138   2e-34    
gb|KFK38432.1|  hypothetical protein AALP_AA3G112600                    138   2e-34    
ref|XP_009393004.1|  PREDICTED: serine carboxypeptidase-like 2          139   2e-34    
ref|NP_565545.1|  putative serine carboxypeptidase-like 52              132   3e-34    
ref|NP_187656.1|  serine carboxypeptidase-like 7                        138   3e-34    
emb|CDY22581.1|  BnaC05g24190D                                          138   3e-34    
ref|XP_004983497.1|  PREDICTED: serine carboxypeptidase-like 18-like    138   3e-34    
ref|XP_009139973.1|  PREDICTED: serine carboxypeptidase-like 13 i...    137   3e-34    
ref|NP_001189581.1|  serine carboxypeptidase-like 12                    134   4e-34    
gb|ABA95037.1|  Serine carboxypeptidase family protein                  138   4e-34    
ref|XP_007134008.1|  hypothetical protein PHAVU_010G011400g             138   4e-34    
ref|XP_002882669.1|  hypothetical protein ARALYDRAFT_478377             137   4e-34    
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             138   4e-34    
ref|XP_009784017.1|  PREDICTED: serine carboxypeptidase-like 7 is...    137   4e-34    
ref|XP_010277008.1|  PREDICTED: serine carboxypeptidase-like 18 i...    137   6e-34    
gb|EMS68839.1|  Serine carboxypeptidase-like 9                          134   7e-34    
emb|CDX85493.1|  BnaA02g03200D                                          137   7e-34    
ref|XP_009784016.1|  PREDICTED: serine carboxypeptidase-like 11 i...    137   7e-34    
ref|XP_009139971.1|  PREDICTED: serine carboxypeptidase-like 13 i...    137   7e-34    
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    140   8e-34    
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    137   8e-34    
gb|KHG24307.1|  Serine carboxypeptidase-like 18                         137   8e-34    
ref|XP_006843888.1|  hypothetical protein AMTR_s00007p00266480          136   8e-34    
ref|XP_006343160.1|  PREDICTED: serine carboxypeptidase-like 18-l...    137   8e-34    
dbj|BAF99698.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    137   8e-34    
ref|XP_003604931.1|  Serine carboxypeptidase                            137   8e-34    
emb|CDY38096.1|  BnaC02g06770D                                          137   8e-34    
ref|XP_003604928.1|  Serine carboxypeptidase                            137   9e-34    
ref|XP_010030506.1|  PREDICTED: serine carboxypeptidase-like 7          137   9e-34    
dbj|BAF99697.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    137   9e-34    
ref|XP_010231762.1|  PREDICTED: serine carboxypeptidase-like 19 i...    137   9e-34    
ref|XP_003593861.1|  Serine carboxypeptidase family protein             137   1e-33    
gb|KDP41600.1|  hypothetical protein JCGZ_16007                         137   1e-33    
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    139   1e-33    
ref|XP_010231763.1|  PREDICTED: serine carboxypeptidase-like 13 i...    137   1e-33    
ref|XP_003566614.1|  PREDICTED: serine carboxypeptidase-like 13 i...    137   1e-33    
ref|XP_010464718.1|  PREDICTED: serine carboxypeptidase-like 7 is...    136   1e-33    
ref|XP_009135217.1|  PREDICTED: serine carboxypeptidase-like 14         136   1e-33    
ref|XP_010464719.1|  PREDICTED: serine carboxypeptidase-like 7 is...    135   1e-33    
ref|XP_006356867.1|  PREDICTED: serine carboxypeptidase-like 19-like    139   2e-33    
ref|XP_009135216.1|  PREDICTED: serine carboxypeptidase-like 15         136   2e-33    
ref|XP_006297708.1|  hypothetical protein CARUB_v10013737mg             136   2e-33    
ref|XP_010416123.1|  PREDICTED: serine carboxypeptidase-like 2          136   2e-33    
ref|XP_010939015.1|  PREDICTED: serine carboxypeptidase-like 18 i...    135   2e-33    
ref|XP_010464717.1|  PREDICTED: serine carboxypeptidase-like 7 is...    135   2e-33    
ref|XP_010468096.1|  PREDICTED: serine carboxypeptidase-like 7          130   2e-33    
ref|XP_003604927.1|  Serine carboxypeptidase                            137   2e-33    
ref|XP_004288266.1|  PREDICTED: serine carboxypeptidase-like 2 is...    136   2e-33    
ref|XP_009140440.1|  PREDICTED: serine carboxypeptidase-like 13 i...    135   2e-33    
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          136   2e-33    
emb|CBI19380.3|  unnamed protein product                                136   2e-33    
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         139   2e-33    
ref|NP_001242803.1|  uncharacterized protein LOC100794342               136   2e-33    
ref|XP_009131550.1|  PREDICTED: serine carboxypeptidase-like 7 is...    135   3e-33    
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    135   3e-33    
gb|KHN06942.1|  Serine carboxypeptidase-like 19                         135   3e-33    
ref|XP_003579296.2|  PREDICTED: serine carboxypeptidase-like 2          135   3e-33    
ref|XP_009133996.1|  PREDICTED: serine carboxypeptidase-like 10 i...    133   3e-33    
ref|NP_001154529.1|  sinapoylglucose:malate sinapoyltransferase         133   3e-33    
ref|XP_006415268.1|  hypothetical protein EUTSA_v10007570mg             135   3e-33    
ref|XP_003604929.1|  Serine carboxypeptidase                            138   3e-33    
ref|XP_009761854.1|  PREDICTED: serine carboxypeptidase-like 18         135   3e-33    
gb|AFK37593.1|  unknown                                                 131   3e-33    
ref|NP_177473.1|  serine carboxypeptidase-like 2                        135   3e-33    
gb|KFK25883.1|  hypothetical protein AALP_AA8G174700                    135   4e-33    
emb|CDY59210.1|  BnaA09g54030D                                          135   4e-33    
ref|XP_009612206.1|  PREDICTED: serine carboxypeptidase-like 18 i...    134   4e-33    
ref|XP_009388678.1|  PREDICTED: serine carboxypeptidase-like 18         135   4e-33    
emb|CDM84698.1|  unnamed protein product                                135   4e-33    
ref|XP_010428248.1|  PREDICTED: serine carboxypeptidase-like 2 is...    134   4e-33    
emb|CDP08199.1|  unnamed protein product                                135   5e-33    
ref|XP_009146839.1|  PREDICTED: serine carboxypeptidase-like 7 is...    133   5e-33    
emb|CDP08179.1|  unnamed protein product                                135   5e-33    
ref|XP_010556471.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    134   5e-33    
ref|NP_177471.1|  serine carboxypeptidase-like 3                        134   5e-33    
gb|KDP32094.1|  hypothetical protein JCGZ_12555                         135   5e-33    
ref|XP_010428244.1|  PREDICTED: serine carboxypeptidase-like 2 is...    134   6e-33    
ref|NP_001067796.1|  Os11g0432900                                       134   6e-33    
gb|KEH29043.1|  1-O-acylglucose:anthocyanin acyltransferase             134   7e-33    
gb|AAG30990.1|AC012396_26  serine carboxypeptidase, putative            134   7e-33    
ref|XP_006663407.1|  PREDICTED: serine carboxypeptidase-like 9-like     129   7e-33    
gb|AAK95312.1|AF410326_1  T20K9.19/T20K9.19                             130   7e-33    
ref|XP_008452657.1|  PREDICTED: serine carboxypeptidase-like 13 i...    134   7e-33    
ref|XP_006415266.1|  hypothetical protein EUTSA_v10007559mg             134   7e-33    
tpg|DAA60427.1|  TPA: hypothetical protein ZEAMMB73_620256              131   7e-33    
ref|XP_003593858.1|  Serine carboxypeptidase-like protein               134   7e-33    
ref|XP_009764359.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    134   7e-33    
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         134   8e-33    
ref|XP_010314600.1|  PREDICTED: serine carboxypeptidase-like 11         134   8e-33    
emb|CDY30277.1|  BnaC04g31880D                                          134   8e-33    
sp|Q9CAU2.2|SCP5_ARATH  RecName: Full=Serine carboxypeptidase-lik...    134   8e-33    
ref|NP_179876.1|  serine carboxypeptidase-like 12                       134   8e-33    
ref|XP_006662865.1|  PREDICTED: serine carboxypeptidase-like 19-like    134   8e-33    
emb|CDM81579.1|  unnamed protein product                                137   8e-33    
ref|XP_002459781.1|  hypothetical protein SORBIDRAFT_02g010510          134   9e-33    
gb|EMS58156.1|  Serine carboxypeptidase-like 18                         134   9e-33    
ref|XP_004956083.1|  PREDICTED: serine carboxypeptidase-like 19-like    134   9e-33    
ref|NP_177474.1|  serine carboxypeptidase-like 4                        134   9e-33    
ref|XP_010555479.1|  PREDICTED: serine carboxypeptidase-like 7          134   9e-33    
ref|XP_008452655.1|  PREDICTED: serine carboxypeptidase-like 13 i...    134   1e-32    
ref|XP_009104816.1|  PREDICTED: serine carboxypeptidase-like 2          134   1e-32    
gb|AAX92990.1|  Serine carboxypeptidase                                 134   1e-32    
gb|KEH29044.1|  1-O-acylglucose:anthocyanin acyltransferase             134   1e-32    
ref|XP_008352130.1|  PREDICTED: serine carboxypeptidase-like 18         131   1e-32    
ref|XP_009131551.1|  PREDICTED: serine carboxypeptidase-like 7 is...    134   1e-32    
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   133   1e-32    
gb|ABG22468.1|  Serine carboxypeptidase family protein, expressed       134   1e-32    
ref|NP_565546.3|  sinapoylglucose:malate sinapoyltransferase            132   1e-32    
ref|XP_008452662.1|  PREDICTED: serine carboxypeptidase-like 13         134   1e-32    
ref|XP_009612197.1|  PREDICTED: serine carboxypeptidase-like 11 i...    134   1e-32    
ref|XP_004289672.1|  PREDICTED: serine carboxypeptidase-like 13         134   1e-32    
ref|XP_006404766.1|  hypothetical protein EUTSA_v10000651mg             133   1e-32    
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   134   1e-32    
ref|XP_006342727.1|  PREDICTED: uncharacterized protein LOC102585123    136   1e-32    
ref|XP_009133994.1|  PREDICTED: serine carboxypeptidase-like 10 i...    133   1e-32    
ref|XP_004163543.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    133   2e-32    
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    133   2e-32    
ref|NP_850034.1|  sinapoylglucose:malate sinapoyltransferase            133   2e-32    
ref|XP_010486654.1|  PREDICTED: serine carboxypeptidase-like 7 is...    132   2e-32    
ref|XP_009146838.1|  PREDICTED: serine carboxypeptidase-like 7 is...    133   2e-32    
ref|XP_010464720.1|  PREDICTED: serine carboxypeptidase-like 7          133   2e-32    
ref|XP_010471386.1|  PREDICTED: serine carboxypeptidase-like 2          133   2e-32    
dbj|BAJ88901.1|  predicted protein                                      133   2e-32    
ref|XP_006840227.1|  hypothetical protein AMTR_s00089p00168750          133   2e-32    
ref|XP_002266354.2|  PREDICTED: serine carboxypeptidase-like 18         133   2e-32    
ref|XP_008452666.1|  PREDICTED: serine carboxypeptidase-like 7 is...    133   2e-32    
dbj|BAB03129.1|  serine carboxypeptidase                                132   3e-32    
ref|XP_008452665.1|  PREDICTED: serine carboxypeptidase-like 7 is...    132   3e-32    
gb|AFK49380.1|  unknown                                                 132   3e-32    
gb|ACN25790.1|  unknown                                                 132   3e-32    
ref|NP_177472.1|  serine carboxypeptidase-like 5                        132   3e-32    
ref|XP_004165535.1|  PREDICTED: serine carboxypeptidase-like 1-like     132   3e-32    
ref|XP_006663388.1|  PREDICTED: serine carboxypeptidase-like 18-like    132   3e-32    
ref|XP_006662126.1|  PREDICTED: serine carboxypeptidase-like 6-like     132   3e-32    
ref|XP_010484310.1|  PREDICTED: serine carboxypeptidase-like 7          132   3e-32    
emb|CDY11116.1|  BnaC06g23680D                                          135   4e-32    
ref|XP_009103431.1|  PREDICTED: serine carboxypeptidase-like 10         132   4e-32    
gb|KFK38434.1|  hypothetical protein AALP_AA3G112800                    132   4e-32    
ref|XP_006345611.1|  PREDICTED: serine carboxypeptidase-like 19-like    131   4e-32    
gb|EMT22788.1|  Serine carboxypeptidase-like protein 9                  132   4e-32    
emb|CDX68234.1|  BnaA07g22740D                                          132   4e-32    
gb|EMT03311.1|  Serine carboxypeptidase-like 19                         132   4e-32    
emb|CDX76889.1|  BnaC08g34750D                                          132   4e-32    
ref|XP_010238599.1|  PREDICTED: serine carboxypeptidase-like 3          132   4e-32    
gb|KEH29042.1|  1-O-acylglucose:anthocyanin acyltransferase             135   5e-32    
dbj|BAO04189.1|  hypothetical protein                                   129   5e-32    
ref|NP_187828.1|  serine carboxypeptidase-like 17                       132   5e-32    
gb|AES87126.2|  1-O-acylglucose:anthocyanin acyltransferase             135   5e-32    
emb|CDY00943.1|  BnaC05g42570D                                          132   5e-32    
ref|XP_010499905.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    132   5e-32    
ref|XP_008337031.1|  PREDICTED: serine carboxypeptidase-like 18         132   5e-32    
ref|XP_010106919.1|  Serine carboxypeptidase-like 18                    132   5e-32    
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             132   5e-32    
ref|NP_198467.2|  serine carboxypeptidase-like 1                        132   6e-32    
ref|XP_004165534.1|  PREDICTED: serine carboxypeptidase-like 7-like     132   6e-32    
ref|XP_010486652.1|  PREDICTED: serine carboxypeptidase-like 7 is...    131   6e-32    
ref|NP_973516.2|  sinapoylglucose:malate sinapoyltransferase            131   6e-32    
emb|CBI22420.3|  unnamed protein product                                132   7e-32    
ref|XP_006356850.1|  PREDICTED: serine carboxypeptidase-like 18-like    132   7e-32    
gb|AAC17816.2|  putative serine carboxypeptidase I                      131   7e-32    
ref|XP_010486651.1|  PREDICTED: serine carboxypeptidase-like 7 is...    131   7e-32    
emb|CDX70702.1|  BnaC03g07860D                                          131   7e-32    
gb|KGN55283.1|  hypothetical protein Csa_4G643620                       131   7e-32    
gb|KFK39469.1|  hypothetical protein AALP_AA3G248300                    131   8e-32    
gb|EMT08577.1|  Serine carboxypeptidase-like 18                         131   8e-32    
gb|ACF84666.1|  unknown                                                 131   9e-32    
ref|NP_001132320.1|  uncharacterized protein LOC100193762 precursor     131   9e-32    
gb|AFW71416.1|  hypothetical protein ZEAMMB73_152983                    131   9e-32    
ref|XP_003593859.1|  Serine carboxypeptidase-like protein               131   9e-32    
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    131   9e-32    



>ref|XP_009626166.1| PREDICTED: serine carboxypeptidase-like 20 [Nicotiana tomentosiformis]
Length=499

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPVR+G VPTWP++L   +VPCTDD VATAWL++ EVRKAIHA++  +TG
Sbjct  324  RMFGRAWPFRAPVREGHVPTWPEILNGAHVPCTDDRVATAWLNNEEVRKAIHAKETTVTG  383

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCTDKI   HDSGSMIKYHKNLT+RGYRALI+SGDHDMCVP+TGSE WTRS+GYKI+
Sbjct  384  PWELCTDKIHLIHDSGSMIKYHKNLTARGYRALIYSGDHDMCVPFTGSEKWTRSLGYKIV  443

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW VNEQVAG+IQGYD NL FLTIKGAGHTVPEYKP+EALAFYTRWLEGK+I
Sbjct  444  DEWRPWYVNEQVAGFIQGYDNNLIFLTIKGAGHTVPEYKPREALAFYTRWLEGKNI  499



>ref|XP_009785823.1| PREDICTED: serine carboxypeptidase-like 20 [Nicotiana sylvestris]
Length=499

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPVR+G VPTWP++L   +VPCTDD VATAWL++ EVRKAIHA++  +TG
Sbjct  324  RMFGRAWPFRAPVREGHVPTWPEILNGVHVPCTDDRVATAWLNNEEVRKAIHAKETTVTG  383

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCT KI   HDSGSMIKYHKNLT+RGYRALI+SGDHDMCVP+TGSE WTRS+GYKI+
Sbjct  384  PWELCTGKIHLIHDSGSMIKYHKNLTARGYRALIYSGDHDMCVPFTGSEKWTRSLGYKIV  443

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW VNEQVAGYIQGYD NL FLTIKGAGHTVPEYKP+EALAFY RWLEGK+I
Sbjct  444  DEWRPWYVNEQVAGYIQGYDNNLIFLTIKGAGHTVPEYKPREALAFYARWLEGKNI  499



>gb|ACJ85811.1| unknown [Medicago truncatula]
 gb|AFK44735.1| unknown [Medicago truncatula]
Length=280

 Score =   302 bits (773),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDG VPTWPQL+ S NVPCTD +VA AWL++ EVRKAIH  ++++  
Sbjct  105  RMFGRAWPLRAPVRDGNVPTWPQLINSNNVPCTDGSVANAWLNNEEVRKAIHTAEKSVVS  164

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTDKI+F HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVP+TGS+AWTRS+GYKI+
Sbjct  165  SWDLCTDKISFDHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPFTGSQAWTRSIGYKIV  224

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ N QV GY QGYD+NLTFLTIKGAGHTVPEYKP+EAL FY R+L G  I
Sbjct  225  DEWRPWLSNGQVVGYTQGYDHNLTFLTIKGAGHTVPEYKPQEALDFYKRFLAGSPI  280



>ref|XP_010251666.1| PREDICTED: serine carboxypeptidase-like 20 [Nelumbo nucifera]
Length=554

 Score =   311 bits (796),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDG VPTWPQL+ SG+VPCTDD VAT+WL++ EVRKAIHAE E L  
Sbjct  380  RMFGRAWPLRAPVRDGYVPTWPQLMNSGSVPCTDDEVATSWLNNEEVRKAIHAE-EVLVV  438

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT KI + HD+GSMIKYH+NLTS+GYRALIFSGDHDMCVP+TG+EAWTRS+GYKII
Sbjct  439  TWELCTYKINYYHDAGSMIKYHRNLTSQGYRALIFSGDHDMCVPFTGTEAWTRSLGYKII  498

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  NEQ+AGYIQGYD N+TFLTIKGAGHTVPEYKP+EALAFY+RWLEGK+I
Sbjct  499  DEWRPWTCNEQIAGYIQGYDKNITFLTIKGAGHTVPEYKPQEALAFYSRWLEGKTI  554



>emb|CBI35583.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVR+G+VPTWPQLL SG+VPCTDD VAT+WL++  VR+AIHA  E++ G
Sbjct  304  RMFGRAWPLRAPVREGLVPTWPQLLNSGSVPCTDDEVATSWLNNKAVREAIHAALESVAG  363

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I + HD+GSMIKYHKNLTS GYRALIFSGDHDMCVPYTGS+AWTRSVGYK++
Sbjct  364  KWELCTDRILYHHDAGSMIKYHKNLTSNGYRALIFSGDHDMCVPYTGSQAWTRSVGYKVV  423

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  +EQVAGY+QGY+ NLTFLT+KG+GHTVPEYKP+EALAFY+RWL G+ I
Sbjct  424  DEWRPWFFDEQVAGYVQGYENNLTFLTVKGSGHTVPEYKPREALAFYSRWLTGRPI  479



>ref|XP_002264454.2| PREDICTED: serine carboxypeptidase 1 [Vitis vinifera]
Length=495

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVR+G+VPTWPQLL SG+VPCTDD VAT+WL++  VR+AIHA  E++ G
Sbjct  320  RMFGRAWPLRAPVREGLVPTWPQLLNSGSVPCTDDEVATSWLNNKAVREAIHAALESVAG  379

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I + HD+GSMIKYHKNLTS GYRALIFSGDHDMCVPYTGS+AWTRSVGYK++
Sbjct  380  KWELCTDRILYHHDAGSMIKYHKNLTSNGYRALIFSGDHDMCVPYTGSQAWTRSVGYKVV  439

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  +EQVAGY+QGY+ NLTFLT+KG+GHTVPEYKP+EALAFY+RWL G+ I
Sbjct  440  DEWRPWFFDEQVAGYVQGYENNLTFLTVKGSGHTVPEYKPREALAFYSRWLTGRPI  495



>gb|KCW57985.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDG VPTWP+LL S +VPCTDD VAT WL+  +VRKAIHAE++++ G
Sbjct  321  RMFGRAWPLRAPVRDGRVPTWPELLNSESVPCTDDEVATTWLNDKDVRKAIHAEEQSVAG  380

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +I+F HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGS+AWTRSVGYKI+
Sbjct  381  SWELCTGRISFYHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSQAWTRSVGYKIV  440

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N+QVAGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  441  DEWRPWTSNDQVAGYLQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKRI  496



>gb|KDP45241.1| hypothetical protein JCGZ_15106 [Jatropha curcas]
Length=492

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVR+GIVPTWPQLL S +VPCTDD VAT+WL++ EVRKAIHA++E+  G
Sbjct  317  RMFGRAWPLRAPVREGIVPTWPQLLNSESVPCTDDEVATSWLNNAEVRKAIHADEESALG  376

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTDKITF HD+GSM+K+H+NLT RGYRALIFSGDHDMCVPYTGSEAWTRS+GYKI+
Sbjct  377  AWELCTDKITFYHDAGSMMKFHRNLTLRGYRALIFSGDHDMCVPYTGSEAWTRSMGYKIV  436

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW    QVAGY QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GKSI
Sbjct  437  DEWRPWTSKGQVAGYTQGYENNLTFLTIKGAGHTVPEYKPQEALDFYSRFLAGKSI  492



>gb|KHG18698.1| Serine carboxypeptidase-like 20 [Gossypium arboreum]
Length=491

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWPLRAPVRDGIVPTWPQLL + +VPCTDDTVAT WL++P VRKAIHAE+E   
Sbjct  315  TRMFGRAWPLRAPVRDGIVPTWPQLLDAESVPCTDDTVATQWLNNPAVRKAIHAEEETAI  374

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +ELCTDKI + HD+GSMI YHKNLTS GYRALI+SGDHDMCVP+TGS+AWTRS+GY+I
Sbjct  375  GKWELCTDKILYDHDAGSMIMYHKNLTSGGYRALIYSGDHDMCVPFTGSQAWTRSIGYEI  434

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW+ N QVAGY+QGY  NLTFLTIKGAGHTVPEYKP+EA  FY+R+L GK+I
Sbjct  435  VDEWRPWMSNGQVAGYLQGYANNLTFLTIKGAGHTVPEYKPQEAFDFYSRFLAGKAI  491



>gb|KJB42610.1| hypothetical protein B456_007G160000 [Gossypium raimondii]
Length=491

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWPLRAPVRDGIVPTWPQLL + +VPCTDDTVAT WL+ P VRKAIHAE+E   
Sbjct  315  TRMFGRAWPLRAPVRDGIVPTWPQLLDAESVPCTDDTVATQWLNDPAVRKAIHAEEETAI  374

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +ELCTDKI + HD+GSMI YHKNLTS GYRALI+SGDHDMCVP+TGS+AWTRS+GY+I
Sbjct  375  GKWELCTDKILYDHDAGSMIVYHKNLTSGGYRALIYSGDHDMCVPFTGSQAWTRSIGYEI  434

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW+ N QVAGY+QGY  NLTFLT+KGAGHTVPEYKP+EAL FY+R+L GK+I
Sbjct  435  VDEWRPWMSNGQVAGYLQGYANNLTFLTVKGAGHTVPEYKPEEALDFYSRFLAGKAI  491



>ref|XP_004242440.1| PREDICTED: serine carboxypeptidase-like 20 [Solanum lycopersicum]
Length=499

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP +APVR G VPTWP++L    VPCTDD VATAWL++ +VRKAIHAEQ  L G
Sbjct  324  RMFGRAWPFKAPVRAGHVPTWPEILNDLYVPCTDDRVATAWLNNEDVRKAIHAEQTTLIG  383

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCTDKI  +HDSGSMI YHKNLT+RGYRALI+SGDHDMCVP+TGSE WTRS+GY I+
Sbjct  384  PWELCTDKIGLSHDSGSMIPYHKNLTARGYRALIYSGDHDMCVPFTGSEKWTRSLGYPIV  443

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D+WRPW VNE+VAGYIQGYD NLTF+TIKGAGHTVPEYKP+EALAFY+RWLEGK+I
Sbjct  444  DKWRPWYVNEEVAGYIQGYDNNLTFITIKGAGHTVPEYKPQEALAFYSRWLEGKNI  499



>gb|KCW57986.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
 gb|KCW57987.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDG VPTWP+LL S +VPCTDD VAT WL+  +VRKAIHAE++++ G
Sbjct  321  RMFGRAWPLRAPVRDGRVPTWPELLNSESVPCTDDEVATTWLNDKDVRKAIHAEEQSVAG  380

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +I+F HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGS+AWTRSVGYKI+
Sbjct  381  SWELCTGRISFYHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSQAWTRSVGYKIV  440

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N Q+AGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  441  DEWRPWNSNNQIAGYLQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKRI  496



>ref|XP_010069589.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=496

 Score =   304 bits (778),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDG VPTWP+LL S +VPCTDD VAT WL+  +VRKAIHAE++++ G
Sbjct  321  RMFGRAWPLRAPVRDGRVPTWPELLNSESVPCTDDEVATTWLNDKDVRKAIHAEEQSVAG  380

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +I+F HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGS+AWTRSVGYKI+
Sbjct  381  SWELCTGRISFYHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSQAWTRSVGYKIV  440

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N Q+AGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  441  DEWRPWNSNNQIAGYLQGYENNLTFLTIKGAGHTVPEYKPQEALDFYSRFLAGKRI  496



>ref|XP_007049587.1| Serine carboxypeptidase-like 20 isoform 1 [Theobroma cacao]
 gb|EOX93744.1| Serine carboxypeptidase-like 20 isoform 1 [Theobroma cacao]
Length=499

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVPTWPQLL S +VPC DD +AT WL+   VRKAIHAE+E + G
Sbjct  324  RMFGRAWPLRAPVRDGIVPTWPQLLDSQSVPCMDDEIATKWLNDAAVRKAIHAEEETVIG  383

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTD I + HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVP+TGS+AWTRSVGYKI+
Sbjct  384  TWQLCTDNILYDHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPFTGSQAWTRSVGYKIV  443

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  + QVAGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK+I
Sbjct  444  DEWRPWTSHGQVAGYLQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKAI  499



>ref|XP_002527263.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF35107.1| serine carboxypeptidase, putative [Ricinus communis]
Length=498

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVPTWPQLL S +VPCTDD VAT WL++  VRKAIHA++E++ G
Sbjct  323  RMFGRAWPLRAPVRDGIVPTWPQLLNSESVPCTDDEVATLWLNNAAVRKAIHADEESIAG  382

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I F+HD+GSMIKYH+NLT RG+RALIFSGDHDMCVPYTGS+AWTRS+GYKI+
Sbjct  383  TWELCTDRIFFSHDAGSMIKYHRNLTMRGFRALIFSGDHDMCVPYTGSQAWTRSMGYKIV  442

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPWI   QVAGY QGY+ NLTFLTIKGAGHTVPEYKP+EA  FY+R+L GK I
Sbjct  443  DEWRPWISKGQVAGYTQGYENNLTFLTIKGAGHTVPEYKPQEAFDFYSRFLAGKRI  498



>emb|CDP03970.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWPLR+PVRDG+VPTWPQLL++ +V CT+D VATAWL++  VR+AIHAE   + 
Sbjct  322  TRMFGRAWPLRSPVRDGLVPTWPQLLKTTSVLCTNDEVATAWLNNEVVRQAIHAESVNVA  381

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
              +ELCT +I F HD+GSMIKYHKNLTS+GYRALIFSGDHDMCVP+TGS+AWTRSVGYKI
Sbjct  382  DTWELCTGRIQFHHDAGSMIKYHKNLTSKGYRALIFSGDHDMCVPFTGSQAWTRSVGYKI  441

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPWIVN+QVAG++QGYDYNLTF+TIKGAGHTV EYKP+EAL FYTRWL+G+ I
Sbjct  442  VDEWRPWIVNDQVAGFLQGYDYNLTFITIKGAGHTVAEYKPREALEFYTRWLDGRKI  498



>gb|KCW57988.1| hypothetical protein EUGRSUZ_H00717 [Eucalyptus grandis]
Length=481

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRAWPL APVRDG VPTWPQLL S +VPCT D VA+AWL+  EVRKAIHAE +++T
Sbjct  305  NRMFGRAWPLGAPVRDGPVPTWPQLLSSNSVPCTSDEVASAWLNDKEVRKAIHAEVQSVT  364

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G + LCT ++ + HD+GSMIKYHKNLT+RGYRALIFSGDHDMC+P+TGS+AWTRS+GYKI
Sbjct  365  GDWNLCTGRLFYNHDAGSMIKYHKNLTARGYRALIFSGDHDMCIPFTGSQAWTRSMGYKI  424

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW+ NEQVAGYIQGYD+NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  425  VDEWRPWMSNEQVAGYIQGYDHNLTFLTIKGAGHTVPEYKPREALHFYSRFLRGKRI  481



>ref|XP_003626861.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AET01337.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK43057.1| unknown [Medicago truncatula]
Length=495

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDG VPTWPQL+ S NVPCTD +VA AWL++ EVRKAIH  ++++  
Sbjct  320  RMFGRAWPLRAPVRDGNVPTWPQLINSNNVPCTDGSVANAWLNNEEVRKAIHTAEKSVVS  379

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTDKI+F HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVP+TGS+AWTRS+GYKI+
Sbjct  380  SWDLCTDKISFDHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPFTGSQAWTRSIGYKIV  439

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ N QV GY QGYD+NLTFLTIKGAGHTVPEYKP+EAL FY R+L G  I
Sbjct  440  DEWRPWLSNGQVVGYTQGYDHNLTFLTIKGAGHTVPEYKPQEALDFYKRFLAGSPI  495



>ref|XP_010245947.1| PREDICTED: serine carboxypeptidase 1 [Nelumbo nucifera]
Length=494

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAP+RDG VPTWPQL+ SGNVPCTDD VAT+WL++ EVRKAIHAE+ ++  
Sbjct  320  RMFGRAWPLRAPIRDGYVPTWPQLMDSGNVPCTDDEVATSWLNNEEVRKAIHAEEVSVV-  378

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT KI + HD+GSMIKYHK+LT+ GYR+LIFSGDHDMC+P+TG+EAWT+S+GY+I+
Sbjct  379  TWELCTGKIEYFHDAGSMIKYHKSLTAGGYRSLIFSGDHDMCIPFTGTEAWTKSLGYEIV  438

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  NEQVAGYIQGYD NLTFLTIKG+GHTVPEYKP+EALAFY+RWLEG++I
Sbjct  439  DEWRPWTFNEQVAGYIQGYDKNLTFLTIKGSGHTVPEYKPQEALAFYSRWLEGETI  494



>ref|XP_010026006.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=495

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRAWPL APVRDG VPTWPQLL S +VPCT D VA+AWL+  EVRKAIHAE +++T
Sbjct  319  NRMFGRAWPLGAPVRDGPVPTWPQLLSSNSVPCTSDEVASAWLNDKEVRKAIHAEVQSVT  378

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G + LCT ++ + HD+GSMIKYHKNLT+RGYRALIFSGDHDMC+P+TGS+AWTRS+GYKI
Sbjct  379  GDWNLCTGRLFYNHDAGSMIKYHKNLTARGYRALIFSGDHDMCIPFTGSQAWTRSMGYKI  438

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW+ NEQVAGYIQGYD+NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  439  VDEWRPWMSNEQVAGYIQGYDHNLTFLTIKGAGHTVPEYKPREALHFYSRFLRGKRI  495



>ref|XP_006447985.1| hypothetical protein CICLE_v10014996mg [Citrus clementina]
 ref|XP_006492224.1| PREDICTED: serine carboxypeptidase-like 20-like [Citrus sinensis]
 gb|ESR61225.1| hypothetical protein CICLE_v10014996mg [Citrus clementina]
 gb|KDO58561.1| hypothetical protein CISIN_1g010880mg [Citrus sinensis]
Length=497

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVP+WPQLL S +VPCTDD VAT WL+   VR AIHAE E++ G
Sbjct  322  RMFGRAWPLRAPVRDGIVPSWPQLLNSNSVPCTDDRVATLWLNDAAVRTAIHAEPESIAG  381

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I F HD+GSMIKYHKNLT RGYRALIFSGDHDMCVP+TGSEAWTRSVGYKI+
Sbjct  382  SWELCTDRILFEHDAGSMIKYHKNLTLRGYRALIFSGDHDMCVPFTGSEAWTRSVGYKIV  441

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D+WRPW  N QVAGY QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK +
Sbjct  442  DKWRPWTSNGQVAGYTQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKPL  497



>gb|KDO58562.1| hypothetical protein CISIN_1g010880mg [Citrus sinensis]
Length=498

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVP+WPQLL S +VPCTDD VAT WL+   VR AIHAE E++ G
Sbjct  323  RMFGRAWPLRAPVRDGIVPSWPQLLNSNSVPCTDDRVATLWLNDAAVRTAIHAEPESIAG  382

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I F HD+GSMIKYHKNLT RGYRALIFSGDHDMCVP+TGSEAWTRSVGYKI+
Sbjct  383  SWELCTDRILFEHDAGSMIKYHKNLTLRGYRALIFSGDHDMCVPFTGSEAWTRSVGYKIV  442

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D+WRPW  N QVAGY QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK +
Sbjct  443  DKWRPWTSNGQVAGYTQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKPL  498



>ref|XP_004510209.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=495

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVPTWPQL+ S NVPCTD +VA AWL++  VRKAIH  ++++  
Sbjct  320  RMFGRAWPLRAPVRDGIVPTWPQLINSNNVPCTDGSVANAWLNNEVVRKAIHTAEKSVVS  379

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTDKI+F HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVP+TGS+AWTRS+GYKI+
Sbjct  380  SWDLCTDKISFNHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPFTGSQAWTRSIGYKIV  439

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ N QV GY QGYD NLTFLTIKGAGHTVPEYKP+EAL FY R+L G  I
Sbjct  440  DEWRPWLSNGQVVGYTQGYDNNLTFLTIKGAGHTVPEYKPQEALDFYKRFLAGLPI  495



>ref|XP_004242437.1| PREDICTED: serine carboxypeptidase-like 20 [Solanum lycopersicum]
Length=498

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP +APV++G VPTWP++L    VPCTDD VAT WL++ +VRKAIHAEQ  + G
Sbjct  323  RMFGRAWPFKAPVKEGRVPTWPEILNGVAVPCTDDRVATVWLNNADVRKAIHAEQTTVIG  382

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCTDKIT  HDSGSMI YHKNLT+RGYRA+I+SGDHDMCVPYTGS  WTRS+GY I+
Sbjct  383  PWELCTDKITMYHDSGSMIPYHKNLTARGYRAIIYSGDHDMCVPYTGSALWTRSLGYPIV  442

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW VNEQVAG+IQGYD NL F+T+KGAGHTVPEYKP+EALAFY+RWLEGK I
Sbjct  443  DEWRPWYVNEQVAGFIQGYDNNLIFMTVKGAGHTVPEYKPREALAFYSRWLEGKKI  498



>ref|XP_006352654.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=498

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP +APV++G VPTWP++L    VPCTDD VAT WL++ +VRKAIHAEQ  + G
Sbjct  323  RMFGRAWPFKAPVKEGRVPTWPEILNGVAVPCTDDRVATLWLNNADVRKAIHAEQTTVIG  382

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCTDKIT  HDSGSMI YHKNLT+RGYRA+I+SGDHDMCVPYTGS  WTRS+GY I+
Sbjct  383  PWELCTDKITMYHDSGSMIPYHKNLTARGYRAIIYSGDHDMCVPYTGSALWTRSLGYPIV  442

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW VNEQVAG+IQGYD NL F+T+KGAGHTVPEYKP+EALAFY RWLEGK I
Sbjct  443  DEWRPWYVNEQVAGFIQGYDNNLIFMTVKGAGHTVPEYKPREALAFYARWLEGKKI  498



>emb|CAN64572.1| hypothetical protein VITISV_010382 [Vitis vinifera]
Length=478

 Score =   298 bits (764),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 160/186 (86%), Gaps = 10/186 (5%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVR+G+VPTWPQLL SG+VPCTDD VAT+WL++  VR+AIHA  E++ G
Sbjct  293  RMFGRAWPLRAPVREGLVPTWPQLLNSGSVPCTDDEVATSWLNNKAVREAIHAALESVAG  352

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIF----------SGDHDMCVPYTGSEA  412
             +ELCTD+I + HD+GSMIKYHKNLTS GYRALIF          SGDHDMCVPYTGS+A
Sbjct  353  KWELCTDRILYHHDAGSMIKYHKNLTSBGYRALIFRHLLILFISGSGDHDMCVPYTGSQA  412

Query  411  WTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRW  232
            WTRSVGYK++DEWRPW  +EQVAGY+QGY+ NLTFLT+KG+GHTVPEYKP+EALAFY+RW
Sbjct  413  WTRSVGYKVVDEWRPWFFDEQVAGYVQGYENNLTFLTVKGSGHTVPEYKPREALAFYSRW  472

Query  231  LEGKSI  214
            L G+ I
Sbjct  473  LTGRPI  478



>ref|XP_006366824.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 1-like 
[Solanum tuberosum]
Length=498

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP +APVR G VPTWP++L S  VPCTDD VAT WL++ +VRKAIHAE   + G
Sbjct  323  RMFGRAWPYKAPVRAGHVPTWPEILNSVEVPCTDDRVATLWLNNADVRKAIHAEPATVIG  382

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCTDKI   HDSGSMI YHKNLT+RGYRA+IFSGDHDMCVP+TGS  WTRS+GY I+
Sbjct  383  PWELCTDKIYLYHDSGSMIXYHKNLTARGYRAIIFSGDHDMCVPFTGSAVWTRSLGYPIV  442

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW VNEQVAG+IQGYD NL F+TIKGAGHTVPEYKP+EALAFYTRWLEGK I
Sbjct  443  DEWRPWYVNEQVAGFIQGYDNNLIFMTIKGAGHTVPEYKPQEALAFYTRWLEGKKI  498



>gb|KCW57984.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDG VPTWP+LL S +VPCTDD VAT WL+  +VRKAIHAE++++ G
Sbjct  321  RMFGRAWPLRAPVRDGRVPTWPELLNSESVPCTDDEVATTWLNDKDVRKAIHAEEQSMAG  380

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I+F HD+GSMIKYHKNLT+RGYRALI+SGDHD+ +PYTG++AWTRSVGYKI+
Sbjct  381  TWELCTDRISFYHDAGSMIKYHKNLTARGYRALIYSGDHDLGLPYTGTQAWTRSVGYKIV  440

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N+QVAGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  441  DEWRPWTSNDQVAGYLQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKRI  496



>ref|XP_011089617.1| PREDICTED: serine carboxypeptidase 1 [Sesamum indicum]
Length=498

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPVRDG VPTWPQ+L S  VPCTDD VA AWL++  VRKAIHAE  ++ G
Sbjct  323  RMFGRAWPFRAPVRDGYVPTWPQILNSEEVPCTDDEVANAWLNNETVRKAIHAESASVAG  382

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I+F HD+GSMIKYHKNLT RGYRA+IFSGDHDMCVP+TGS+AWTRSVGYK +
Sbjct  383  NWELCTDRISFYHDAGSMIKYHKNLTMRGYRAIIFSGDHDMCVPFTGSQAWTRSVGYKTV  442

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW V  QVAGY+QGY+ NL+FLT+KG+GHTVPEYKP EALAFY+RWL G+ I
Sbjct  443  DEWRPWYVKGQVAGYVQGYENNLSFLTVKGSGHTVPEYKPVEALAFYSRWLAGQKI  498



>gb|EYU40664.1| hypothetical protein MIMGU_mgv1a004824mg [Erythranthe guttata]
Length=508

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPV+DG VP+WPQLL   NVPCTDD VA AWL++  VRKAIHA+   + G
Sbjct  333  RMFGRAWPLRAPVKDGYVPSWPQLLNGENVPCTDDEVADAWLNNEAVRKAIHADSANVAG  392

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTD+I+F HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVP+TG++AWTRS+GYK +
Sbjct  393  KWDLCTDRISFYHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPFTGTQAWTRSIGYKTV  452

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW + +QVAGY QGY+  LTFLT+KG+GHTVPEYKP+EAL FYTRWLEG+ I
Sbjct  453  DEWRPWTIKDQVAGYTQGYENGLTFLTVKGSGHTVPEYKPREALQFYTRWLEGQRI  508



>ref|XP_006366825.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=499

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP +APVR G VPTWP++L   +VPCTDD VATAWL++ +VRKAIHAEQ  + G
Sbjct  324  RMFGRAWPFKAPVRAGHVPTWPEILNGLDVPCTDDRVATAWLNNEDVRKAIHAEQTTVIG  383

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCT KI  +HDSGSMI YHKNLT+RGYRALI+SGDHDMCVP+TGSE WTRS+GY I+
Sbjct  384  PWELCTAKIGLSHDSGSMIPYHKNLTARGYRALIYSGDHDMCVPFTGSEKWTRSLGYPIV  443

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D+WR W VNEQVAGYIQGYD NL F+TIKG+GHTVPEYKP+EALAFY+RWLEGK+I
Sbjct  444  DKWRSWYVNEQVAGYIQGYDNNLIFITIKGSGHTVPEYKPREALAFYSRWLEGKNI  499



>gb|KGN66663.1| hypothetical protein Csa_1G654920 [Cucumis sativus]
Length=305

 Score =   290 bits (742),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 6/182 (3%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN------VPCTDDTVATAWLSSPEVRKAIHAE  580
            RMFGRAWP RAPVRDGIVP WPQL +S N      VPC +D VAT WL+   VR AIHAE
Sbjct  124  RMFGRAWPFRAPVRDGIVPLWPQLARSHNITHESTVPCMNDEVATIWLNDESVRAAIHAE  183

Query  579  QEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRS  400
             +++TG +ELCTD+I++ HD+GSMI YH NLTS+GYRALIFSGDHDMCVPYTG++AWT S
Sbjct  184  PQSVTGAWELCTDRISYDHDAGSMIPYHINLTSQGYRALIFSGDHDMCVPYTGTQAWTSS  243

Query  399  VGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            +GYKI+DEWRPW  N QVAGY+QGY++NLTFLTIKGAGHTVPEYKP+EAL FY+RWL G 
Sbjct  244  IGYKIVDEWRPWFTNSQVAGYLQGYEHNLTFLTIKGAGHTVPEYKPREALDFYSRWLHGN  303

Query  219  SI  214
            SI
Sbjct  304  SI  305



>gb|KCW57982.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
 gb|KCW57983.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRAWPLRAPVRDG VPTW +LL S ++PCTDD VAT WL+  +VRKAIHAE++++ 
Sbjct  320  NRMFGRAWPLRAPVRDGRVPTWSELLNSNSIPCTDDEVATTWLNDKDVRKAIHAEEQSMA  379

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +ELCTD+I+F HD+GSMIKYHKNLT+RGYRALI+SGDHD+ +PYTG++AWTRSVGYKI
Sbjct  380  GTWELCTDRISFYHDAGSMIKYHKNLTARGYRALIYSGDHDLGLPYTGTQAWTRSVGYKI  439

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N+QVAGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  440  VDEWRPWTSNDQVAGYLQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKRI  496



>gb|KCW57981.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRAWPLRAPVRDG VPTW +LL S ++PCTDD VAT WL+  +VRKAIHAE++++ 
Sbjct  320  NRMFGRAWPLRAPVRDGRVPTWSELLNSNSIPCTDDEVATTWLNDKDVRKAIHAEEQSMA  379

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +ELCTD+I+F HD+GSMIKYHKNLT+RGYRALI+SGDHD+ +PYTG++AWTRSVGYKI
Sbjct  380  GTWELCTDRISFYHDAGSMIKYHKNLTARGYRALIYSGDHDLGLPYTGTQAWTRSVGYKI  439

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N+QVAGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  440  VDEWRPWTSNDQVAGYLQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKRI  496



>gb|KCW57980.1| hypothetical protein EUGRSUZ_H00716 [Eucalyptus grandis]
Length=496

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRAWPLRAPVRDG VPTW +LL S ++PCTDD VAT WL+  +VRKAIHAE++++ 
Sbjct  320  NRMFGRAWPLRAPVRDGRVPTWSELLNSNSIPCTDDEVATTWLNDKDVRKAIHAEEQSMA  379

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +ELCTD+I+F HD+GSMIKYHKNLT+RGYRALI+SGDHD+ +PYTG++AWTRSVGYKI
Sbjct  380  GTWELCTDRISFYHDAGSMIKYHKNLTARGYRALIYSGDHDLGLPYTGTQAWTRSVGYKI  439

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N+QVAGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  440  VDEWRPWTSNDQVAGYLQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKRI  496



>ref|XP_010069585.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
 ref|XP_010069586.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=496

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRAWPLRAPVRDG VPTW +LL S ++PCTDD VAT WL+  +VRKAIHAE++++ 
Sbjct  320  NRMFGRAWPLRAPVRDGRVPTWSELLNSNSIPCTDDEVATTWLNDKDVRKAIHAEEQSMA  379

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +ELCTD+I+F HD+GSMIKYHKNLT+RGYRALI+SGDHD+ +PYTG++AWTRSVGYKI
Sbjct  380  GTWELCTDRISFYHDAGSMIKYHKNLTARGYRALIYSGDHDLGLPYTGTQAWTRSVGYKI  439

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N+QVAGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  440  VDEWRPWTSNDQVAGYLQGYENNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGKRI  496



>ref|XP_010678976.1| PREDICTED: serine carboxypeptidase-like 20 [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   295 bits (754),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            R++GRAWPLRAPVRDGIVPTWP++  S  VPC +D VATAWL+   VRKAIHAE+E++ G
Sbjct  327  RIYGRAWPLRAPVRDGIVPTWPEISNSVGVPCINDEVATAWLNEKAVRKAIHAEEESVAG  386

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +I++ HD+GSMIKYHKNLTSRGYRALI+SGDHDMCVPYTGSEAWT+S+GYK++
Sbjct  387  SWELCTSRISYNHDAGSMIKYHKNLTSRGYRALIYSGDHDMCVPYTGSEAWTKSIGYKVL  446

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ NEQV+G+IQGY+ NLT+LTIKGAGHTVPEYKP+EAL FY+++L G+ I
Sbjct  447  DEWRPWVCNEQVSGFIQGYEKNLTYLTIKGAGHTVPEYKPREALYFYSQFLAGQKI  502



>ref|XP_006366830.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=497

 Score =   295 bits (754),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP +APVRDG+VPTWP+LL    VPCTDD V++ WL++ +VRKAIHAEQ  + G
Sbjct  322  RMFGRAWPFKAPVRDGLVPTWPELLNELTVPCTDDRVSSVWLNNEDVRKAIHAEQTTVIG  381

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCTD ITF+HD+GSMI YHKNLT+ GYRALI+SGDHDMCVP+TGSE WT S+GY I+
Sbjct  382  PWELCTDSITFSHDAGSMIPYHKNLTAHGYRALIYSGDHDMCVPHTGSEKWTSSLGYPIV  441

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D+WRPW VNEQVAGY QGY  NL+FLTIKG+GHTVPEYKP+EALAFY RWLE K I
Sbjct  442  DKWRPWYVNEQVAGYTQGYANNLSFLTIKGSGHTVPEYKPQEALAFYARWLESKKI  497



>gb|AFK43580.1| unknown [Lotus japonicus]
Length=175

 Score =   283 bits (724),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  738  MFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTGP  559
            MFGRAWPLRAPVR+GIVPTWPQL+ S +VPCTDD VA  WL++  VRKAIH  + +L   
Sbjct  1    MFGRAWPLRAPVREGIVPTWPQLMDSNDVPCTDDVVAKLWLNNEAVRKAIHTARTSLVSQ  60

Query  558  FELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIID  379
            ++LCT +I + HD+GSMIKYHKNLTS+GYRALI+SGDHDMCVP+TGSEAWTRS+GYKI+D
Sbjct  61   WDLCTGRIRYNHDAGSMIKYHKNLTSKGYRALIYSGDHDMCVPFTGSEAWTRSMGYKIVD  120

Query  378  EWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEG  223
            EWRPW  N+QVAG+ QGYD NLTF+TIKGAGHTVPEYKP+EAL FYT +L G
Sbjct  121  EWRPWFSNDQVAGFTQGYDKNLTFMTIKGAGHTVPEYKPREALEFYTHFLTG  172



>ref|XP_002321240.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE99555.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=495

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPVR GIVPTWPQLL   +VPCTDD VAT+WL++  VRKAIHAE E+++G
Sbjct  320  RMFGRAWPFRAPVRPGIVPTWPQLLDGESVPCTDDEVATSWLNNEAVRKAIHAELESVSG  379

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I F HD+GSMIKYH+NLT RG+RALIFSGDHDMCVPYTGSEAWTRS+GY I+
Sbjct  380  TWELCTDRIRFHHDAGSMIKYHRNLTLRGFRALIFSGDHDMCVPYTGSEAWTRSMGYDIV  439

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N QVAGY QGY  NLTFLT+KGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  440  DEWRPWTSNGQVAGYTQGYANNLTFLTMKGAGHTVPEYKPREALDFYSRFLSGKPI  495



>ref|XP_004170750.1| PREDICTED: serine carboxypeptidase 1-like, partial [Cucumis sativus]
Length=413

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 6/182 (3%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN------VPCTDDTVATAWLSSPEVRKAIHAE  580
            RMFGRAWP RAPVRDGIVP WPQL +S N      VPC +D VAT WL+   VR AIHAE
Sbjct  232  RMFGRAWPFRAPVRDGIVPLWPQLARSHNITHESTVPCMNDEVATIWLNDESVRAAIHAE  291

Query  579  QEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRS  400
             +++TG +ELCTD+I++ HD+GSMI YH NLTS+GYRALIFSGDHDMCVPYTG++AWT S
Sbjct  292  PQSVTGAWELCTDRISYDHDAGSMIPYHINLTSQGYRALIFSGDHDMCVPYTGTQAWTSS  351

Query  399  VGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            +GYKI+DEWRPW  N QVAGY+QGY++NLTFLTIKGAGHTVPEYKP+EAL FY+RWL G 
Sbjct  352  IGYKIVDEWRPWFTNSQVAGYLQGYEHNLTFLTIKGAGHTVPEYKPREALDFYSRWLHGN  411

Query  219  SI  214
            SI
Sbjct  412  SI  413



>ref|XP_007205172.1| hypothetical protein PRUPE_ppa005545mg [Prunus persica]
 gb|EMJ06371.1| hypothetical protein PRUPE_ppa005545mg [Prunus persica]
Length=455

 Score =   292 bits (748),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPV DGIVP WPQL  S  VPC  D VAT WL++P VR+AIHAE E++TG
Sbjct  280  RMFGRAWPFRAPVEDGIVPLWPQLSNSLGVPCFSDEVATKWLNNPAVREAIHAEPESVTG  339

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCT +I+++HD+GSMI YH+NLT++GYRALI+SGDHDMCVPYTGS+AWTRS+GY+I+
Sbjct  340  PWELCTGRISYSHDAGSMIPYHRNLTTQGYRALIYSGDHDMCVPYTGSQAWTRSLGYQIV  399

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR W  NEQVAGY+Q Y  NLTFLT+KGAGHTVPEYKP+EAL FYTRWLEGK I
Sbjct  400  DEWRSWQSNEQVAGYLQAYQNNLTFLTVKGAGHTVPEYKPREALDFYTRWLEGKPI  455



>ref|XP_008218456.1| PREDICTED: serine carboxypeptidase-like 20 [Prunus mume]
Length=504

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPV DGIVP WPQL  S  VPC  D VAT WL++P VR+AIHAE E++ G
Sbjct  329  RMFGRAWPFRAPVEDGIVPLWPQLSNSLGVPCVSDEVATKWLNNPAVREAIHAEPESVAG  388

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCT++I+++HD+GSMI YH+NLT++GYRALI+SGDHDMCVPYTGS+AWTRS+GY+I+
Sbjct  389  PWELCTERISYSHDAGSMIPYHQNLTTQGYRALIYSGDHDMCVPYTGSQAWTRSLGYQIV  448

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR W  NEQVAGY+Q Y  NLTFLTIKGAGHTVPEYKP+EAL FYTRWLEGK I
Sbjct  449  DEWRSWQSNEQVAGYLQAYQNNLTFLTIKGAGHTVPEYKPREALDFYTRWLEGKPI  504



>ref|XP_011009329.1| PREDICTED: serine carboxypeptidase-like 20 [Populus euphratica]
Length=495

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPVR GIVPTWPQLL   +VPCTDD VAT+WL++  VRKAIHAE E+++G
Sbjct  320  RMFGRAWPFRAPVRPGIVPTWPQLLDGESVPCTDDEVATSWLNNEAVRKAIHAELESVSG  379

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I F HD+GSMIKYH+NLT +G+RALIFSGDHDMCVPYTGSEAWTRS+GY I+
Sbjct  380  TWELCTDRIRFHHDAGSMIKYHRNLTLKGFRALIFSGDHDMCVPYTGSEAWTRSMGYDIV  439

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N QVAGY QGY  NLTFLT+KGAGHTVPEYKP+EAL FY+R+L GK I
Sbjct  440  DEWRPWTSNGQVAGYTQGYANNLTFLTMKGAGHTVPEYKPREALDFYSRFLAGKPI  495



>ref|NP_001234691.1| wound-inducible carboxypeptidase precursor [Solanum lycopersicum]
 gb|AAF44708.1|AF242849_1 wound-inducible carboxypeptidase [Solanum lycopersicum]
Length=498

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP +APVR G VPTWP++L S  VPCTDD VAT WL++ +VRKAIHAE   + G
Sbjct  323  RMFGRAWPYKAPVRAGHVPTWPEILNSVEVPCTDDRVATLWLNNADVRKAIHAEPATVIG  382

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCTDKI   HDSGSMI YHKNLT+RGYRA+IFSGDHDMCVP+TGS  WT+S+GY I+
Sbjct  383  PWELCTDKIDLDHDSGSMIPYHKNLTARGYRAIIFSGDHDMCVPFTGSAVWTKSLGYPIV  442

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW VN+QVAG+IQGY  NL F+TIKGAGHTVPEYKP+EALAFY+RWLEGK I
Sbjct  443  DEWRPWYVNDQVAGFIQGYANNLIFMTIKGAGHTVPEYKPREALAFYSRWLEGKKI  498



>ref|XP_008443686.1| PREDICTED: serine carboxypeptidase 1-like isoform X2 [Cucumis 
melo]
Length=458

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 150/182 (82%), Gaps = 6/182 (3%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQS------GNVPCTDDTVATAWLSSPEVRKAIHAE  580
            RMFGRAWP RAPVRDGIVP WPQL QS        VPC +D VAT WL+   VR AIHAE
Sbjct  277  RMFGRAWPFRAPVRDGIVPLWPQLAQSHASTHESTVPCMNDEVATIWLNDESVRAAIHAE  336

Query  579  QEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRS  400
              ++TGP+ELCT +I++ HD+GSMI YH NLTS+GYRALIFSGDHDMCVPYTGS+AWT S
Sbjct  337  PRSVTGPWELCTQRISYDHDAGSMIPYHINLTSQGYRALIFSGDHDMCVPYTGSQAWTSS  396

Query  399  VGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            VGYKI+DEWRPW  N QVAGY+QGY +NLTFLTIKGAGHTVPEYKP+EAL FY+RWL G 
Sbjct  397  VGYKIVDEWRPWFTNSQVAGYLQGYQHNLTFLTIKGAGHTVPEYKPREALDFYSRWLHGN  456

Query  219  SI  214
            SI
Sbjct  457  SI  458



>ref|XP_008443685.1| PREDICTED: serine carboxypeptidase 1-like isoform X1 [Cucumis 
melo]
Length=499

 Score =   291 bits (744),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 150/182 (82%), Gaps = 6/182 (3%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQS------GNVPCTDDTVATAWLSSPEVRKAIHAE  580
            RMFGRAWP RAPVRDGIVP WPQL QS        VPC +D VAT WL+   VR AIHAE
Sbjct  318  RMFGRAWPFRAPVRDGIVPLWPQLAQSHASTHESTVPCMNDEVATIWLNDESVRAAIHAE  377

Query  579  QEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRS  400
              ++TGP+ELCT +I++ HD+GSMI YH NLTS+GYRALIFSGDHDMCVPYTGS+AWT S
Sbjct  378  PRSVTGPWELCTQRISYDHDAGSMIPYHINLTSQGYRALIFSGDHDMCVPYTGSQAWTSS  437

Query  399  VGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            VGYKI+DEWRPW  N QVAGY+QGY +NLTFLTIKGAGHTVPEYKP+EAL FY+RWL G 
Sbjct  438  VGYKIVDEWRPWFTNSQVAGYLQGYQHNLTFLTIKGAGHTVPEYKPREALDFYSRWLHGN  497

Query  219  SI  214
            SI
Sbjct  498  SI  499



>ref|XP_004139101.1| PREDICTED: serine carboxypeptidase 1-like [Cucumis sativus]
Length=502

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 6/182 (3%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN------VPCTDDTVATAWLSSPEVRKAIHAE  580
            RMFGRAWP RAPVRDGIVP WPQL +S N      VPC +D VAT WL+   VR AIHAE
Sbjct  321  RMFGRAWPFRAPVRDGIVPLWPQLARSHNITHESTVPCMNDEVATIWLNDESVRAAIHAE  380

Query  579  QEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRS  400
             +++TG +ELCTD+I++ HD+GSMI YH NLTS+GYRALIFSGDHDMCVPYTG++AWT S
Sbjct  381  PQSVTGAWELCTDRISYDHDAGSMIPYHINLTSQGYRALIFSGDHDMCVPYTGTQAWTSS  440

Query  399  VGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            +GYKI+DEWRPW  N QVAGY+QGY++NLTFLTIKGAGHTVPEYKP+EAL FY+RWL G 
Sbjct  441  IGYKIVDEWRPWFTNSQVAGYLQGYEHNLTFLTIKGAGHTVPEYKPREALDFYSRWLHGN  500

Query  219  SI  214
            SI
Sbjct  501  SI  502



>gb|AFK39478.1| unknown [Lotus japonicus]
Length=261

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 148/173 (86%), Gaps = 0/173 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVR+GIVPTWPQL+ S +VPCTDD VA  WL++  VRKAIH  + +L  
Sbjct  86   RMFGRAWPLRAPVREGIVPTWPQLMDSNDVPCTDDVVAKLWLNNEAVRKAIHTAKTSLVS  145

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCT +I + HD+GSMIKYHKNLTS+GYRALI+SGDHDMCVP+TGSE WTRS+GYKI+
Sbjct  146  QWDLCTGRIRYNHDAGSMIKYHKNLTSKGYRALIYSGDHDMCVPFTGSEVWTRSMGYKIV  205

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEG  223
            DEWRPW  N+QVAG+ QGYD NLTF+TIKGAGHTVPEYKP+EA  FYT +L G
Sbjct  206  DEWRPWFSNDQVAGFTQGYDKNLTFMTIKGAGHTVPEYKPREASEFYTHFLTG  258



>ref|XP_010095610.1| Serine carboxypeptidase-like 20 [Morus notabilis]
 gb|EXB61183.1| Serine carboxypeptidase-like 20 [Morus notabilis]
Length=499

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWPLRAPVR+GIVPTWPQLL S +VPCTDD VAT WL+   VRKA+H  +E+L 
Sbjct  323  TRMFGRAWPLRAPVREGIVPTWPQLLNSNSVPCTDDEVATTWLNDETVRKALHVAEESLV  382

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +ELCT +IT+ HDSGSMI YH+N+TSRGYRALI+SGDHDMCVP+TGSEAWTRS+ Y+I
Sbjct  383  GSWELCTGRITYYHDSGSMIPYHRNITSRGYRALIYSGDHDMCVPFTGSEAWTRSLDYQI  442

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N QVAGY QGY++NLTFLT+KG+GHTVPEYKP+EA   Y+R+L G+ +
Sbjct  443  VDEWRPWFSNGQVAGYTQGYEHNLTFLTVKGSGHTVPEYKPREAFDLYSRFLAGRPL  499



>ref|XP_008794935.1| PREDICTED: serine carboxypeptidase 1-like [Phoenix dactylifera]
Length=499

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGR+WPLRAPVRDG VPTWP+L  S +VPC  D VAT+WL++ EVR AIHA+  +L G
Sbjct  325  RMFGRSWPLRAPVRDGYVPTWPEL-GSSSVPCMSDEVATSWLNNEEVRSAIHAQPASLVG  383

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCT KI F+HD+GSMIKYH+NLT +GYRALIFSGDHDMCVP+TGSEAWTRS+G++I+
Sbjct  384  PWELCTGKIYFSHDAGSMIKYHRNLTEQGYRALIFSGDHDMCVPFTGSEAWTRSLGFRIV  443

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  +EQVAGYIQGY++NLTFLTIKGAGHTVPEYKP EAL FY+RWL    I
Sbjct  444  DEWRPWFFDEQVAGYIQGYEHNLTFLTIKGAGHTVPEYKPGEALTFYSRWLASTKI  499



>ref|XP_008235895.1| PREDICTED: serine carboxypeptidase-like 20 [Prunus mume]
Length=504

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVPTWP+L+ S +VPCTDD VAT+WL++  VRKAIHA  E+L  
Sbjct  329  RMFGRAWPLRAPVRDGIVPTWPELMNSEDVPCTDDEVATSWLNNETVRKAIHAAGESLVP  388

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT  I FTHD+GSMIKYHKNLT++GYRALI+SGDHDMCVP+TGSEAWTRS+GYK++
Sbjct  389  SWELCTSGIRFTHDAGSMIKYHKNLTAKGYRALIYSGDHDMCVPFTGSEAWTRSLGYKVV  448

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N QVAGY QGY+ NLTFLT+KG+GHTVPEYKP+EA   ++R+L G+ +
Sbjct  449  DEWRPWTSNGQVAGYTQGYENNLTFLTVKGSGHTVPEYKPREAFDLFSRFLAGQPL  504



>ref|XP_007199794.1| hypothetical protein PRUPE_ppa004538mg [Prunus persica]
 gb|EMJ00993.1| hypothetical protein PRUPE_ppa004538mg [Prunus persica]
Length=504

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVPTWP+L+ S +VPCTDD VAT+WL++  VRKAIHA  E+L  
Sbjct  329  RMFGRAWPLRAPVRDGIVPTWPELMNSEDVPCTDDEVATSWLNNETVRKAIHAAGESLVP  388

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT  I FTHD+GSMIKYHKNLT++GYRALI+SGDHDMCVP+TGSEAWTRS+GYK++
Sbjct  389  SWELCTGGIRFTHDAGSMIKYHKNLTAKGYRALIYSGDHDMCVPFTGSEAWTRSLGYKVV  448

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N QVAGY QGY+ NLTFLT+KG+GHTVPEYKP+EA   ++R+L G+ +
Sbjct  449  DEWRPWTSNGQVAGYTQGYENNLTFLTVKGSGHTVPEYKPREAFDLFSRFLAGQPL  504



>ref|XP_007134260.1| hypothetical protein PHAVU_010G032200g [Phaseolus vulgaris]
 ref|XP_007134261.1| hypothetical protein PHAVU_010G032200g [Phaseolus vulgaris]
 gb|ESW06254.1| hypothetical protein PHAVU_010G032200g [Phaseolus vulgaris]
 gb|ESW06255.1| hypothetical protein PHAVU_010G032200g [Phaseolus vulgaris]
Length=497

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQ-SGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            RMFGRAWPLRAPVRDGIVPTWPQL+    + PCTDD VA AWL+   VR AIHA QE+  
Sbjct  321  RMFGRAWPLRAPVRDGIVPTWPQLMNLQLSPPCTDDVVANAWLNDEAVRTAIHAAQESEI  380

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +++CTD+ITF HD+GSMI YHKNLTS+GYRALIFSGDHDMCVPYTGS+AWTRS+GYKI
Sbjct  381  GSWDICTDRITFDHDAGSMINYHKNLTSKGYRALIFSGDHDMCVPYTGSQAWTRSIGYKI  440

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N QVAGY QGYD NLTFLTIKG+GHTVPEYKP EAL FY R+L G  I
Sbjct  441  VDEWRPWSSNGQVAGYTQGYDKNLTFLTIKGSGHTVPEYKPVEALDFYKRFLAGIPI  497



>ref|XP_006414998.1| hypothetical protein EUTSA_v10025701mg [Eutrema salsugineum]
 gb|ESQ56451.1| hypothetical protein EUTSA_v10025701mg [Eutrema salsugineum]
Length=327

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAPVR GIVP+W QLL   +VPC DD VATAWL+ P +R AIHA++E   G
Sbjct  152  RMFGRAWPVRAPVRPGIVPSWSQLLADVSVPCIDDRVATAWLNDPAIRNAIHAKEENEIG  211

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LC+ K++F HD+GSMIK+HKNLT  GYRALI+SGDHDMCVP+TGS+AWTRS+GYK+I
Sbjct  212  RWVLCSGKLSFDHDAGSMIKFHKNLTLSGYRALIYSGDHDMCVPFTGSQAWTRSLGYKVI  271

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI N+QVAGY QGY  NLTFLTIKGAGHTVPEYKP+EAL FY+R+LEG  I
Sbjct  272  DEWRAWISNDQVAGYTQGYANNLTFLTIKGAGHTVPEYKPREALDFYSRFLEGSKI  327



>ref|XP_003547759.1| PREDICTED: serine carboxypeptidase-like 20-like isoformX1 [Glycine 
max]
 ref|XP_006599137.1| PREDICTED: serine carboxypeptidase-like 20-like isoform X2 [Glycine 
max]
 ref|XP_006599138.1| PREDICTED: serine carboxypeptidase-like 20-like isoform X3 [Glycine 
max]
 ref|XP_006599139.1| PREDICTED: serine carboxypeptidase-like 20-like isoform X4 [Glycine 
max]
 gb|KHN04567.1| Serine carboxypeptidase-like 20 [Glycine soja]
Length=498

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 150/177 (85%), Gaps = 1/177 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVP-CTDDTVATAWLSSPEVRKAIHAEQEALT  565
            RMFGRAWPLRAPVRDGIVPTWPQL+ S + P CTDD VA +WL++  VR AIH  Q+++ 
Sbjct  322  RMFGRAWPLRAPVRDGIVPTWPQLMNSKSAPPCTDDEVANSWLNNEAVRTAIHTAQKSVV  381

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
              ++LCTD+I F HD+GSMIKYHKNLTS+GYRALIFSGDHDMCVPYTGS+ WTRSVGYKI
Sbjct  382  SSWDLCTDRIYFDHDAGSMIKYHKNLTSKGYRALIFSGDHDMCVPYTGSQVWTRSVGYKI  441

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N QVAGY QGYD NLTFLT+KG+GHTVPEYKP+EAL FY R+L G  I
Sbjct  442  VDEWRPWSSNGQVAGYTQGYDKNLTFLTVKGSGHTVPEYKPREALDFYKRFLAGLPI  498



>ref|XP_009416609.1| PREDICTED: serine carboxypeptidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 153/176 (87%), Gaps = 2/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            R+FGR+WPLRAPVR+G VPTWP+L  S  VPC DD VAT+WL++  VR AIHA+  ++ G
Sbjct  323  RIFGRSWPLRAPVREGHVPTWPELGSS--VPCMDDEVATSWLNNEAVRSAIHAQPVSVVG  380

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCTD I+F HD+GSMIKYHKNLT  GYRALIFSGDHDMCVPYTGS+AWTRS+GY+++
Sbjct  381  PWELCTDNISFQHDAGSMIKYHKNLTYGGYRALIFSGDHDMCVPYTGSQAWTRSLGYQVL  440

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  ++QVAGY QGY++NLTFLTIKG+GHTVPEYKP+EALAFY RWL G SI
Sbjct  441  DEWRPWYFDKQVAGYTQGYEHNLTFLTIKGSGHTVPEYKPREALAFYARWLAGGSI  496



>ref|XP_003552449.1| PREDICTED: serine carboxypeptidase-like 20-like isoform 1 [Glycine 
max]
Length=506

 Score =   283 bits (725),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPV+ G+VP WPQL Q+ +V C  D VA++WL++  VRKAIHAE E + G
Sbjct  331  RMFGRAWPFRAPVKPGLVPLWPQLAQTRHVACVSDEVASSWLNNVAVRKAIHAESEKVAG  390

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELC+ +I + H++GSMI YHKNLT  GYRALIFSGDHDMCVP+TGSEAWTRS+GYKI+
Sbjct  391  PWELCSSRIEYHHNAGSMIPYHKNLTRLGYRALIFSGDHDMCVPFTGSEAWTRSLGYKIV  450

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N QVAGY+Q Y+ NLTFLTIKGAGHTVPEYKP+EAL FY+RWLEGK I
Sbjct  451  DEWRPWNSNNQVAGYLQAYENNLTFLTIKGAGHTVPEYKPREALDFYSRWLEGKLI  506



>ref|XP_004290128.1| PREDICTED: serine carboxypeptidase-like 20 [Fragaria vesca subsp. 
vesca]
Length=496

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVR G+VPTWPQL+ S  VPCTDD VATAWL++  VRKAIHAE  ++  
Sbjct  321  RMFGRAWPLRAPVRAGLVPTWPQLMNSEEVPCTDDEVATAWLNNAAVRKAIHAEDASVIP  380

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD I F HD+GSMI YHKNLTS+GYRALI+SGDHD+CVP+TGSEAWTRS+GYKI+
Sbjct  381  SWELCTDNIRFYHDAGSMIPYHKNLTSKGYRALIYSGDHDLCVPFTGSEAWTRSLGYKIV  440

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW    Q+AGY QGY+ NLTF T+KG+GHTVPEYKP+EAL  Y+R+L GK +
Sbjct  441  DEWRPWTSKGQIAGYTQGYEKNLTFSTVKGSGHTVPEYKPQEALDLYSRFLAGKPL  496



>ref|XP_006283616.1| hypothetical protein CARUB_v10004672mg [Capsella rubella]
 gb|EOA16514.1| hypothetical protein CARUB_v10004672mg [Capsella rubella]
Length=491

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAPVR GIVP+W QLL +  VPC DD VATAWL+ P +RKAIHA++E+  G
Sbjct  316  RMFGRAWPIRAPVRPGIVPSWSQLLANLRVPCIDDRVATAWLNDPAIRKAIHAKEESEIG  375

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTDK+ F+HD+GSMI +H+NLT  GYRALI+SGDHDMCVP+TGS+AWT S+GYK+ 
Sbjct  376  KWELCTDKLAFSHDAGSMIPFHRNLTLSGYRALIYSGDHDMCVPFTGSQAWTESLGYKVT  435

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ N+QVAG+ QGY  NLTFLTIKGAGHTVPEYKP+EAL FY+R+L G  I
Sbjct  436  DEWRPWMSNDQVAGFTQGYANNLTFLTIKGAGHTVPEYKPREALNFYSRFLAGSKI  491



>gb|AFK43037.1| unknown [Medicago truncatula]
Length=175

 Score =   271 bits (692),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 148/177 (84%), Gaps = 4/177 (2%)
 Frame = -2

Query  738  MFGRAWPLRAPVRDGIVPTWPQLL--QSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            MFGRAWP RAPVRDG+V  WPQL+  Q  +VPC +D VAT WL++  VRKAIH ++   +
Sbjct  1    MFGRAWPFRAPVRDGLVTLWPQLMAAQRRHVPCVNDEVATTWLNNDAVRKAIHVDKA--S  58

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G ++LCTD+I+F HD+G MI YHKNLT  GYRALIFSGDHDMCVP+TGSEAWTRS+GYK+
Sbjct  59   GAWQLCTDRISFRHDAGGMIPYHKNLTRLGYRALIFSGDHDMCVPFTGSEAWTRSLGYKV  118

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWR WI N+QVAGY+Q Y+ NLTFLT+KG+GHTVPEYKP+EAL FY RWL GKSI
Sbjct  119  VDEWRSWISNDQVAGYLQAYENNLTFLTVKGSGHTVPEYKPREALDFYNRWLGGKSI  175



>ref|XP_004492844.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=504

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 149/180 (83%), Gaps = 6/180 (3%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLL----QSGNVPCTDDTVATAWLSSPEVRKAIHAEQE  574
            RMFGRAWP RAPVRDG V  WPQL+     S  VPC  D VAT WL+S EVRKAIHA +E
Sbjct  327  RMFGRAWPFRAPVRDGPVTLWPQLMAQMSHSSGVPCVSDEVATTWLNSNEVRKAIHASRE  386

Query  573  ALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVG  394
            A  G ++LC+DKI F HD+GSMI YHKNLT  GYRALIFSGDHDMCVP+TGSEAWTRS+G
Sbjct  387  A--GNWDLCSDKIIFEHDAGSMIPYHKNLTKLGYRALIFSGDHDMCVPFTGSEAWTRSLG  444

Query  393  YKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            YKI+DEWRPW  N+QVAGY+Q Y+ NLTF+TIKGAGHTVPEYKP+EAL FY RWLEG+SI
Sbjct  445  YKIVDEWRPWNSNDQVAGYLQAYENNLTFITIKGAGHTVPEYKPREALDFYRRWLEGESI  504



>ref|XP_010649230.1| PREDICTED: serine carboxypeptidase-like 20 [Vitis vinifera]
Length=496

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWP RAPV+DGI+P W +L++   +PCTDD VA+AWL+   VR AIHA+Q+ + 
Sbjct  320  TRMFGRAWPFRAPVKDGILPLWTELIKQNPIPCTDDQVASAWLNDKGVRTAIHAQQKDVI  379

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +E+CT ++ ++ DSGSM++YHKNLT++GYRALI+SGDHDMCVP+TGSEAWTRS+GYKI
Sbjct  380  GEWEICTGRLHYSSDSGSMLQYHKNLTAKGYRALIYSGDHDMCVPFTGSEAWTRSLGYKI  439

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWR WI N+QVAGY QGY++ LTFLTIKGAGHTVPEYKP+EAL F+ RWLEGK+I
Sbjct  440  MDEWRAWISNDQVAGYTQGYEHGLTFLTIKGAGHTVPEYKPREALDFFGRWLEGKAI  496



>ref|XP_006847478.1| hypothetical protein AMTR_s00163p00053930 [Amborella trichopoda]
 gb|ERN09059.1| hypothetical protein AMTR_s00163p00053930 [Amborella trichopoda]
Length=530

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 153/176 (87%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            R+FGRAWPLRAPVRDG+VPTWPQL ++  VPCTDD VA  WL+   VRKAIHA+ E ++G
Sbjct  356  RIFGRAWPLRAPVRDGLVPTWPQLGKN-LVPCTDDEVAHVWLNDEGVRKAIHAQPEKVSG  414

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +E+CTD+I+F HD+GSMI YHKNLT++GYRALI+SGDHDMCVPYTGSEAWTRS+GY I 
Sbjct  415  SWEICTDRISFMHDAGSMINYHKNLTAKGYRALIYSGDHDMCVPYTGSEAWTRSLGYDIT  474

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW +N+QV G+ QGY+ NLTF+TIKGAGHTVPEYKP+EALAF++RWL G  I
Sbjct  475  DEWRPWYLNDQVVGFTQGYENNLTFITIKGAGHTVPEYKPREALAFFSRWLGGIPI  530



>emb|CBI17613.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWP RAPV+DGI+P W +L++   +PCTDD VA+AWL+   VR AIHA+Q+ + 
Sbjct  306  TRMFGRAWPFRAPVKDGILPLWTELIKQNPIPCTDDQVASAWLNDKGVRTAIHAQQKDVI  365

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +E+CT ++ ++ DSGSM++YHKNLT++GYRALI+SGDHDMCVP+TGSEAWTRS+GYKI
Sbjct  366  GEWEICTGRLHYSSDSGSMLQYHKNLTAKGYRALIYSGDHDMCVPFTGSEAWTRSLGYKI  425

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWR WI N+QVAGY QGY++ LTFLTIKGAGHTVPEYKP+EAL F+ RWLEGK+I
Sbjct  426  MDEWRAWISNDQVAGYTQGYEHGLTFLTIKGAGHTVPEYKPREALDFFGRWLEGKAI  482



>gb|AAM97031.1| serine carboxypeptidase 1 precursor-like protein [Arabidopsis 
thaliana]
 gb|AAN15500.1| serine carboxypeptidase 1 precursor-like protein [Arabidopsis 
thaliana]
Length=497

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAPV  GIVP+W QLL    VPC DD VATAWL+ PE+RKAIH ++E+  G
Sbjct  322  RMFGRAWPVRAPVHPGIVPSWSQLLADVTVPCIDDRVATAWLNDPEIRKAIHTKEESEIG  381

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELC+ K++F HD+GSMI +H+NLT  GYRALI+SGDHDMCVP+TGSEAWT+S+GYK+I
Sbjct  382  RWELCSGKLSFYHDAGSMIDFHRNLTLSGYRALIYSGDHDMCVPFTGSEAWTKSLGYKVI  441

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI N+QVAGY QGY  NLTFLTIKGAGHTVPEYKP+EAL FY+R+LEG  I
Sbjct  442  DEWRAWISNDQVAGYTQGYANNLTFLTIKGAGHTVPEYKPREALDFYSRFLEGSKI  497



>ref|NP_193027.5| serine carboxypeptidase-like 20 [Arabidopsis thaliana]
 sp|Q8L7B2.2|SCP20_ARATH RecName: Full=Serine carboxypeptidase-like 20; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE83202.1| serine carboxypeptidase-like 20 [Arabidopsis thaliana]
Length=497

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAPV  GIVP+W QLL    VPC DD VATAWL+ PE+RKAIH ++E+  G
Sbjct  322  RMFGRAWPVRAPVHPGIVPSWSQLLADVTVPCIDDRVATAWLNDPEIRKAIHTKEESEIG  381

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELC+ K++F HD+GSMI +H+NLT  GYRALI+SGDHDMCVP+TGSEAWT+S+GYK+I
Sbjct  382  RWELCSGKLSFYHDAGSMIDFHRNLTLSGYRALIYSGDHDMCVPFTGSEAWTKSLGYKVI  441

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI N+QVAGY QGY  NLTFLTIKGAGHTVPEYKP+EAL FY+R+LEG  I
Sbjct  442  DEWRAWISNDQVAGYTQGYANNLTFLTIKGAGHTVPEYKPREALDFYSRFLEGSKI  497



>ref|XP_009358971.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358972.1| PREDICTED: serine carboxypeptidase-like 20 isoform X2 [Pyrus 
x bretschneideri]
Length=494

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 3/174 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVPTWP+L+ S  VPCTDD VAT WL++  VRKAIHAE +    
Sbjct  322  RMFGRAWPLRAPVRDGIVPTWPELMNSEEVPCTDDEVATEWLNNETVRKAIHAETDP---  378

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +I F HDSGSMIKYH+NLT++GYRALIFSGDHDMCVP+TGS+AWTRS+GYKI+
Sbjct  379  SWELCTSRIRFYHDSGSMIKYHRNLTAKGYRALIFSGDHDMCVPFTGSQAWTRSLGYKIV  438

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            DEWRPW  N QVAGY Q Y+ NLTFLT+KG+GHTVPEYKP+EAL  ++R+L GK
Sbjct  439  DEWRPWTSNGQVAGYTQAYENNLTFLTVKGSGHTVPEYKPREALDLFSRFLAGK  492



>ref|XP_006428612.1| hypothetical protein CICLE_v10013875mg [Citrus clementina]
 gb|ESR41852.1| hypothetical protein CICLE_v10013875mg [Citrus clementina]
Length=499

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 154/195 (79%), Gaps = 19/195 (10%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQS-------------------GNVPCTDDTVATAW  619
            R+FGRAWP RAPVR+G VPTWP++L+                    G VPCTDD VA  W
Sbjct  305  RIFGRAWPFRAPVREGHVPTWPEILRDYQANVLNNANADSDSNALHGYVPCTDDEVARTW  364

Query  618  LSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDM  439
            L++ EVRKAIHA  E+ TG +ELC+D + ++HD+GSMI YHKNLT +G+RALI+SGDHDM
Sbjct  365  LNNAEVRKAIHAAPESATGAWELCSDNLDYSHDTGSMIPYHKNLTMQGFRALIYSGDHDM  424

Query  438  CVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPK  259
            CVPYTGS+AWT S+GYK +DEWRPW  N+QVAGY+QGYD+NLTFLTIKGAGHTVPEYKP+
Sbjct  425  CVPYTGSQAWTSSLGYKTLDEWRPWTSNDQVAGYLQGYDHNLTFLTIKGAGHTVPEYKPR  484

Query  258  EALAFYTRWLEGKSI  214
            E+L FY+RWLEGK I
Sbjct  485  ESLDFYSRWLEGKPI  499



>gb|KHN40479.1| Serine carboxypeptidase-like 20 [Glycine soja]
Length=506

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPV+ G+V  WPQL Q+ +V C  D VA++WL++  VRKAIHAE E + G
Sbjct  331  RMFGRAWPFRAPVKPGLVTLWPQLAQTRHVACVSDEVASSWLNNVAVRKAIHAESEKVAG  390

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELC+ +I + H++GSMI YHKNLT  GYRALIFSGDHDMCVP+TGSEAWTRS+GYKI+
Sbjct  391  PWELCSSRIEYHHNAGSMIPYHKNLTRLGYRALIFSGDHDMCVPFTGSEAWTRSLGYKIV  450

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N QVAGY+Q Y+ NLTFLTIKGAGHTVPEYKP+EAL FY+RWLEGK I
Sbjct  451  DEWRPWNSNNQVAGYLQAYENNLTFLTIKGAGHTVPEYKPREALDFYSRWLEGKLI  506



>ref|XP_006480515.1| PREDICTED: serine carboxypeptidase-like 20-like [Citrus sinensis]
Length=528

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 154/195 (79%), Gaps = 19/195 (10%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQS-------------------GNVPCTDDTVATAW  619
            R+FGRAWP RAPVR+G VPTWP++L+                    G VPCTDD VA  W
Sbjct  334  RIFGRAWPFRAPVREGHVPTWPEILRDYQANVLNNANADSDSNALHGYVPCTDDEVARTW  393

Query  618  LSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDM  439
            L++ EVRKAIHA  E+ TG +ELC+D + ++HD+GSMI YHKNLT +G+RALI+SGDHDM
Sbjct  394  LNNAEVRKAIHAAPESATGAWELCSDNLDYSHDTGSMIPYHKNLTMQGFRALIYSGDHDM  453

Query  438  CVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPK  259
            CVPYTGS+AWT S+GYK +DEWRPW  N+QVAGY+QGYD+NLTFLTIKGAGHTVPEYKP+
Sbjct  454  CVPYTGSQAWTSSLGYKTLDEWRPWTSNDQVAGYLQGYDHNLTFLTIKGAGHTVPEYKPR  513

Query  258  EALAFYTRWLEGKSI  214
            E+L FY+RWLEGK I
Sbjct  514  ESLDFYSRWLEGKPI  528



>ref|XP_010435332.1| PREDICTED: serine carboxypeptidase-like 20 [Camelina sativa]
Length=495

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAPVR GIVP W QLL    VPC DD VATAWL+ P VRKAIHA++E+  G
Sbjct  320  RMFGRAWPVRAPVRPGIVPRWSQLLADITVPCIDDRVATAWLNDPAVRKAIHAKEESEIG  379

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELC+ K++F HD+GSMI +H+NLT  GY+ALI+SGDHDMCVP+TGS+AWTRS+GYK+I
Sbjct  380  RWELCSGKLSFEHDAGSMITFHRNLTLSGYKALIYSGDHDMCVPFTGSQAWTRSLGYKVI  439

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPWI N QVAGY QGY  NLTFLTIKGAGHTVPEYKP+E+L FY+R+L G  I
Sbjct  440  DEWRPWISNNQVAGYTQGYANNLTFLTIKGAGHTVPEYKPRESLDFYSRFLAGSMI  495



>ref|XP_006366827.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=492

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWP  APVR+G+VP+WP+LL   NV CTDDTVATAWL++ +VRKAIHAE   +T
Sbjct  317  TRMFGRAWPFNAPVREGLVPSWPELLDHNNVFCTDDTVATAWLNNEDVRKAIHAEPATVT  376

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ELC   + FTHD+GSMI YHKNLT++GYRALI+SGDHDMCVPYTGSE WT S+GY I
Sbjct  377  GPWELC-KHLNFTHDAGSMIPYHKNLTTQGYRALIYSGDHDMCVPYTGSEKWTSSLGYAI  435

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW   E++ GY QGY  NLTFLTIKG+GHTVPEYKP+E+L FY  WL+GK I
Sbjct  436  VDEWRPWYTKEKIQGYTQGYANNLTFLTIKGSGHTVPEYKPQESLYFYDSWLQGKKI  492



>gb|KDP26878.1| hypothetical protein JCGZ_18036 [Jatropha curcas]
Length=489

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 151/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL A V+DGIVP+WP+L + G+V C +D +AT WL+   VR AIHA+ +++ G
Sbjct  314  RMFGRAWPLWAAVKDGIVPSWPELAKQGSVGCMNDEIATTWLNDKLVRAAIHAKPKSIAG  373

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCT ++ + HD GSMI YHK LTS GYRALIFSGDHDMCVP+TGS+AWT+S+GYKII
Sbjct  374  PWELCTHRLLYRHDVGSMIPYHKTLTSLGYRALIFSGDHDMCVPFTGSQAWTKSLGYKII  433

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR W+ N QVAGY+QGY++NLTFLT+KGAGHTVPEYKP+EAL FYTRWL+GKSI
Sbjct  434  DEWRSWVSNNQVAGYLQGYEHNLTFLTVKGAGHTVPEYKPREALDFYTRWLDGKSI  489



>ref|XP_008365929.1| PREDICTED: serine carboxypeptidase-like 20 [Malus domestica]
Length=494

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 149/174 (86%), Gaps = 3/174 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVPTWP+L+ S +VPC +D VAT WL++  VRKAIHAE +    
Sbjct  322  RMFGRAWPLRAPVRDGIVPTWPELMDSESVPCINDEVATEWLNNETVRKAIHAETDF---  378

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +I F HDSGSMIKYHKNLT++GYRALI+SGDHDMCVP+TGSEAWTRS+GYKI+
Sbjct  379  SWELCTSRIEFYHDSGSMIKYHKNLTAKGYRALIYSGDHDMCVPFTGSEAWTRSLGYKIV  438

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            DEWRPW  N QVAGY QGY+ NLTFLT+KG+GHTVPEYKP+EA   ++R+L GK
Sbjct  439  DEWRPWTSNGQVAGYTQGYENNLTFLTVKGSGHTVPEYKPREAFDLFSRFLAGK  492



>ref|XP_010649231.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Vitis 
vinifera]
Length=496

 Score =   278 bits (711),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWP  APV+DGI+P WP+L++   +PCTDD VA+ WL+   VR AIHA+Q+ + 
Sbjct  320  TRMFGRAWPFHAPVKDGILPLWPELMKKKTIPCTDDQVASVWLNDKGVRTAIHAQQKDVI  379

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +E+CT ++ ++ DSGSM++YHK+LT+ GY+ALI+SGDHDMCVP+TGSEAWTRS+GYKI
Sbjct  380  GEWEICTGRLYYSSDSGSMLQYHKSLTAEGYQALIYSGDHDMCVPFTGSEAWTRSLGYKI  439

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWR WI N+QVAGY QGY++ LTFLTIKGAGHTVPEYKPKEAL F++RWL+GK+I
Sbjct  440  VDEWRAWISNDQVAGYTQGYEHGLTFLTIKGAGHTVPEYKPKEALDFFSRWLDGKAI  496



>ref|XP_003624187.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES80405.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=498

 Score =   278 bits (711),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 151/178 (85%), Gaps = 4/178 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLL--QSGNVPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            RMFGRAWP RAPVRDG+V  WPQL+  Q  +VPC +D VAT WL++  VRKAIH ++   
Sbjct  323  RMFGRAWPFRAPVRDGLVTLWPQLMAAQRRHVPCVNDEVATTWLNNDAVRKAIHVDKA--  380

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
            +G ++LCTD+I+F HD+G MI YHKNLT  GYRALIFSGDHDMCVP+TGSEAWTRS+GYK
Sbjct  381  SGAWQLCTDRISFRHDAGGMIPYHKNLTRLGYRALIFSGDHDMCVPFTGSEAWTRSLGYK  440

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            ++DEWR WI N+QVAGY+Q Y+ NLTFLT+KG+GHTVPEYKP+EAL FY+RWLEGKSI
Sbjct  441  VVDEWRSWISNDQVAGYLQAYENNLTFLTVKGSGHTVPEYKPREALDFYSRWLEGKSI  498



>ref|XP_010649232.1| PREDICTED: serine carboxypeptidase-like 20 isoform X2 [Vitis 
vinifera]
Length=490

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWP  APV+DGI+P WP+L++   +PCTDD VA+ WL+   VR AIHA+Q+ + 
Sbjct  314  TRMFGRAWPFHAPVKDGILPLWPELMKKKTIPCTDDQVASVWLNDKGVRTAIHAQQKDVI  373

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +E+CT ++ ++ DSGSM++YHK+LT+ GY+ALI+SGDHDMCVP+TGSEAWTRS+GYKI
Sbjct  374  GEWEICTGRLYYSSDSGSMLQYHKSLTAEGYQALIYSGDHDMCVPFTGSEAWTRSLGYKI  433

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWR WI N+QVAGY QGY++ LTFLTIKGAGHTVPEYKPKEAL F++RWL+GK+I
Sbjct  434  VDEWRAWISNDQVAGYTQGYEHGLTFLTIKGAGHTVPEYKPKEALDFFSRWLDGKAI  490



>emb|CBI17614.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWP  APV+DGI+P WP+L++   +PCTDD VA+ WL+   VR AIHA+Q+ + 
Sbjct  358  TRMFGRAWPFHAPVKDGILPLWPELMKKKTIPCTDDQVASVWLNDKGVRTAIHAQQKDVI  417

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G +E+CT ++ ++ DSGSM++YHK+LT+ GY+ALI+SGDHDMCVP+TGSEAWTRS+GYKI
Sbjct  418  GEWEICTGRLYYSSDSGSMLQYHKSLTAEGYQALIYSGDHDMCVPFTGSEAWTRSLGYKI  477

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWR WI N+QVAGY QGY++ LTFLTIKGAGHTVPEYKPKEAL F++RWL+GK+I
Sbjct  478  VDEWRAWISNDQVAGYTQGYEHGLTFLTIKGAGHTVPEYKPKEALDFFSRWLDGKAI  534



>gb|KHN29264.1| Serine carboxypeptidase-like 20 [Glycine soja]
Length=488

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRAWP RAPV+ G+V  WPQL ++ +V C  D VA++WL++  VRKAIHAE E + 
Sbjct  312  NRMFGRAWPFRAPVKPGLVTLWPQLTETSHVACVSDEVASSWLNNVAVRKAIHAESEKVA  371

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ELCT +I + H++GSMI YHKNLT  GY+ALIFSGDHDMCVP+TGSEAWTRS+ YKI
Sbjct  372  GPWELCTGRIEYHHNAGSMIPYHKNLTRLGYKALIFSGDHDMCVPFTGSEAWTRSLRYKI  431

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N QVAGY+Q Y+ NLTFLTIKGAGHTVPEYKP+EAL FY+RWLEGK I
Sbjct  432  VDEWRPWNSNNQVAGYLQAYENNLTFLTIKGAGHTVPEYKPREALDFYSRWLEGKQI  488



>tpg|DAA55429.1| TPA: hypothetical protein ZEAMMB73_969275 [Zea mays]
Length=295

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 145/182 (80%), Gaps = 5/182 (3%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQ-----SGNVPCTDDTVATAWLSSPEVRKAIHAE  580
            TRM GRAWPLRAPVRDG VP+W +L       S  VPC  D VATAWL++  VR AIHAE
Sbjct  114  TRMHGRAWPLRAPVRDGRVPSWQELAADVASTSSGVPCMSDEVATAWLNNNSVRSAIHAE  173

Query  579  QEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRS  400
              +  GP+ELCTDK+ F HD+GSMI YHKNLTS+GYRA I+SGDHDMCVPYTG+EAWT S
Sbjct  174  PVSSIGPWELCTDKLDFDHDAGSMIIYHKNLTSQGYRAFIYSGDHDMCVPYTGTEAWTAS  233

Query  399  VGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            +GY ++D WR WIV+EQVAGY QGY+  LTF TIKGAGHTVPEYKP+EALAFY+RWL G 
Sbjct  234  LGYAVVDPWRQWIVDEQVAGYTQGYEKGLTFATIKGAGHTVPEYKPQEALAFYSRWLAGA  293

Query  219  SI  214
             +
Sbjct  294  KL  295



>ref|XP_010111090.1| Serine carboxypeptidase-like 20 [Morus notabilis]
 gb|EXC29952.1| Serine carboxypeptidase-like 20 [Morus notabilis]
Length=499

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSG--NVPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            RMFGRAWP  APVRDG+VP WPQL      +VPC DD VA+ WL+   VR+AIHAE E++
Sbjct  322  RMFGRAWPFEAPVRDGLVPLWPQLAAGSRIHVPCFDDNVASTWLNDKAVREAIHAEPESV  381

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
            TG ++LCT +I + HD+GSMI YH+NLT +GYR L+FSGDHDMCVP+TGS+AWTRS+GY+
Sbjct  382  TGRWDLCTSRIQYYHDAGSMIPYHRNLTMQGYRVLVFSGDHDMCVPFTGSQAWTRSLGYQ  441

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            I+ EWRPWI N QVAGY+QGYD+NLTFLT+KGAGHTVPEYKP EAL FY+RWLE K I
Sbjct  442  IVAEWRPWISNSQVAGYVQGYDHNLTFLTVKGAGHTVPEYKPGEALDFYSRWLEEKPI  499



>ref|XP_003534508.1| PREDICTED: serine carboxypeptidase-like 20-like [Glycine max]
Length=506

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRAWP RAPV+ G+V  WPQL ++ +V C  D VA++WL++  VRKAIHAE E + 
Sbjct  330  NRMFGRAWPFRAPVKPGLVTLWPQLTETSHVACVSDEVASSWLNNVAVRKAIHAESEKVA  389

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ELCT +I + H++GSMI YHKNLT  GY+ALIFSGDHDMCVP+TGSEAWTRS+ YKI
Sbjct  390  GPWELCTGRIEYHHNAGSMIPYHKNLTRLGYKALIFSGDHDMCVPFTGSEAWTRSLRYKI  449

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N QVAGY+Q Y+ NLTFLTIKGAGHTVPEYKP+EAL FY+RWLEGK I
Sbjct  450  VDEWRPWNSNNQVAGYLQAYENNLTFLTIKGAGHTVPEYKPREALDFYSRWLEGKQI  506



>ref|XP_010323102.1| PREDICTED: serine carboxypeptidase-like 20 [Solanum lycopersicum]
Length=498

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 151/183 (83%), Gaps = 7/183 (4%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWPL APV++G+VP+WP+LL + +V CTDDTVATAWL++ +VRKAIHAE   +T
Sbjct  317  TRMFGRAWPLNAPVKEGLVPSWPELLDNHHVFCTDDTVATAWLNNEDVRKAIHAEPATVT  376

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ELC   + FTHD+GSM+ YHKNLT+RGYRALI+SGDHDMCVPYTGSE WT S+GY I
Sbjct  377  GPWELC-KHLNFTHDAGSMLPYHKNLTTRGYRALIYSGDHDMCVPYTGSEKWTSSLGYAI  435

Query  384  IDEWRPWIVNE------QVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEG  223
            +DEWRPW   +      QVAGY QGY  NLTFLTIKGAGHTVPEYKP+E+L FY  WL+G
Sbjct  436  VDEWRPWYTKDQIQGYVQVAGYTQGYANNLTFLTIKGAGHTVPEYKPRESLQFYDNWLQG  495

Query  222  KSI  214
            K I
Sbjct  496  KKI  498



>ref|XP_009334243.1| PREDICTED: serine carboxypeptidase-like 20 [Pyrus x bretschneideri]
Length=494

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 148/174 (85%), Gaps = 3/174 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVPTWP+L+ + +VPC +D VAT WL++  VRKAIHAE +    
Sbjct  322  RMFGRAWPLRAPVRDGIVPTWPELMDNESVPCINDEVATEWLNNESVRKAIHAETDF---  378

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +I F HDSGSMIKYH NLT++GYRALI+SGDHDMCVP+TGSEAWTRS+GYKI+
Sbjct  379  SWELCTSRIEFYHDSGSMIKYHMNLTAKGYRALIYSGDHDMCVPFTGSEAWTRSLGYKIV  438

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            DEWRPW  N QVAGY QGY+ NLTFLT+KG+GHTVPEYKP+EA   ++R+L GK
Sbjct  439  DEWRPWTSNGQVAGYTQGYENNLTFLTVKGSGHTVPEYKPREAFDLFSRFLAGK  492



>ref|XP_009340398.1| PREDICTED: serine carboxypeptidase-like 20 [Pyrus x bretschneideri]
Length=503

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 155/179 (87%), Gaps = 3/179 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN--VPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            RMFGRAWP  A V DGIVP+WPQL ++ N  VPC +D VAT WL++ EVR+AIHA+ E++
Sbjct  325  RMFGRAWPFLANVEDGIVPSWPQLAKTLNSRVPCVNDEVATLWLNTAEVREAIHAKPESV  384

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
             GP+ELCTD+IT++ D+GSMI YH+NLT++GYRALIFSGDHDMCVPYTGSEAWT S+GYK
Sbjct  385  AGPWELCTDRITYSRDAGSMIPYHQNLTTQGYRALIFSGDHDMCVPYTGSEAWTASLGYK  444

Query  387  IIDEWRPWI-VNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            I+DEWRPW+  ++Q+AGY+QGY  NLTFLT+KGAGHTVPEYKP+EAL F+ R+L+GK I
Sbjct  445  IVDEWRPWLSSDDQIAGYLQGYANNLTFLTVKGAGHTVPEYKPREALDFFQRFLDGKRI  503



>ref|XP_009340341.1| PREDICTED: serine carboxypeptidase-like 20 [Pyrus x bretschneideri]
Length=492

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 155/179 (87%), Gaps = 3/179 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN--VPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            RMFGRAWP  A V DGIVP+WPQL ++ N  VPC +D VAT WL++ EVR+AIHA+ E++
Sbjct  314  RMFGRAWPFLANVEDGIVPSWPQLAKTLNSRVPCVNDEVATLWLNTAEVREAIHAKPESV  373

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
             GP+ELCTD+IT++ D+GSMI YH+NLT++GYRALIFSGDHDMCVPYTGSEAWT S+GYK
Sbjct  374  AGPWELCTDRITYSRDAGSMIPYHQNLTTQGYRALIFSGDHDMCVPYTGSEAWTASLGYK  433

Query  387  IIDEWRPWI-VNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            I+DEWRPW+  ++Q+AGY+QGY  NLTFLT+KGAGHTVPEYKP+EAL F+ R+L+GK I
Sbjct  434  IVDEWRPWLSSDDQIAGYLQGYANNLTFLTVKGAGHTVPEYKPREALDFFQRFLDGKRI  492



>gb|KFK23486.1| hypothetical protein AALP_AAs46213U000900 [Arabis alpina]
Length=492

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAPVR GIVP+W QLL   +VPC DDTVATAWL+ P  RKA+H ++ +  G
Sbjct  317  RMFGRAWPVRAPVRPGIVPSWYQLLADISVPCIDDTVATAWLNDPATRKALHTKEISEIG  376

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +++F+HD+GSMI++H+NLT  GYRALI+SGDHDMCVP+TGS+AWTRS+GYK++
Sbjct  377  SWELCTGQLSFSHDAGSMIRFHRNLTLSGYRALIYSGDHDMCVPFTGSQAWTRSIGYKVV  436

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI + QVAGY QGY  NLTFLTIKGAGHTVPEYKP+EAL FY+R+L G  I
Sbjct  437  DEWRAWISSNQVAGYTQGYANNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGNKI  492



>ref|XP_008451218.1| PREDICTED: serine carboxypeptidase-like 20 [Cucumis melo]
Length=485

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 151/176 (86%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVR GIVP+W +LL +  VPCT+D VATAWL++  VRKAIHA+  +L G
Sbjct  311  RMFGRAWPLRAPVRAGIVPSWSKLLDNLEVPCTNDEVATAWLNNEAVRKAIHADT-SLVG  369

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTDK+ F HD+GSMI +H+NLT +GYRALIFSGDHDMCVP+TGSEAW RS+GYK+ 
Sbjct  370  TWDLCTDKLEFDHDAGSMIPFHRNLTLKGYRALIFSGDHDMCVPFTGSEAWVRSLGYKVN  429

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW+ NEQVAGY++GY+ NL FLTIKG+GHTVPEYKP+EAL FY R+L G+SI
Sbjct  430  DPWRPWMSNEQVAGYLRGYENNLMFLTIKGSGHTVPEYKPREALDFYQRFLAGESI  485



>ref|XP_009139654.1| PREDICTED: serine carboxypeptidase-like 20 [Brassica rapa]
Length=492

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAP+  GIVP+W QLL   +VPC DD VATAWL+ P +RKAIHA++E+  G
Sbjct  317  RMFGRAWPVRAPILPGIVPSWSQLLADVSVPCIDDRVATAWLNDPAIRKAIHAKEESEIG  376

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT K+ F HD+GSMI +H+NLT  GYRALI+SGDHDMCVP+TGSEAWT S+GYK+I
Sbjct  377  RWELCTGKLWFHHDAGSMISFHRNLTLSGYRALIYSGDHDMCVPFTGSEAWTHSLGYKVI  436

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI N+QVAGY +GY  NLTFLTIKGAGHTVPEYKP+EAL FY+R+L G  I
Sbjct  437  DEWRAWISNDQVAGYTEGYANNLTFLTIKGAGHTVPEYKPREALDFYSRFLAGSKI  492



>ref|XP_007139719.1| hypothetical protein PHAVU_008G053600g [Phaseolus vulgaris]
 gb|ESW11713.1| hypothetical protein PHAVU_008G053600g [Phaseolus vulgaris]
Length=501

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPV+ G+V  WPQL ++ +V C +D VA++WL++  VRKAIHAE E + G
Sbjct  326  RMFGRAWPFRAPVKAGLVTLWPQLAETRHVACVNDEVASSWLNNEAVRKAIHAESENVAG  385

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +I + HD+GSMI YH+NLT +GY+ALIFSGDHDMCVP+TGSEAWTR++GYKI+
Sbjct  386  AWELCTSRIQYHHDAGSMIPYHRNLTKQGYKALIFSGDHDMCVPFTGSEAWTRALGYKIV  445

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N+QVAGY+Q Y+ NLTFLTIKGAGHTVPEYKP+EAL F + WLEGK I
Sbjct  446  DEWRPWNSNDQVAGYLQAYENNLTFLTIKGAGHTVPEYKPREALDFLSHWLEGKKI  501



>ref|XP_008370931.1| PREDICTED: serine carboxypeptidase-like 20 [Malus domestica]
Length=505

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 155/179 (87%), Gaps = 3/179 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN--VPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            RMFGRAWP  A V DGIVP+WPQL ++ N  VPC +D VAT WL++PEVR+AIHA+ E++
Sbjct  327  RMFGRAWPFLANVEDGIVPSWPQLAKTLNSRVPCVNDEVATLWLNTPEVREAIHAKPESV  386

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
             GP+ELCTD+IT++ D+GSMI YH+NLT++GYRALIFSGDHDMCVPYTGSEAWT S+GYK
Sbjct  387  AGPWELCTDRITYSRDAGSMIPYHQNLTTQGYRALIFSGDHDMCVPYTGSEAWTASLGYK  446

Query  387  IIDEWRPWI-VNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            I+DEWRPW+  ++QVAGY+QGY  +LTFLT+KGAGHTVPEYKP+EAL F+ R+L+ K I
Sbjct  447  IVDEWRPWLSSDDQVAGYLQGYANDLTFLTVKGAGHTVPEYKPREALDFFQRFLDEKRI  505



>gb|AGV54426.1| serine carboxypeptidase-like protein [Phaseolus vulgaris]
Length=502

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP RAPV+ G+V  WPQL ++ +V C +D VA++WL++  VRKAIHAE E + G
Sbjct  327  RMFGRAWPFRAPVKAGLVTLWPQLSETRHVACVNDEVASSWLNNEAVRKAIHAESENVAG  386

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT +I + HD+GSMI YH+NLT +GY+ALIFSGDHDMCVP+TGSEAWTR++GYKI+
Sbjct  387  AWELCTSRIQYHHDAGSMIPYHRNLTKQGYKALIFSGDHDMCVPFTGSEAWTRALGYKIV  446

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N+QVAGY+Q Y+ NLTFLTIKGAGHTVPEYKP+EAL F + WLEGK I
Sbjct  447  DEWRPWNSNDQVAGYLQAYENNLTFLTIKGAGHTVPEYKPREALDFLSHWLEGKKI  502



>dbj|BAB01313.1| serine carboxypeptidase I [Arabidopsis thaliana]
Length=504

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL A VR GIVP+W QLL    VPC DDTVAT WL+ P VRKA+HA++E   G
Sbjct  329  RMFGRAWPLGAVVRPGIVPSWSQLLAGFGVPCIDDTVATKWLNDPAVRKAVHAKEEKAIG  388

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELC+  + + HD+GSMI+YH+NLT  G+RALIFSGDHDMCVPYTGSEAWT+++GYK++
Sbjct  389  NWELCSSNLEYRHDTGSMIEYHRNLTLSGFRALIFSGDHDMCVPYTGSEAWTKAMGYKVV  448

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ N QVAG+ QGY  NLTFLTIKGAGHTVPEYKP+E+L FY+R+L G+ I
Sbjct  449  DEWRPWMSNNQVAGFTQGYANNLTFLTIKGAGHTVPEYKPRESLDFYSRFLAGEKI  504



>sp|Q9LSV8.2|SCP21_ARATH RecName: Full=Serine carboxypeptidase-like 21; Flags: Precursor 
[Arabidopsis thaliana]
Length=494

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL A VR GIVP+W QLL    VPC DDTVAT WL+ P VRKA+HA++E   G
Sbjct  319  RMFGRAWPLGAVVRPGIVPSWSQLLAGFGVPCIDDTVATKWLNDPAVRKAVHAKEEKAIG  378

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELC+  + + HD+GSMI+YH+NLT  G+RALIFSGDHDMCVPYTGSEAWT+++GYK++
Sbjct  379  NWELCSSNLEYRHDTGSMIEYHRNLTLSGFRALIFSGDHDMCVPYTGSEAWTKAMGYKVV  438

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ N QVAG+ QGY  NLTFLTIKGAGHTVPEYKP+E+L FY+R+L G+ I
Sbjct  439  DEWRPWMSNNQVAGFTQGYANNLTFLTIKGAGHTVPEYKPRESLDFYSRFLAGEKI  494



>emb|CDY27895.1| BnaA07g04850D [Brassica napus]
Length=493

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGR+WPL A VR G VP+WPQ+L +  VPC DD VATAWL+ P VRKA+HA++E+  G
Sbjct  318  RMFGRSWPLGAVVRPGFVPSWPQILANSQVPCVDDRVATAWLNDPAVRKAVHAKEESEIG  377

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTD + +THD+GSMI++H+NLT  GYRALIFSGDHDMCVPYTGSEAWT+S+GYK++
Sbjct  378  RWQLCTDNLNYTHDAGSMIEFHRNLTLSGYRALIFSGDHDMCVPYTGSEAWTKSMGYKVV  437

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR W+ N  VAG+ QGY  NLTF TIKG+GHTVPEYKP EA  FY+R+LEGK+I
Sbjct  438  DEWRAWMSNGMVAGFTQGYANNLTFATIKGSGHTVPEYKPHEAFDFYSRFLEGKNI  493



>ref|XP_009102414.1| PREDICTED: serine carboxypeptidase-like 21 [Brassica rapa]
Length=500

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGR+WPL A VR G VP+WPQ+L +  VPC DD VATAWL+ P VRKA+HA++E+  G
Sbjct  325  RMFGRSWPLGAVVRPGFVPSWPQILANSQVPCVDDRVATAWLNDPAVRKAVHAKEESEIG  384

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTD + +THD+GSMI++H+NLT  GYRALIFSGDHDMCVPYTGSEAWT+S+GYK++
Sbjct  385  RWQLCTDNLNYTHDAGSMIEFHRNLTLSGYRALIFSGDHDMCVPYTGSEAWTKSMGYKVV  444

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR W+ N  VAG+ QGY  NLTF TIKG+GHTVPEYKP EA  FY+R+LEGK+I
Sbjct  445  DEWRAWMSNGMVAGFTQGYANNLTFATIKGSGHTVPEYKPHEAFDFYSRFLEGKNI  500



>emb|CDY00837.1| BnaCnng00370D [Brassica napus]
Length=498

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGR+WPL A VR G VP+WPQ+L +  VPC DD VATAWL+ P VRKA+HA++E+  G
Sbjct  323  RMFGRSWPLGAVVRPGFVPSWPQILANSQVPCVDDRVATAWLNDPAVRKAVHAKEESEIG  382

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCT+ + +THD+GSMI++H+NLT  GYRALIFSGDHDMCVPYTGSEAWT+S+GYK++
Sbjct  383  RWQLCTNNLDYTHDAGSMIEFHRNLTLSGYRALIFSGDHDMCVPYTGSEAWTKSMGYKVV  442

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI N  VAG+ QGY  NLTF TIKG+GHTVPEYKP EAL FY+R+LEGK+I
Sbjct  443  DEWRAWISNGMVAGFTQGYANNLTFATIKGSGHTVPEYKPHEALDFYSRFLEGKNI  498



>ref|XP_004148941.1| PREDICTED: serine carboxypeptidase-like 20-like [Cucumis sativus]
 ref|XP_004161537.1| PREDICTED: serine carboxypeptidase-like 20-like [Cucumis sativus]
 gb|KGN44716.1| hypothetical protein Csa_7G374580 [Cucumis sativus]
Length=485

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 151/176 (86%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVR GIVP+W +LL S  VPCT D VATAWL++  VRKAIHA+  +L+G
Sbjct  311  RMFGRAWPLRAPVRAGIVPSWSKLLDSLEVPCTSDEVATAWLNNEAVRKAIHADT-SLSG  369

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD++ F HD+GSMI +H+NLT +GYRALI+SGDHDMCVP+TGSEAW RS+GYK+ 
Sbjct  370  TWELCTDRLDFDHDAGSMIPFHRNLTLKGYRALIYSGDHDMCVPFTGSEAWVRSLGYKVN  429

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW+ NEQVAGY++GY+ NL FLT+KG+GHTVPEYKP+EAL FY R+L G++I
Sbjct  430  DPWRPWMSNEQVAGYLRGYENNLIFLTVKGSGHTVPEYKPREALDFYQRFLAGEAI  485



>ref|XP_011013065.1| PREDICTED: serine carboxypeptidase 1-like isoform X2 [Populus 
euphratica]
Length=415

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL A  +DG  P+W +L   G+VPC +D VAT WL+   VRKAIHAE +++ G
Sbjct  240  RMFGRAWPLWAFEKDGNFPSWSELALQGSVPCVNDEVATTWLNDESVRKAIHAEPKSIAG  299

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+++C+D+I + + +G+M+ YHKNLT++GYRALI+SGDHDMCVP+TG++AWTRS+GYKII
Sbjct  300  PWQICSDRIDYGYSAGNMLPYHKNLTAQGYRALIYSGDHDMCVPFTGTQAWTRSLGYKII  359

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI NEQVAGY+QGYD NLTFLTIKGAGHTVPEYKP+E+L F++RWL+GK I
Sbjct  360  DEWRSWISNEQVAGYLQGYDNNLTFLTIKGAGHTVPEYKPRESLDFFSRWLDGKPI  415



>ref|XP_004302166.1| PREDICTED: serine carboxypeptidase-like 20 [Fragaria vesca subsp. 
vesca]
Length=506

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN---VPCTDDTVATAWLSSPEVRKAIHAEQEA  571
            RMFGRAWP R  V DG+VP WPQL    N   VPC DD VAT WL+ P VR+AIHA+  +
Sbjct  328  RMFGRAWPYRVSVEDGLVPLWPQLAAQSNSVHVPCIDDEVATKWLNDPAVREAIHAKPAS  387

Query  570  LTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGY  391
            ++GP+ELCT +I++  ++GSMI YHKNLT+RGY+A+IFSGDHDMCVPYTGS+AWT S+GY
Sbjct  388  VSGPWELCTGRISYYRNAGSMIPYHKNLTTRGYKAIIFSGDHDMCVPYTGSQAWTSSLGY  447

Query  390  KIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            K+ID+WR W  N+QVAGY+Q Y+ NLTFLT+KGAGHTVPEYKP+EAL FY+RWL+GK I
Sbjct  448  KVIDQWRSWQSNDQVAGYLQAYENNLTFLTVKGAGHTVPEYKPREALDFYSRWLQGKPI  506



>ref|XP_006418631.1| hypothetical protein EUTSA_v10002940mg [Eutrema salsugineum]
 gb|ESQ37067.1| hypothetical protein EUTSA_v10002940mg [Eutrema salsugineum]
Length=490

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP  A VR GIVP+WPQLL +     +DD VATAWL+ P VR+A+HA++E   G
Sbjct  315  RMFGRAWPFDAVVRPGIVPSWPQLLANSTASYSDDRVATAWLNDPAVRQAVHAKKETEIG  374

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LCTD++ + HD+GSMI+YH+NLT  GYRALIFSGDHDMCVPYTGSEAWT+S+GYK++
Sbjct  375  RWVLCTDQVGYAHDAGSMIEYHRNLTLSGYRALIFSGDHDMCVPYTGSEAWTKSMGYKVV  434

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ N+QVAG+ QGYD NLTFLT+KG+GHTVPEYKP EAL FY+R+L G+ I
Sbjct  435  DEWRPWMSNDQVAGFTQGYDNNLTFLTVKGSGHTVPEYKPHEALDFYSRFLAGEKI  490



>gb|KHG03245.1| Serine carboxypeptidase 1 [Gossypium arboreum]
Length=466

 Score =   270 bits (689),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 151/179 (84%), Gaps = 2/179 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQ--SGNVPCTDDTVATAWLSSPEVRKAIHAEQEA  571
            TRMFGRAWP RAPV+DGIVP WP+L Q  S +VPC +D VAT WL+  +VR+AIHA+ E 
Sbjct  288  TRMFGRAWPFRAPVKDGIVPLWPELAQTNSRDVPCFNDEVATLWLNDAKVRQAIHAQPEN  347

Query  570  LTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGY  391
            ++G +ELCTD+I++ HD+GSMI YHK LT +GYRALI+SGDHDMCVPYTG++AWTRS+GY
Sbjct  348  VSGTWELCTDRISYNHDAGSMIPYHKTLTLQGYRALIYSGDHDMCVPYTGTQAWTRSLGY  407

Query  390  KIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            K I  WR W+ N QV+GY+QGYD+++TFLTIKGAGHTVPEYKP EAL FY+RWL+ K I
Sbjct  408  KTIIPWRSWMSNGQVSGYLQGYDHDITFLTIKGAGHTVPEYKPMEALDFYSRWLDHKPI  466



>ref|XP_002514836.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF47390.1| serine carboxypeptidase, putative [Ricinus communis]
Length=478

 Score =   270 bits (689),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRAWPL    ++G  P WP+L   G+VPC  D VAT WL+   VRKAIHAE +++ 
Sbjct  302  TRMFGRAWPLWRLEKNGKFPLWPELASQGSVPCFSDEVATTWLNDDSVRKAIHAEPKSIA  361

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ELC+ +I + + +GSMI YHKNLT++GYRALI+SGDHDMCVP+TG++AWTRS+GYKI
Sbjct  362  GPWELCSSRIDYEYGAGSMISYHKNLTTQGYRALIYSGDHDMCVPFTGTQAWTRSLGYKI  421

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW+ N QVAGY+QGYD NL FLTIKGAGHTVPEYKP+E+L F+TRWL+GK+I
Sbjct  422  VDEWRPWMSNGQVAGYLQGYDKNLIFLTIKGAGHTVPEYKPQESLDFFTRWLDGKTI  478



>gb|EMS65217.1| Serine carboxypeptidase 1 [Triticum urartu]
Length=410

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 143/177 (81%), Gaps = 2/177 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRM GRAWPLRAPV+ G VP W ++  +  VPC  D VATAWL +  VR AIHA+  +  
Sbjct  236  TRMLGRAWPLRAPVKAGRVPLWQEV--ASGVPCMSDEVATAWLDNDGVRSAIHAQSVSSI  293

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ LCTDKI F HD+GSMI YHKNLTS+GYRA+IFSGDHDMCVPYTGSEAWT+S+GY +
Sbjct  294  GPWLLCTDKIDFNHDAGSMISYHKNLTSQGYRAIIFSGDHDMCVPYTGSEAWTKSMGYGV  353

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +D WRPW  N+QV+GY +GY++ LTF TIKGAGHTVPEYKP+EALAFY+RWL G  +
Sbjct  354  VDSWRPWFTNDQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEALAFYSRWLNGSKL  410



>ref|XP_008388814.1| PREDICTED: serine carboxypeptidase-like 20 [Malus domestica]
Length=505

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 155/180 (86%), Gaps = 5/180 (3%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQL---LQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEA  571
            RMFGRAWP RA V DGIVP+WPQL   L SG VPC +D VAT WL++P+VR+AIHA+ E+
Sbjct  327  RMFGRAWPFRANVEDGIVPSWPQLAKTLDSG-VPCINDEVATLWLNTPKVREAIHAQPES  385

Query  570  LTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGY  391
            + GP+ELCTD+I+++ D+GSMI YH+NLT++GYRALI+SGDHDMCVPYTGSEAWT S+GY
Sbjct  386  VAGPWELCTDRISYSRDAGSMIPYHQNLTTQGYRALIYSGDHDMCVPYTGSEAWTASLGY  445

Query  390  KIIDEWRPWIVNE-QVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +I+DEWRPW  ++ QVAGY+QGY  +LTFLTIKGAGHTVPEYKP+EAL F+ R++ GK I
Sbjct  446  EIVDEWRPWFSSDNQVAGYLQGYANSLTFLTIKGAGHTVPEYKPREALDFFQRFVGGKRI  505



>ref|XP_011013064.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Populus 
euphratica]
Length=495

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL A  +DG  P+W +L   G+VPC +D VAT WL+   VRKAIHAE +++ G
Sbjct  320  RMFGRAWPLWAFEKDGNFPSWSELALQGSVPCVNDEVATTWLNDESVRKAIHAEPKSIAG  379

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+++C+D+I + + +G+M+ YHKNLT++GYRALI+SGDHDMCVP+TG++AWTRS+GYKII
Sbjct  380  PWQICSDRIDYGYSAGNMLPYHKNLTAQGYRALIYSGDHDMCVPFTGTQAWTRSLGYKII  439

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI NEQVAGY+QGYD NLTFLTIKGAGHTVPEYKP+E+L F++RWL+GK I
Sbjct  440  DEWRSWISNEQVAGYLQGYDNNLTFLTIKGAGHTVPEYKPRESLDFFSRWLDGKPI  495



>gb|ACN29329.1| unknown [Zea mays]
 tpg|DAA55433.1| TPA: serine carboxypeptidase 1 [Zea mays]
Length=517

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 145/182 (80%), Gaps = 5/182 (3%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQ-----SGNVPCTDDTVATAWLSSPEVRKAIHAE  580
            TRM GRAWPLRAPVRDG VP+W +L       S  VPC  D VATAWL++  VR AIHAE
Sbjct  336  TRMHGRAWPLRAPVRDGRVPSWQELAADVASTSSGVPCMSDEVATAWLNNNSVRSAIHAE  395

Query  579  QEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRS  400
              +  GP+ELCTDK+ F HD+GSMI YHKNLTS+GYRA I+SGDHDMCVPYTG+EAWT S
Sbjct  396  PVSSIGPWELCTDKLDFDHDAGSMIIYHKNLTSQGYRAFIYSGDHDMCVPYTGTEAWTAS  455

Query  399  VGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            +GY ++D WR WIV+EQVAGY QGY+  LTF TIKGAGHTVPEYKP+EALAFY+RWL G 
Sbjct  456  LGYAVVDPWRQWIVDEQVAGYTQGYEKGLTFATIKGAGHTVPEYKPQEALAFYSRWLAGA  515

Query  219  SI  214
             +
Sbjct  516  KL  517



>ref|NP_001149341.1| serine carboxypeptidase 1 precursor [Zea mays]
 gb|ACG35088.1| serine carboxypeptidase 1 precursor [Zea mays]
Length=517

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 145/182 (80%), Gaps = 5/182 (3%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQ-----SGNVPCTDDTVATAWLSSPEVRKAIHAE  580
            TRM GRAWPLRAPVRDG VP+W +L       S  VPC  D VATAWL++  VR AIHAE
Sbjct  336  TRMHGRAWPLRAPVRDGRVPSWQELAADVASTSSGVPCMSDEVATAWLNNNSVRSAIHAE  395

Query  579  QEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRS  400
              +  GP+ELCTDK+ F HD+GSMI YHKNLTS+GYRA I+SGDHDMCVPYTG+EAWT S
Sbjct  396  PVSSIGPWELCTDKLDFDHDAGSMIIYHKNLTSQGYRAFIYSGDHDMCVPYTGTEAWTAS  455

Query  399  VGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            +GY ++D WR WIV+EQVAGY QGY+  LTF TIKGAGHTVPEYKP+EALAFY+RWL G 
Sbjct  456  LGYAVVDPWRQWIVDEQVAGYTQGYEKGLTFATIKGAGHTVPEYKPQEALAFYSRWLAGA  515

Query  219  SI  214
             +
Sbjct  516  KL  517



>ref|XP_010527287.1| PREDICTED: serine carboxypeptidase-like 20 isoform X3 [Tarenaya 
hassleriana]
Length=493

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRA V  G VP WPQL ++ +VPC DD VATAWL  P VRKA+HA++++  G
Sbjct  318  RMFGRAWPLRASVLPGPVPNWPQLSKTMSVPCVDDRVATAWLDDPSVRKAVHAKEDSEIG  377

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT KI + HD GSM+  H+NLT  GYRALI+SGDHDMCVPYTG+EAWTRS+GY + 
Sbjct  378  GWELCTQKINYMHDRGSMLNLHRNLTLGGYRALIYSGDHDMCVPYTGTEAWTRSLGYNVT  437

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW++++QVAGYIQGY  NLTFLTIKGAGHTVPEYKP+E+L+FY+R+L G+ I
Sbjct  438  DGWRPWMLDDQVAGYIQGYSNNLTFLTIKGAGHTVPEYKPRESLSFYSRFLAGEKI  493



>ref|XP_010070328.1| PREDICTED: serine carboxypeptidase-like 21 [Eucalyptus grandis]
Length=494

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL  PVRDG VP WPQL +  +V C +D VAT+WL++  VR+AIHA    ++G
Sbjct  319  RMFGRAWPLWLPVRDGTVPLWPQLAKKFHVACVNDEVATSWLNNDRVREAIHAASVNVSG  378

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCT++I +  +SGSMI YHKNLT++ +RALIFSGDHDMCVP+TGS+AWT+S+GY+I+
Sbjct  379  PWELCTERIKYRRNSGSMIPYHKNLTTQNFRALIFSGDHDMCVPFTGSQAWTQSLGYRIM  438

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+  ++VAGY+Q YD+NLTFLTIKGAGHTVPEYKP+EAL FYTRWL+G  I
Sbjct  439  DEWRPWMSADEVAGYLQEYDHNLTFLTIKGAGHTVPEYKPREALDFYTRWLDGNPI  494



>gb|KDP26877.1| hypothetical protein JCGZ_18035 [Jatropha curcas]
Length=478

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL +  +DG +P WP+L + G+VPC  D VATAWL+   VRKAIHA  +++ G
Sbjct  303  RMFGRAWPLWSLEKDGNLPLWPKLAEQGSVPCVRDEVATAWLNDESVRKAIHAAPKSIAG  362

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELC+D+I + + +GSM+ YHKNLT +GYRALI+SGDHDMC+P+TG++AWTRS+GYKII
Sbjct  363  PWELCSDRIDYEYGAGSMLPYHKNLTMQGYRALIYSGDHDMCIPFTGTQAWTRSLGYKII  422

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ N+QVAGY+QGY  NL FLTIKGAGHTVPEYKP+E+L FY+RWL+GK I
Sbjct  423  DEWRPWMSNDQVAGYLQGYVNNLIFLTIKGAGHTVPEYKPRESLDFYSRWLDGKPI  478



>ref|XP_010527286.1| PREDICTED: serine carboxypeptidase-like 20 isoform X2 [Tarenaya 
hassleriana]
Length=497

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRA V  G VP WPQL ++ +VPC DD VATAWL  P VRKA+HA++++  G
Sbjct  322  RMFGRAWPLRASVLPGPVPNWPQLSKTMSVPCVDDRVATAWLDDPSVRKAVHAKEDSEIG  381

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT KI + HD GSM+  H+NLT  GYRALI+SGDHDMCVPYTG+EAWTRS+GY + 
Sbjct  382  GWELCTQKINYMHDRGSMLNLHRNLTLGGYRALIYSGDHDMCVPYTGTEAWTRSLGYNVT  441

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW++++QVAGYIQGY  NLTFLTIKGAGHTVPEYKP+E+L+FY+R+L G+ I
Sbjct  442  DGWRPWMLDDQVAGYIQGYSNNLTFLTIKGAGHTVPEYKPRESLSFYSRFLAGEKI  497



>ref|XP_006366826.1| PREDICTED: serine carboxypeptidase-like 20-like [Solanum tuberosum]
Length=497

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN-VPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            RMFGRAWP  APVR+G+VP+WP++L+  N VPC  D +AT WL++ +VRKAIHAE   + 
Sbjct  321  RMFGRAWPYNAPVREGLVPSWPEILKHTNYVPCISDRIATVWLNNEDVRKAIHAEPITVI  380

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G + LC++K+ FTHD+GSMI YHKNLT+ GYRALI+SGDHDMCVPYTGSE WT S+GY I
Sbjct  381  GRWRLCSNKLIFTHDTGSMIPYHKNLTAWGYRALIYSGDHDMCVPYTGSEKWTSSLGYAI  440

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW   E++ GY QGY  NLTFLTIKGAGHTVPEYKP EAL FY RWLEGK I
Sbjct  441  VDEWRPWYTKEEIQGYTQGYANNLTFLTIKGAGHTVPEYKPLEALEFYERWLEGKKI  497



>ref|XP_006299687.1| hypothetical protein CARUB_v10015878mg [Capsella rubella]
 gb|EOA32585.1| hypothetical protein CARUB_v10015878mg [Capsella rubella]
Length=338

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 4/180 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAE----QE  574
            RMFGRAWPL A +R GIVP+W QLL S  VPC +D VAT WL+ P VRKA+HA+    QE
Sbjct  159  RMFGRAWPLGAILRPGIVPSWSQLLASSGVPCINDVVATKWLNDPTVRKAVHAKEVYIQE  218

Query  573  ALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVG  394
            +  G + LC+DK+ ++HD+GSMI++H+NLT  G RALI+SGDHDMCVPYTGSEAWT+++G
Sbjct  219  SEIGGWHLCSDKLEYSHDTGSMIEHHRNLTLNGIRALIYSGDHDMCVPYTGSEAWTKAMG  278

Query  393  YKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            YK++DEWRPW  N QVAG+ QGY  NLTF+TIKGAGHTVPEYKP+EAL FY+R+L G+ I
Sbjct  279  YKVVDEWRPWTSNNQVAGFTQGYANNLTFITIKGAGHTVPEYKPREALDFYSRFLAGEKI  338



>ref|XP_010527284.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Tarenaya 
hassleriana]
Length=499

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRA V  G VP WPQL ++ +VPC DD VATAWL  P VRKA+HA++++  G
Sbjct  324  RMFGRAWPLRASVLPGPVPNWPQLSKTMSVPCVDDRVATAWLDDPSVRKAVHAKEDSEIG  383

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT KI + HD GSM+  H+NLT  GYRALI+SGDHDMCVPYTG+EAWTRS+GY + 
Sbjct  384  GWELCTQKINYMHDRGSMLNLHRNLTLGGYRALIYSGDHDMCVPYTGTEAWTRSLGYNVT  443

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW++++QVAGYIQGY  NLTFLTIKGAGHTVPEYKP+E+L+FY+R+L G+ I
Sbjct  444  DGWRPWMLDDQVAGYIQGYSNNLTFLTIKGAGHTVPEYKPRESLSFYSRFLAGEKI  499



>ref|XP_003578731.1| PREDICTED: serine carboxypeptidase 1 [Brachypodium distachyon]
Length=492

 Score =   268 bits (684),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 141/177 (80%), Gaps = 2/177 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRM GRAWPLRAPVRDG VP+W  L  +  VPC  D VATAWL +  VR AIHAE  +  
Sbjct  318  TRMLGRAWPLRAPVRDGRVPSW--LEYASGVPCMSDEVATAWLDNDSVRSAIHAEPVSSI  375

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ LCTD I F HD+GSMI YHKNLT +GYRA IFSGDHDMCVP+TGSEAWT+S+GY +
Sbjct  376  GPWLLCTDAINFNHDAGSMISYHKNLTRQGYRAFIFSGDHDMCVPFTGSEAWTKSIGYGV  435

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +D WRPW +N QV+GY QGY++ LTF TIKGAGHTVPEYKP+EALAFY+RWL G  +
Sbjct  436  VDSWRPWFLNGQVSGYTQGYEHGLTFATIKGAGHTVPEYKPQEALAFYSRWLAGSKL  492



>gb|KJB26857.1| hypothetical protein B456_004G263400 [Gossypium raimondii]
Length=492

 Score =   268 bits (684),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 151/179 (84%), Gaps = 2/179 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQ--SGNVPCTDDTVATAWLSSPEVRKAIHAEQEA  571
            TR+FGRAWP RAPV+DGIVP WP+L Q  S +VPC +D VAT WL+  +VR+AIHA+ E 
Sbjct  314  TRIFGRAWPFRAPVKDGIVPLWPELAQTNSRDVPCFNDEVATLWLNDAKVRQAIHAQPET  373

Query  570  LTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGY  391
            ++G +ELCTD+I++ HD+GSMI YHK LT +GYRALI+SGDHDMCVPYTG++AWTRS+GY
Sbjct  374  VSGTWELCTDRISYYHDAGSMIPYHKTLTLQGYRALIYSGDHDMCVPYTGTQAWTRSLGY  433

Query  390  KIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            K I  WR W+ N QV+GY+QGYD+++TFLTIKGAGHTVPEYKP EAL FY+RWL+ K I
Sbjct  434  KTIIPWRSWMSNGQVSGYMQGYDHDITFLTIKGAGHTVPEYKPMEALDFYSRWLDDKPI  492



>ref|XP_007029289.1| Serine carboxypeptidase-like 20 isoform 1 [Theobroma cacao]
 gb|EOY09791.1| Serine carboxypeptidase-like 20 isoform 1 [Theobroma cacao]
Length=498

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 149/187 (80%), Gaps = 10/187 (5%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSG-NVPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            TRMFGRAWP RAPV+DGIVP WP+L  +  +V C +D VAT WL+  EVRKAIHAE E +
Sbjct  312  TRMFGRAWPFRAPVKDGIVPLWPELAANKLHVSCINDEVATTWLNDAEVRKAIHAEPENV  371

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
             GP+ELCTD+I++ HD+GSMI YHK LT+ GYRALIFSGDHDMCVPYTGS+AWT+S+GYK
Sbjct  372  AGPWELCTDRISYDHDAGSMIPYHKTLTAEGYRALIFSGDHDMCVPYTGSQAWTKSLGYK  431

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIK---------GAGHTVPEYKPKEALAFYTR  235
               +WR W  N+QVAGY+QGY++N+TFLT+K         GAGHTVPEYKP EAL FY+R
Sbjct  432  TTIQWRSWFSNQQVAGYLQGYEHNITFLTVKLLQNNSLLQGAGHTVPEYKPGEALDFYSR  491

Query  234  WLEGKSI  214
            WL+ K I
Sbjct  492  WLDRKPI  498



>gb|AAA32940.1| carboxypeptidase I precursor, partial [Hordeum vulgare]
Length=412

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 144/177 (81%), Gaps = 2/177 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRM GRAWPLRAPV+ G VP+W Q + SG VPC  D VATAWL +  VR AIHA+  +  
Sbjct  238  TRMLGRAWPLRAPVKAGRVPSW-QEVASG-VPCMSDEVATAWLDNAAVRSAIHAQSVSAI  295

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ LCTDK+ F HD+GSMI YHKNLTS+GYRA+IFSGDHDMCVP+TGSEAWT+S+GY +
Sbjct  296  GPWLLCTDKLYFVHDAGSMIAYHKNLTSQGYRAIIFSGDHDMCVPFTGSEAWTKSLGYGV  355

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +D WRPWI N QV+GY +GY++ LTF TIKGAGHTVPEYKP+EA AFY+RWL G  +
Sbjct  356  VDSWRPWITNGQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEAFAFYSRWLAGSKL  412



>ref|XP_010466954.1| PREDICTED: serine carboxypeptidase-like 21 isoform X2 [Camelina 
sativa]
Length=501

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL + VR GI+P+W QLL   +VPC +D VAT WL+ P VRKAIHA++E+  G
Sbjct  326  RMFGRAWPLGSVVRPGIIPSWSQLLAESSVPCINDVVATKWLNDPAVRKAIHAKEESEIG  385

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LC++++ +THD+GSMI+ H+NLT  G RALI+SGDHDMCVPYTGSEAWT+++GYK+I
Sbjct  386  KWMLCSNQLEYTHDTGSMIELHRNLTLSGIRALIYSGDHDMCVPYTGSEAWTKAMGYKVI  445

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N QVAG+ QGY  NLTF+TIKG+GHTVPEYKP+EAL FY+R+L GK+I
Sbjct  446  DEWRPWFSNHQVAGFTQGYANNLTFITIKGSGHTVPEYKPREALDFYSRFLAGKNI  501



>ref|XP_010466953.1| PREDICTED: serine carboxypeptidase-like 21 isoform X1 [Camelina 
sativa]
Length=508

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL + VR GI+P+W QLL   +VPC +D VAT WL+ P VRKAIHA++E+  G
Sbjct  333  RMFGRAWPLGSVVRPGIIPSWSQLLAESSVPCINDVVATKWLNDPAVRKAIHAKEESEIG  392

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LC++++ +THD+GSMI+ H+NLT  G RALI+SGDHDMCVPYTGSEAWT+++GYK+I
Sbjct  393  KWMLCSNQLEYTHDTGSMIELHRNLTLSGIRALIYSGDHDMCVPYTGSEAWTKAMGYKVI  452

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N QVAG+ QGY  NLTF+TIKG+GHTVPEYKP+EAL FY+R+L GK+I
Sbjct  453  DEWRPWFSNHQVAGFTQGYANNLTFITIKGSGHTVPEYKPREALDFYSRFLAGKNI  508



>ref|XP_010466955.1| PREDICTED: serine carboxypeptidase-like 21 isoform X3 [Camelina 
sativa]
Length=489

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL + VR GI+P+W QLL   +VPC +D VAT WL+ P VRKAIHA++E+  G
Sbjct  314  RMFGRAWPLGSVVRPGIIPSWSQLLAESSVPCINDVVATKWLNDPAVRKAIHAKEESEIG  373

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LC++++ +THD+GSMI+ H+NLT  G RALI+SGDHDMCVPYTGSEAWT+++GYK+I
Sbjct  374  KWMLCSNQLEYTHDTGSMIELHRNLTLSGIRALIYSGDHDMCVPYTGSEAWTKAMGYKVI  433

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N QVAG+ QGY  NLTF+TIKG+GHTVPEYKP+EAL FY+R+L GK+I
Sbjct  434  DEWRPWFSNHQVAGFTQGYANNLTFITIKGSGHTVPEYKPREALDFYSRFLAGKNI  489



>gb|ABR17809.1| unknown [Picea sitchensis]
Length=494

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQL---LQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEA  571
            RMFGRAWP+ + V+DG VP WPQL   L + ++ C D  V+  W + P VR+AIHAE E 
Sbjct  316  RMFGRAWPMWSAVKDGKVPMWPQLGDQLGAQHLICMDTQVSHVWCNDPLVREAIHAESEN  375

Query  570  LTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGY  391
            ++G +++C D+IT+T D+GSMIKYH+NLT++GYR+LIFSGDHDMCVPYTGSEAWTRS+GY
Sbjct  376  ISGRWQVCADRITYTRDAGSMIKYHRNLTTKGYRSLIFSGDHDMCVPYTGSEAWTRSMGY  435

Query  390  KIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            KI DEWRPW +N+QVAGY QGYD+NLTF TIKG+GHTVPEYKP+EA AFY RWL G+ +
Sbjct  436  KITDEWRPWFLNDQVAGYTQGYDHNLTFATIKGSGHTVPEYKPREAFAFYQRWLSGEPL  494



>ref|XP_002325905.2| hypothetical protein POPTR_0019s08160g [Populus trichocarpa]
 gb|EEF00287.2| hypothetical protein POPTR_0019s08160g [Populus trichocarpa]
Length=503

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL A  +DG  P+W +L   G+VPC +D VAT WL+   VR AIHAE +++ G
Sbjct  328  RMFGRAWPLWAFEKDGNFPSWSELALQGSVPCVNDEVATTWLNDESVRTAIHAEPKSIAG  387

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+++C+D++ + + +G+M+ YHKNLT++GYRALI+SGDHDMCVP+TG++AWTRS+GYKII
Sbjct  388  PWQICSDRLDYGYGAGNMLPYHKNLTAQGYRALIYSGDHDMCVPFTGTQAWTRSLGYKII  447

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR W+ NEQVAGY+QGYD NLTFLTIKGAGHTVPEYKP+E+L F++RWL+GK I
Sbjct  448  DEWRSWVSNEQVAGYLQGYDNNLTFLTIKGAGHTVPEYKPRESLDFFSRWLDGKPI  503



>ref|XP_002443027.1| hypothetical protein SORBIDRAFT_08g006540 [Sorghum bicolor]
 gb|EES16865.1| hypothetical protein SORBIDRAFT_08g006540 [Sorghum bicolor]
Length=498

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQS--GNVPCTDDTVATAWLSSPEVRKAIHAEQEA  571
            TRM GRAWPLRAPVRDG VP+W +L      +V C  D VATAWL++  VR AIHAE  +
Sbjct  320  TRMIGRAWPLRAPVRDGRVPSWQELAAGTGSSVMCMSDEVATAWLNNDSVRSAIHAEPVS  379

Query  570  LTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGY  391
              GP+ LCTDK+TF HD+GSMI YHKNLTS+GYRALI+SGDHDMCVPYTGS AWT S+GY
Sbjct  380  SIGPWVLCTDKLTFHHDAGSMIIYHKNLTSQGYRALIYSGDHDMCVPYTGSLAWTTSLGY  439

Query  390  KIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
             +ID WR W+VNEQV+GY QGY+ +LTF TIKG+GHTVPEYKPKEA AFY+RWL G  +
Sbjct  440  GVIDSWRAWLVNEQVSGYTQGYENDLTFATIKGSGHTVPEYKPKEAFAFYSRWLAGSKL  498



>ref|XP_010514125.1| PREDICTED: serine carboxypeptidase-like 21 [Camelina sativa]
Length=507

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            R+FGRAWPL + VR GIVP+W QLL    VPC +D VAT WL+ P VRKAIHA++E   G
Sbjct  332  RLFGRAWPLGSVVRPGIVPSWSQLLAGSGVPCVNDIVATKWLNEPAVRKAIHAKEERDIG  391

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LC+DK+ +THD+GSMI+ H+NLT  G RALI+SGDHDMCVPYTGSEAWT+S+GYK  
Sbjct  392  SWQLCSDKLEYTHDTGSMIELHRNLTLSGIRALIYSGDHDMCVPYTGSEAWTKSIGYKAT  451

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D+WRPW  N QVAG+ QGY  NLTF+TIKG+GHTVPEYKP+EAL FY+R+L GK I
Sbjct  452  DQWRPWFSNHQVAGFTQGYANNLTFITIKGSGHTVPEYKPREALDFYSRFLAGKKI  507



>ref|XP_004960778.1| PREDICTED: serine carboxypeptidase 1-like [Setaria italica]
Length=500

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSG--NVPCTDDTVATAWLSSPEVRKAIHAEQEA  571
            TRM GRAWPLRAPV++G VP+W +L  +    VPC  D VATAWL++  VR AIHAE  +
Sbjct  322  TRMIGRAWPLRAPVKEGRVPSWQELAVAAPSGVPCMSDEVATAWLNNDGVRSAIHAEPVS  381

Query  570  LTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGY  391
              GP+ +CTDK+ F HD+GSMI YHKNLTS+GYRALIFSGDHDMCVPYTG+EAWT S+GY
Sbjct  382  SIGPWLICTDKLDFRHDAGSMIIYHKNLTSQGYRALIFSGDHDMCVPYTGTEAWTTSLGY  441

Query  390  KIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
             ++D WRPW  NEQV+GY QGY+  LTF TIKGAGHTVPEYKP+EALAFY+RWL G  +
Sbjct  442  GVVDSWRPWFTNEQVSGYTQGYEKGLTFATIKGAGHTVPEYKPQEALAFYSRWLAGSKL  500



>ref|XP_004515043.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=506

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN-VPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            RMFGRAWP +  V+DGIVP+WP+L  +   VPCTDD VA +WL++P+VRKAIH  +E++ 
Sbjct  330  RMFGRAWPYKGNVKDGIVPSWPELTSTSILVPCTDDGVANSWLNNPDVRKAIHTVEESVV  389

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G + LCTD+I +THD+GSM+ +HKNLTS+GYR L +SGDHDMCVPYTG+E WT+ VG KI
Sbjct  390  GAWYLCTDQIKYTHDTGSMLNFHKNLTSKGYRVLAYSGDHDMCVPYTGTETWTKLVGVKI  449

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N+QVAGY QGY  NLT+LTIKG+GHTVPEYKP+E+L FY R+L+G  I
Sbjct  450  VDEWRPWFSNDQVAGYTQGYSNNLTYLTIKGSGHTVPEYKPRESLDFYKRFLDGVPI  506



>dbj|BAJ95123.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 144/177 (81%), Gaps = 2/177 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRM GRAWPLRAPV+ G VP+W Q + SG VPC  D VATAWL +  VR AIHA+  +  
Sbjct  325  TRMLGRAWPLRAPVKAGRVPSW-QEVASG-VPCMSDEVATAWLDNAAVRSAIHAQSVSAI  382

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ LCTDK+ F HD+GSMI YHKNLTS+GYRA+IFSGDHDMCVP+TGSEAWT+S+GY +
Sbjct  383  GPWLLCTDKLYFVHDAGSMIAYHKNLTSQGYRAIIFSGDHDMCVPFTGSEAWTKSLGYGV  442

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +D WRPWI N QV+GY +GY++ LTF TIKGAGHTVPEYKP+EA AFY+RWL G  +
Sbjct  443  VDSWRPWITNGQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEAFAFYSRWLAGSKL  499



>sp|P07519.4|CBP1_HORVU RecName: Full=Serine carboxypeptidase 1; AltName: Full=CP-MI; 
AltName: Full=Carboxypeptidase C; AltName: Full=Serine carboxypeptidase 
I; Contains: RecName: Full=Serine carboxypeptidase 
1 chain A; AltName: Full=Serine carboxypeptidase I chain 
A; Contains: RecName: Full=Serine carboxypeptidase 1 chain 
B; AltName: Full=Serine carboxypeptidase I chain B; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA70816.1| serine carboxypeptidase I, CP-MI [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 144/177 (81%), Gaps = 2/177 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRM GRAWPLRAPV+ G VP+W Q + SG VPC  D VATAWL +  VR AIHA+  +  
Sbjct  325  TRMLGRAWPLRAPVKAGRVPSW-QEVASG-VPCMSDEVATAWLDNAAVRSAIHAQSVSAI  382

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ LCTDK+ F HD+GSMI YHKNLTS+GYRA+IFSGDHDMCVP+TGSEAWT+S+GY +
Sbjct  383  GPWLLCTDKLYFVHDAGSMIAYHKNLTSQGYRAIIFSGDHDMCVPFTGSEAWTKSLGYGV  442

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +D WRPWI N QV+GY +GY++ LTF TIKGAGHTVPEYKP+EA AFY+RWL G  +
Sbjct  443  VDSWRPWITNGQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEAFAFYSRWLAGSKL  499



>ref|XP_010557747.1| PREDICTED: serine carboxypeptidase-like 20 [Tarenaya hassleriana]
Length=496

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRA VR G VP WPQLL+  +V CTDD VATAWL+ P +R+A+HA++ +  G
Sbjct  321  RMFGRAWPLRAHVRPGKVPNWPQLLERTSVVCTDDRVATAWLNDPAIRRALHAKEVSEIG  380

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LCT ++ + HD+ ++I  H NLT  GYRALI+SGDHDMC+P+TG+EAWTRS+GYK+I
Sbjct  381  SWTLCTGRLDYIHDNANLINLHINLTLSGYRALIYSGDHDMCIPFTGTEAWTRSLGYKVI  440

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW+ N+QVAGY QGY+ NLTFLTIKGAGHTVPEYKP+E+L FY+R+L G+ I
Sbjct  441  DEWRPWMSNDQVAGYTQGYENNLTFLTIKGAGHTVPEYKPQESLEFYSRFLAGEKI  496



>ref|XP_010520852.1| PREDICTED: serine carboxypeptidase-like 20 isoform X2 [Tarenaya 
hassleriana]
Length=498

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPV  G+VP WPQLL+   +PCTDD VAT WL  P VRKA+HA++ +  G
Sbjct  323  RMFGRAWPLRAPVLPGLVPNWPQLLEKLYIPCTDDRVATIWLDDPAVRKAVHAKEVSEIG  382

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LCT K+ + HD GSM+  H+ LT  GYRALI+SGDHDMCVPYTGSEAWTRS+GY + 
Sbjct  383  SWMLCTSKLRYVHDYGSMLFLHRKLTLDGYRALIYSGDHDMCVPYTGSEAWTRSLGYNVT  442

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI N+QVAGY QGY  NLTFLTIKGAGHTVPEYKP+E+L FY+R+L G+ I
Sbjct  443  DEWRAWISNDQVAGYTQGYANNLTFLTIKGAGHTVPEYKPRESLDFYSRFLAGEKI  498



>ref|NP_189169.1| serine carboxypeptidase-like 21 [Arabidopsis thaliana]
 gb|AEE77009.1| serine carboxypeptidase-like 21 [Arabidopsis thaliana]
Length=505

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 147/187 (79%), Gaps = 11/187 (6%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEAL--  568
            RMFGRAWPL A VR GIVP+W QLL    VPC DDTVAT WL+ P VRKA+HA++ ++  
Sbjct  319  RMFGRAWPLGAVVRPGIVPSWSQLLAGFGVPCIDDTVATKWLNDPAVRKAVHAKEVSIQF  378

Query  567  ---------TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSE  415
                      G +ELC+  + + HD+GSMI+YH+NLT  G+RALIFSGDHDMCVPYTGSE
Sbjct  379  IIFLSISISIGNWELCSSNLEYRHDTGSMIEYHRNLTLSGFRALIFSGDHDMCVPYTGSE  438

Query  414  AWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTR  235
            AWT+++GYK++DEWRPW+ N QVAG+ QGY  NLTFLTIKGAGHTVPEYKP+E+L FY+R
Sbjct  439  AWTKAMGYKVVDEWRPWMSNNQVAGFTQGYANNLTFLTIKGAGHTVPEYKPRESLDFYSR  498

Query  234  WLEGKSI  214
            +L G+ I
Sbjct  499  FLAGEKI  505



>ref|XP_010527288.1| PREDICTED: serine carboxypeptidase-like 20 [Tarenaya hassleriana]
Length=492

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPV  G+VP WPQLL++   PCTDD VAT WL  P VRKA+HA++ +  G
Sbjct  317  RMFGRAWPLRAPVLPGLVPNWPQLLENIYTPCTDDRVATIWLDDPAVRKAVHAKEVSEIG  376

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LCT K+ + HD GSM+  H+ LT  GYRALI+SGDHDMC+PYTGSEAWTRS+GY + 
Sbjct  377  SWMLCTSKLRYVHDYGSMLFLHRKLTLGGYRALIYSGDHDMCIPYTGSEAWTRSLGYNVT  436

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI N+QVAGY QGY  NLTFLTIKGAGHTVPEYKP+E+L FY+R+L G+ I
Sbjct  437  DEWRAWISNDQVAGYTQGYANNLTFLTIKGAGHTVPEYKPRESLDFYSRFLAGEKI  492



>ref|XP_010520851.1| PREDICTED: serine carboxypeptidase-like 20 isoform X1 [Tarenaya 
hassleriana]
Length=537

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPV  G+VP WPQLL+   +PCTDD VAT WL  P VRKA+HA++ +  G
Sbjct  362  RMFGRAWPLRAPVLPGLVPNWPQLLEKLYIPCTDDRVATIWLDDPAVRKAVHAKEVSEIG  421

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LCT K+ + HD GSM+  H+ LT  GYRALI+SGDHDMCVPYTGSEAWTRS+GY + 
Sbjct  422  SWMLCTSKLRYVHDYGSMLFLHRKLTLDGYRALIYSGDHDMCVPYTGSEAWTRSLGYNVT  481

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR WI N+QVAGY QGY  NLTFLTIKGAGHTVPEYKP+E+L FY+R+L G+ I
Sbjct  482  DEWRAWISNDQVAGYTQGYANNLTFLTIKGAGHTVPEYKPRESLDFYSRFLAGEKI  537



>ref|XP_002514833.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF47387.1| serine carboxypeptidase, putative [Ricinus communis]
Length=494

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 151/179 (84%), Gaps = 3/179 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN--VPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            R+FGRAWP RAPV  G+V +WPQLL + N  VPC +D +ATAWL++ EVRKAIHA  ++ 
Sbjct  316  RIFGRAWPFRAPVLQGLVLSWPQLLSNMNIKVPCVNDEIATAWLNNEEVRKAIHAGSDSE  375

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
             G +ELCT K+ + HD+GSM++YHKN+TS GYRALI+SGDHDMCVP+TG++AWTRS+ YK
Sbjct  376  IGRWELCTGKLQYWHDAGSMLQYHKNITSEGYRALIYSGDHDMCVPFTGTQAWTRSLHYK  435

Query  387  IIDEWRPWIVN-EQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            I+DEWRPW+ +  Q+AGY+QGY+ NLTFLTIKGAGHTVPEYKP+EAL F++RWL+G  I
Sbjct  436  IVDEWRPWMSSVGQLAGYLQGYEKNLTFLTIKGAGHTVPEYKPREALDFFSRWLDGTPI  494



>ref|XP_002443031.1| hypothetical protein SORBIDRAFT_08g006610 [Sorghum bicolor]
 gb|EES16869.1| hypothetical protein SORBIDRAFT_08g006610 [Sorghum bicolor]
Length=176

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = -2

Query  738  MFGRAWPLRAPVRDGIVPTWPQLLQS--GNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            M GRAWPLRAPVRDG VP+W +L  S    +PC  D VATAWL++  VR AIHAE  +  
Sbjct  1    MHGRAWPLRAPVRDGRVPSWQELAASVPRGIPCMSDEVATAWLNNDNVRSAIHAEPVSSI  60

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP++L T+ + F HD+GSMI YHKNLTS+GYRALI+SGDHDMCVP+TG+EAWT S+GY I
Sbjct  61   GPWQLFTE-LDFDHDAGSMIIYHKNLTSQGYRALIYSGDHDMCVPHTGTEAWTASLGYGI  119

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            ID WR WIVNEQVAGY QGY+  LTF TIKG+GHTVPEYKP+E+LAFY+RWL G  +
Sbjct  120  IDSWRQWIVNEQVAGYTQGYENGLTFATIKGSGHTVPEYKPQESLAFYSRWLNGTKL  176



>ref|NP_001167902.1| hypothetical protein precursor [Zea mays]
 gb|ACN26453.1| unknown [Zea mays]
 gb|AFW56638.1| hypothetical protein ZEAMMB73_633855 [Zea mays]
Length=507

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVP---CTDDTVATAWLSSPEVRKAIHAEQE  574
            TRMFGRAWPLRAPVRDG VP+W +L  + N P   C +D VATAWL+   VR AIHAE  
Sbjct  328  TRMFGRAWPLRAPVRDGRVPSWQELAATNNFPSVMCMNDEVATAWLNHDSVRSAIHAEPV  387

Query  573  ALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVG  394
            +  GP+ LCTD++ F HD+GSMI YHKNLTS+GYRA+I+SGDHDMCVPYTGS AWT S+ 
Sbjct  388  SAIGPWILCTDQLLFHHDAGSMIIYHKNLTSQGYRAIIYSGDHDMCVPYTGSLAWTTSLR  447

Query  393  YKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            Y +ID WRPW VN QV+GY QGY+  LTF TIKG+GH VPEYKP+EALAFY+RWL G  +
Sbjct  448  YGVIDSWRPWFVNGQVSGYTQGYENGLTFATIKGSGHAVPEYKPQEALAFYSRWLAGSKL  507



>ref|XP_004492244.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=493

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQS-GNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            R+FGRAWP R  V+DGIVP+WP+L  + G VPC DD VATAWL++P+VRKAIH  +E++ 
Sbjct  317  RIFGRAWPYRGNVKDGIVPSWPELTSANGYVPCVDDGVATAWLNNPDVRKAIHTVEESVV  376

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
              + LCTD+I + HD+GSM+ +HK LTS+GYR L FSGDHDMCVP+TG+E WTR +G KI
Sbjct  377  DAWSLCTDQIQYNHDTGSMLNFHKKLTSKGYRVLAFSGDHDMCVPHTGTETWTRLIGVKI  436

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW  N QVAGY QGY  NLT+LTIKG+GHTVPEYKP+E+L FY R+L+G  I
Sbjct  437  VDEWRPWFSNNQVAGYTQGYANNLTYLTIKGSGHTVPEYKPRESLHFYKRFLDGVPI  493



>gb|KEH18097.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=482

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDG VPTWPQL+ S NVPCTD +VA AWL++ EVRKAIH  ++++  
Sbjct  320  RMFGRAWPLRAPVRDGNVPTWPQLINSNNVPCTDGSVANAWLNNEEVRKAIHTAEKSVVS  379

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTDKI+F HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVP+TGS+AWTRS+GYKI+
Sbjct  380  SWDLCTDKISFDHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPFTGSQAWTRSIGYKIV  439

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIK  295
            DEWRPW+ N QV GY QGYD+NLTFLTIK
Sbjct  440  DEWRPWLSNGQVVGYTQGYDHNLTFLTIK  468



>ref|XP_002883604.1| hypothetical protein ARALYDRAFT_480041 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59863.1| hypothetical protein ARALYDRAFT_480041 [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   261 bits (666),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 147/190 (77%), Gaps = 14/190 (7%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEAL--  568
            RMFGRAWPL A VR GIVP+W QLL+   VPC DDTVAT WL+ P VRKA+HA++ +   
Sbjct  320  RMFGRAWPLGAVVRPGIVPSWSQLLEGSGVPCIDDTVATKWLNDPAVRKAVHAKEVSTLS  379

Query  567  ------------TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYT  424
                         G ++LC+ ++ + HD+GSMI+YH+NLT  G+RAL+FSGDHDMCVPYT
Sbjct  380  THFIIFFLISLSIGNWKLCSSQLEYRHDTGSMIEYHRNLTLSGFRALVFSGDHDMCVPYT  439

Query  423  GSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAF  244
            GSEAWT+++GYK++DEWRPWI N Q AG+ QGY  NLTFLTIKGAGHTVPEYKP+E+L F
Sbjct  440  GSEAWTKAMGYKVVDEWRPWISNNQAAGFTQGYANNLTFLTIKGAGHTVPEYKPRESLDF  499

Query  243  YTRWLEGKSI  214
            Y+R+L G+ I
Sbjct  500  YSRFLAGEKI  509



>ref|XP_003622732.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=600

 Score =   263 bits (671),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNV--PCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            RMFGRAWP RA V+DG VP+WP+L+ + +   PC DD VA  WL++P+VR+AIH  ++++
Sbjct  332  RMFGRAWPYRAIVKDGFVPSWPELVSNSDTAPPCIDDEVAMVWLNNPQVRRAIHTVEKSV  391

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
               + LCTD+I + HD+GSMIKYHK LTS+GYRALI+SGDHDMCVPYTG+EAWT+S+GYK
Sbjct  392  VKGWTLCTDQIKYKHDTGSMIKYHKKLTSKGYRALIYSGDHDMCVPYTGTEAWTKSIGYK  451

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEG  223
            I+DEWRPW+ N+Q+AGY Q Y  NLTFLTIKG+GHTVPEYKP+E+L FY ++L G
Sbjct  452  IVDEWRPWLTNDQIAGYTQRYANNLTFLTIKGSGHTVPEYKPQESLYFYKQFLNG  506



>ref|XP_010673905.1| PREDICTED: serine carboxypeptidase-like 20 [Beta vulgaris subsp. 
vulgaris]
Length=509

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 149/181 (82%), Gaps = 6/181 (3%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQL--LQSG---NVPCTDDTVATAWLSSPEVRKAIHAEQ  577
            RMFGRAWP +  V+DG+VP+WPQL  LQ+    +VPCT + VATAWL+   VRKAIHA+ 
Sbjct  330  RMFGRAWPYQMVVKDGLVPSWPQLNSLQNDRRVSVPCTSEEVATAWLNHEAVRKAIHAKP  389

Query  576  EALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSV  397
                G + LC   + F HD+GSMIKYH+NLT++G+RALI+SGDHD+CVPYTG++AWT S+
Sbjct  390  VNEIGDWSLCMS-LVFNHDAGSMIKYHRNLTAQGFRALIYSGDHDLCVPYTGTQAWTSSL  448

Query  396  GYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKS  217
            GY+I+DEWRPW+ N QVAGY+Q Y++NLTFLT+KGAGHTVPEYKP+EAL FY+RWLEGK 
Sbjct  449  GYRILDEWRPWMSNNQVAGYVQRYEHNLTFLTVKGAGHTVPEYKPREALDFYSRWLEGKP  508

Query  216  I  214
            I
Sbjct  509  I  509



>emb|CDY39716.1| BnaA04g07190D [Brassica napus]
Length=505

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 144/189 (76%), Gaps = 13/189 (7%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAP+  GIVP+W QLL   +VPC DD VATAWL+ P +RKAIHA++E+  G
Sbjct  317  RMFGRAWPVRAPILPGIVPSWSQLLADVSVPCIDDRVATAWLNDPAIRKAIHAKEESEIG  376

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCT K+ F HD+GSMI +H+NLT  GYRALI+SGDHDMCVP+TGSEAWT S+GYK+I
Sbjct  377  RWELCTGKLWFHHDAGSMISFHRNLTLSGYRALIYSGDHDMCVPFTGSEAWTHSLGYKVI  436

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAG-------------HTVPEYKPKEALAFY  241
            DEWR WI N+QVAGY +GY  NLTFLTIK                HTVPEYKP+EAL FY
Sbjct  437  DEWRAWISNDQVAGYTEGYANNLTFLTIKALNHNSLLKLEKWLPRHTVPEYKPREALDFY  496

Query  240  TRWLEGKSI  214
            +R+L G  I
Sbjct  497  SRFLAGSKI  505



>ref|XP_006664470.1| PREDICTED: serine carboxypeptidase 1-like [Oryza brachyantha]
Length=405

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 142/177 (80%), Gaps = 2/177 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRM GRAWPLRAPVR+G VP+W Q L SG VPC  D VATAWL++ +VR AIHA+  +  
Sbjct  231  TRMLGRAWPLRAPVREGRVPSW-QELASG-VPCMSDEVATAWLNNDDVRAAIHAQPVSAI  288

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G + +CT  + F HD+GSMI YHKNLT +GYRA I+SGDHDMCVPYTGSEAWT+S+GY +
Sbjct  289  GSWVICTGVLDFHHDAGSMISYHKNLTGQGYRAFIYSGDHDMCVPYTGSEAWTKSLGYGV  348

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +D WRPW  N QV+GY QGY++ LTF TIKGAGHTVPEYKP+E+LAFY+RWL G  +
Sbjct  349  VDSWRPWHFNGQVSGYTQGYEHGLTFATIKGAGHTVPEYKPQESLAFYSRWLAGSKL  405



>emb|CDY33713.1| BnaC04g29380D [Brassica napus]
Length=505

 Score =   258 bits (659),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 144/189 (76%), Gaps = 13/189 (7%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAP+  GIVP+W QLL   +VPC DD VATAWL+ P +RKAIHA++E+  G
Sbjct  317  RMFGRAWPVRAPILPGIVPSWSQLLADVSVPCIDDRVATAWLNDPAIRKAIHAKEESEIG  376

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LCT K++F HD+GSMI +H+NLT  GYRALI+SGDHDMCVP+TGSEAWT S+GYK+I
Sbjct  377  RWVLCTGKLSFHHDAGSMISFHRNLTLSGYRALIYSGDHDMCVPFTGSEAWTHSLGYKVI  436

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAG-------------HTVPEYKPKEALAFY  241
            DEWR WI N+QVAGY +GY  NLTFLTIK                HTVPEYKP+EAL FY
Sbjct  437  DEWRAWISNDQVAGYTEGYANNLTFLTIKALNHNSLLKLEKWLPRHTVPEYKPREALDFY  496

Query  240  TRWLEGKSI  214
            +R+L G  I
Sbjct  497  SRFLAGSKI  505



>emb|CDP04192.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   250 bits (639),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 150/186 (81%), Gaps = 13/186 (7%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQS-----GNVPCTDDTVATAWLSSPEVRKAIHAEQ  577
            RMFGRAWP RAPVRDGIVP+WPQL QS      +VPC DD VATAWL++  VRKAIHA  
Sbjct  93   RMFGRAWPYRAPVRDGIVPSWPQLTQSLHARGVSVPCIDDEVATAWLNNEAVRKAIHASP  152

Query  576  EALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS-----GDHDMCVPYTGSEA  412
            E  +G + +C + +++ HD+GSMI YHKNLTS GY ALI+      GDHDMC+P+TG++A
Sbjct  153  E--SGSWGVC-NALSYNHDAGSMIPYHKNLTSAGYPALIYRQKPPYGDHDMCIPFTGTQA  209

Query  411  WTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRW  232
            WT S+GY+++D+WRPW+ N+QVAGY+Q Y +NLTFLT+KG+GHTVPEYKP+E+L FY+RW
Sbjct  210  WTASLGYEVVDQWRPWLSNDQVAGYLQEYAHNLTFLTVKGSGHTVPEYKPRESLDFYSRW  269

Query  231  LEGKSI  214
            L+G+ I
Sbjct  270  LQGQKI  275



>ref|XP_002514834.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF47388.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL   ++DG +  WPQL   G+V C +D  ATAWL+   VRKAIHA+ +++ G
Sbjct  284  RMFGRAWPLWGQMKDGTL--WPQLAYHGSVLCFNDETATAWLNDERVRKAIHAKPKSIAG  341

Query  561  PFELCTDKITFT-HDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            P+ELCTD++ ++ + +GSM+ YHKNLT +GYRALI+SGDHDMCVP+TG++AW RS+GYKI
Sbjct  342  PWELCTDRLNYSSYGAGSMLPYHKNLTLQGYRALIYSGDHDMCVPFTGTQAWVRSLGYKI  401

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +D+WRPWI N QVAGY+QGY  NLTFLT+KGAGHTVPEYKP+E+L FY+RWLEGK I
Sbjct  402  VDQWRPWISNYQVAGYLQGYANNLTFLTVKGAGHTVPEYKPRESLDFYSRWLEGKPI  458



>emb|CDP04193.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 147/181 (81%), Gaps = 8/181 (4%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSG-----NVPCTDDTVATAWLSSPEVRKAIHAEQ  577
            RMFGRAWP RAPVRDG VP+WPQL QS      +VPCT+D VATAWL++  VRKAIHA  
Sbjct  313  RMFGRAWPYRAPVRDGTVPSWPQLTQSLQAQGISVPCTNDEVATAWLNTEAVRKAIHASP  372

Query  576  EALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSV  397
            E  +G + LC + + + HD+GSMI YHKNLTS GY ALI+SGDHDMC+P+T +EAWT S+
Sbjct  373  E--SGSWSLC-NYLAYNHDAGSMIPYHKNLTSAGYPALIYSGDHDMCIPFTATEAWTASL  429

Query  396  GYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKS  217
            GY ++D+WRPW+ N+QVAGY+  Y +NLTFLT+KG+GHTVPEYKP+EAL FYTRWL+G+ 
Sbjct  430  GYPVVDQWRPWLSNDQVAGYLVEYAHNLTFLTVKGSGHTVPEYKPQEALNFYTRWLQGQK  489

Query  216  I  214
            I
Sbjct  490  I  490



>ref|XP_011077160.1| PREDICTED: serine carboxypeptidase-like 20 [Sesamum indicum]
Length=496

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 141/176 (80%), Gaps = 3/176 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGR+WP RAPV DGI+P WPQL++   VPC DD  AT WL+   VRKAIHA  E  +G
Sbjct  324  RMFGRSWPFRAPVEDGIIPLWPQLMRKITVPCMDDVQATIWLNDDAVRKAIHASPE--SG  381

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + LC D + +THD+GSM+ YHKNLTS GYR LI+SGDHDMCVP+TG++AWT+S+GYKI+
Sbjct  382  NWSLCVD-LRYTHDAGSMLSYHKNLTSSGYRVLIYSGDHDMCVPFTGTQAWTQSLGYKIV  440

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPW  N Q+AG+IQ Y  + TFLT+KGAGHTVPEYKP+E+L F++RW+EG  I
Sbjct  441  DEWRPWKSNRQIAGFIQEYANDFTFLTVKGAGHTVPEYKPRESLHFFSRWIEGLRI  496



>ref|XP_004492215.1| PREDICTED: serine carboxypeptidase-like 20-like [Cicer arietinum]
Length=486

 Score =   254 bits (650),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGN-VPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            RMFGRAWP + P ++GIVP+WPQL+ S N VPC DD V+  WL++PEVRKAIH  ++++ 
Sbjct  312  RMFGRAWPYKVPFKNGIVPSWPQLMSSNNHVPCIDDEVSVIWLNNPEVRKAIHTVEKSVK  371

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
              + LCT+ I + HD+GSMI YHK LTS+GYRALI+SGDHDMCVPYTG+EAWT S+GY I
Sbjct  372  -EWSLCTN-IEYYHDTGSMIPYHKKLTSKGYRALIYSGDHDMCVPYTGTEAWTSSIGYNI  429

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWRPW+ N QVAGY QGY  NLTF+T+KG+GHTVPEYKP EAL FY+ ++ GK +
Sbjct  430  VDEWRPWLTNGQVAGYTQGYANNLTFVTVKGSGHTVPEYKPAEALHFYSHFITGKPL  486



>ref|NP_001066510.1| Os12g0257000 [Oryza sativa Japonica Group]
 sp|P37890.1|CBP1_ORYSJ RecName: Full=Serine carboxypeptidase 1; AltName: Full=Carboxypeptidase 
C; AltName: Full=Serine carboxypeptidase I; Contains: 
RecName: Full=Serine carboxypeptidase 1 chain A; AltName: 
Full=Serine carboxypeptidase I chain A; Contains: RecName: 
Full=Serine carboxypeptidase 1 chain B; AltName: Full=Serine 
carboxypeptidase I chain B; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAA04510.1| serine carboxypeptidase I [Oryza sativa Japonica Group]
 gb|ABA96977.2| Serine carboxypeptidase I precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29529.1| Os12g0257000 [Oryza sativa Japonica Group]
Length=510

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 141/180 (78%), Gaps = 3/180 (2%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSG---NVPCTDDTVATAWLSSPEVRKAIHAEQE  574
            TRM GRAWPLRAPVR G VP+W +  +      VPC  D VATAWL++ +VR AIHA+  
Sbjct  331  TRMHGRAWPLRAPVRAGRVPSWQEFARGSRPSGVPCMSDEVATAWLNNDDVRAAIHAQPV  390

Query  573  ALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVG  394
            +  G + +CT+ + F HD+GSMI YHKNLT +GYRA I+SGDHDMCVPYTG+EAWTRS+G
Sbjct  391  SSIGSWLICTNVLDFIHDAGSMISYHKNLTGQGYRAFIYSGDHDMCVPYTGTEAWTRSLG  450

Query  393  YKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            Y +ID WRPW +N QV+GY QGY++ LTF TIKGAGHTVPEYKP+E+LAFY+RWL G  +
Sbjct  451  YGVIDSWRPWHLNGQVSGYTQGYEHGLTFATIKGAGHTVPEYKPQESLAFYSRWLAGSKL  510



>gb|EEC69080.1| hypothetical protein OsI_37959 [Oryza sativa Indica Group]
Length=507

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 141/180 (78%), Gaps = 3/180 (2%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSG---NVPCTDDTVATAWLSSPEVRKAIHAEQE  574
            TRM GRAWPLRAPVR G VP+W +  +      VPC  D VATAWL++ +VR AIHA+  
Sbjct  328  TRMHGRAWPLRAPVRAGRVPSWQEFARGSRPSGVPCMSDEVATAWLNNDDVRAAIHAQPV  387

Query  573  ALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVG  394
            +  G + +CT+ + F HD+GSMI YHKNLT +GYRA I+SGDHDMCVPYTG+EAWTRS+G
Sbjct  388  SSIGSWLICTNVLDFIHDAGSMISYHKNLTGQGYRAFIYSGDHDMCVPYTGTEAWTRSLG  447

Query  393  YKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            Y +ID WRPW +N QV+GY QGY++ LTF TIKGAGHTVPEYKP+E+LAFY+RWL G  +
Sbjct  448  YGVIDSWRPWHLNGQVSGYTQGYEHGLTFATIKGAGHTVPEYKPQESLAFYSRWLAGSKL  507



>gb|EEE53029.1| hypothetical protein OsJ_35748 [Oryza sativa Japonica Group]
Length=512

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 141/180 (78%), Gaps = 3/180 (2%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSG---NVPCTDDTVATAWLSSPEVRKAIHAEQE  574
            TRM GRAWPLRAPVR G VP+W +  +      VPC  D VATAWL++ +VR AIHA+  
Sbjct  333  TRMHGRAWPLRAPVRAGRVPSWQEFARGSRPSGVPCMSDEVATAWLNNDDVRAAIHAQPV  392

Query  573  ALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVG  394
            +  G + +CT+ + F HD+GSMI YHKNLT +GYRA I+SGDHDMCVPYTG+EAWTRS+G
Sbjct  393  SSIGSWLICTNVLDFIHDAGSMISYHKNLTGQGYRAFIYSGDHDMCVPYTGTEAWTRSLG  452

Query  393  YKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            Y +ID WRPW +N QV+GY QGY++ LTF TIKGAGHTVPEYKP+E+LAFY+RWL G  +
Sbjct  453  YGVIDSWRPWHLNGQVSGYTQGYEHGLTFATIKGAGHTVPEYKPQESLAFYSRWLAGSKL  512



>gb|EYU39461.1| hypothetical protein MIMGU_mgv1a005253mg [Erythranthe guttata]
Length=492

 Score =   252 bits (644),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 141/176 (80%), Gaps = 3/176 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP  APV DGI+P+WPQL++   VPC DD  AT WL++  VR+AIH   E  +G
Sbjct  320  RMFGRAWPFYAPVEDGIIPSWPQLMRKVPVPCLDDVQATIWLNNDAVREAIHVNPE--SG  377

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + +C D I +THD+GSMI YHKNLTS GYRALI+SGDHDMCVP+TG++AWT S+GYK +
Sbjct  378  EWSMCVD-IKYTHDAGSMISYHKNLTSSGYRALIYSGDHDMCVPFTGTQAWTESLGYKTV  436

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR W  N QVAG++Q Y  NLTFLTIKGAGHTVPEYKP+E+L F++RWL+G+ I
Sbjct  437  DEWRFWKSNGQVAGFLQEYANNLTFLTIKGAGHTVPEYKPRESLDFFSRWLQGQPI  492



>gb|KFK36172.1| hypothetical protein AALP_AA4G087600 [Arabis alpina]
Length=800

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -2

Query  711  APVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTGPFELCTDKIT  532
            A V  GIVP+W QLL + NVPC DD VATAWL+ P VRKA+HA++E+  G + LCTDK+ 
Sbjct  265  AVVHPGIVPSWSQLLANANVPCVDDRVATAWLNDPAVRKAVHAKEESEIGRWVLCTDKLF  324

Query  531  FTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNE  352
            ++HD+GSMIK+H+NLT  GYRALI+SGDHDMCVPYTGSEAWT+S+GYK++DEWRPWI N 
Sbjct  325  YSHDAGSMIKFHRNLTLSGYRALIYSGDHDMCVPYTGSEAWTQSMGYKVVDEWRPWISNG  384

Query  351  QVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI*NIRYY  196
             V G+ QGY  NLTFLTIKGAGHTVPEYKP+EAL FY+R+L G+ +  + YY
Sbjct  385  MVGGFTQGYANNLTFLTIKGAGHTVPEYKPQEALDFYSRFLAGEKMVLVDYY  436



>gb|KFK39839.1| hypothetical protein AALP_AA3G294800, partial [Arabis alpina]
Length=480

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL   VR  IVP+W QLL   N  C DD +AT WL+ P VRKA+HA++E+  G
Sbjct  305  RMFGRAWPLDVAVRPCIVPSWSQLLADSNGFCIDDRIATTWLNDPAVRKAVHAKEESEIG  364

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + + T +I + H+ GSMI++H+NLT  GYRALI+SGDHDMCVPYTGSEAWT+S+GY ++
Sbjct  365  RWVMYTKQIIYDHNIGSMIEFHRNLTLSGYRALIYSGDHDMCVPYTGSEAWTKSMGYNVV  424

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWRPWI N  V G+ QGY  NLTFLTIKGAGHTVPEYKP+EAL FY+R+L G+ I
Sbjct  425  DEWRPWISNGMVGGFTQGYANNLTFLTIKGAGHTVPEYKPQEALDFYSRFLAGEKI  480



>gb|KFK23485.1| hypothetical protein AALP_AAs46213U000800 [Arabis alpina]
Length=437

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAPVR GIVP+W QLL   +VPC DDTVATAWL+ P  RKA+H ++     
Sbjct  270  RMFGRAWPVRAPVRPGIVPSWYQLLAHISVPCIDDTVATAWLNDPATRKALHTKERDWK-  328

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
              E+CT K++F+HD+GSMI+ H+NLT  GYRALI+SGDHDMCVP+TGS+AWTRS+GYK++
Sbjct  329  -LEICTGKLSFSHDAGSMIRVHRNLTLSGYRALIYSGDHDMCVPFTGSQAWTRSLGYKVV  387

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKE  256
            DEWR WI N QVAGY QGY  NLTFLTIK  GHTVPEYKP+E
Sbjct  388  DEWRAWISNSQVAGYTQGYANNLTFLTIKDVGHTVPEYKPRE  429



>gb|AES78951.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=495

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 139/178 (78%), Gaps = 2/178 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQS--GNVPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            RMFGRAWP RA V+DG VP+WP+L  +  G  PC DD V+  WL++ +VR+AIH  +E++
Sbjct  318  RMFGRAWPYRAIVKDGYVPSWPELESNSGGAPPCVDDEVSVIWLNNRKVRRAIHTVKESV  377

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
               + LCT K+ + HDSGSMI YHK LTS+GYRAL++SGDHDMCVP+TG+EAWTRSVGYK
Sbjct  378  VKEWVLCTGKVRYVHDSGSMIPYHKKLTSKGYRALVYSGDHDMCVPFTGTEAWTRSVGYK  437

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            IID WRPW++N Q+AG+ QGY  N TFLT+KG+GHTVPEYKP EA  FY  ++ G  I
Sbjct  438  IIDPWRPWLINNQIAGFTQGYANNFTFLTVKGSGHTVPEYKPHEAFHFYQHFINGLPI  495



>ref|XP_003622733.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=492

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 139/178 (78%), Gaps = 2/178 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQS--GNVPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            RMFGRAWP RA V+DG VP+WP+L  +  G  PC DD V+  WL++ +VR+AIH  +E++
Sbjct  315  RMFGRAWPYRAIVKDGYVPSWPELESNSGGAPPCVDDEVSVIWLNNRKVRRAIHTVKESV  374

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
               + LCT K+ + HDSGSMI YHK LTS+GYRAL++SGDHDMCVP+TG+EAWTRSVGYK
Sbjct  375  VKEWVLCTGKVRYVHDSGSMIPYHKKLTSKGYRALVYSGDHDMCVPFTGTEAWTRSVGYK  434

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            IID WRPW++N Q+AG+ QGY  N TFLT+KG+GHTVPEYKP EA  FY  ++ G  I
Sbjct  435  IIDPWRPWLINNQIAGFTQGYANNFTFLTVKGSGHTVPEYKPHEAFHFYQHFINGLPI  492



>emb|CAB53091.1| SERINE CARBOXYPEPTIDASE I PRECURSOR-like protein [Arabidopsis 
thaliana]
 emb|CAB78333.1| SERINE CARBOXYPEPTIDASE I PRECURSOR-like protein [Arabidopsis 
thaliana]
Length=456

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 133/161 (83%), Gaps = 4/161 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQ----E  574
            RMFGRAWP+RAPV  GIVP+W QLL    VPC DD VATAWL+ PE+RKAIH ++    E
Sbjct  290  RMFGRAWPVRAPVHPGIVPSWSQLLADVTVPCIDDRVATAWLNDPEIRKAIHTKEVSNSE  349

Query  573  ALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVG  394
            +  G +ELC+ K++F HD+GSMI +H+NLT  GYRALI+SGDHDMCVP+TGSEAWT+S+G
Sbjct  350  SEIGRWELCSGKLSFYHDAGSMIDFHRNLTLSGYRALIYSGDHDMCVPFTGSEAWTKSLG  409

Query  393  YKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPE  271
            YK+IDEWR WI N+QVAGY QGY  NLTFLTIKGAGHTVPE
Sbjct  410  YKVIDEWRAWISNDQVAGYTQGYANNLTFLTIKGAGHTVPE  450



>ref|XP_001770944.1| predicted protein [Physcomitrella patens]
 gb|EDQ64274.1| predicted protein [Physcomitrella patens]
Length=496

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 137/180 (76%), Gaps = 4/180 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQL----LQSGNVPCTDDTVATAWLSSPEVRKAIHAEQE  574
            R FGRA+PLR P+R G VPTWP L      S NVPCTDD +A  WL++ EVR A+HA+  
Sbjct  317  RQFGRAYPLRLPLRAGRVPTWPSLSHALFDSENVPCTDDRIAGTWLNNAEVRAALHAKPA  376

Query  573  ALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVG  394
            A  GP++LCTD I F HD+GSMI  H+ LT+ GYRALI+SGDHDMCVPYTGSEAWT S+G
Sbjct  377  ADIGPWDLCTDNIIFYHDAGSMIPIHRELTTSGYRALIYSGDHDMCVPYTGSEAWTSSMG  436

Query  393  YKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            Y++ D+WR W V  QVAG+ QGY  NLTF TIKG+GHTVPEYKP EALAF+ R+L  + +
Sbjct  437  YEVTDQWRAWFVGRQVAGFTQGYANNLTFATIKGSGHTVPEYKPAEALAFFQRFLSAQPL  496



>ref|XP_002514835.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF47389.1| serine carboxypeptidase, putative [Ricinus communis]
Length=491

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            R++GRAWPLR  +  G +  W Q+   G+V C +D VATAWL+   VRKA+HAE +++ G
Sbjct  317  RIYGRAWPLRGQLTPGTL--WHQVAAQGSVTCFNDEVATAWLNDDTVRKALHAESKSIAG  374

Query  561  PFELCTDKITFTH-DSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
             +ELC+ +I+++   SGSMI YHKNLT +GYRALI+SGDHDMCVP+TG++AWTRS+GYK 
Sbjct  375  SWELCSSRISYSRFSSGSMIPYHKNLTIQGYRALIYSGDHDMCVPFTGTQAWTRSLGYKT  434

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +DEWR W  ++QVAGY+QGYDYN TFLTIKGAGHTVPEYKP+E+L FY+RWL+GK I
Sbjct  435  VDEWRSWTSDDQVAGYLQGYDYNFTFLTIKGAGHTVPEYKPRESLDFYSRWLDGKPI  491



>ref|XP_006652175.1| PREDICTED: serine carboxypeptidase 1-like [Oryza brachyantha]
Length=370

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM GR+WPLRA + DG +  WP+L    ++PCT D +A AWL   +VR AIHAE ++L G
Sbjct  195  RMAGRSWPLRAAITDGRMTMWPEL-GGRSLPCTSDELANAWLDDEDVRAAIHAEPKSLIG  253

Query  561  PFELCTDKITFTHDSGS-MIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
             +EL T +I + HDSGS M+KYHK  T+ GYR LI+SGDHD+C+PY G+EAW RS+GY++
Sbjct  254  SWELYTARIDYYHDSGSSMVKYHKKFTAMGYRVLIYSGDHDLCIPYVGTEAWIRSMGYRV  313

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            ID WRPW   EQVAGY +GY++NLTFLTIKGAGHTVPEYKPKE L FYTRWL G+ I
Sbjct  314  IDSWRPWYFGEQVAGYTEGYEHNLTFLTIKGAGHTVPEYKPKETLEFYTRWLSGEKI  370



>emb|CDJ26557.1| unnamed protein product [Triticum aestivum]
Length=369

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM G +WPL  PV  G V  WP+L    ++PCT D +AT WL   +VR AIHA+ ++L G
Sbjct  195  RMAGLSWPLGLPVSSGHVTLWPEL-GGRSLPCTSDELATIWLDDEDVRAAIHAKAKSLIG  253

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +EL T +I +THD+GSM++YHK  T+ GYR LI+SGDHD+C+P+TG+EAW RS+GY+++
Sbjct  254  SWELNTARIDYTHDTGSMVEYHKKFTAMGYRVLIYSGDHDLCIPFTGTEAWVRSLGYRVV  313

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW    QVAGY QGYD+NLTFLTIKG+GHTVPEYKPKE+LAFYT WL G+ I
Sbjct  314  DSWRPWHFGGQVAGYTQGYDHNLTFLTIKGSGHTVPEYKPKESLAFYTHWLFGEKI  369



>ref|NP_001052464.1| Os04g0321700 [Oryza sativa Japonica Group]
 emb|CAD40292.2| OSJNBb0062H02.3 [Oryza sativa Japonica Group]
 dbj|BAF14378.1| Os04g0321700 [Oryza sativa Japonica Group]
 emb|CAH66333.1| OSIGBa0097I24.1 [Oryza sativa Indica Group]
 dbj|BAG94108.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77014.1| hypothetical protein OsI_15357 [Oryza sativa Indica Group]
 gb|EEE60735.1| hypothetical protein OsJ_14259 [Oryza sativa Japonica Group]
Length=504

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM GR+WPLRAPV  G +  WP+L    ++PCT D +A AWL   +VR AIHAE ++L G
Sbjct  329  RMAGRSWPLRAPVTRGRMTMWPEL-GGRSLPCTSDELANAWLDDEDVRAAIHAEPKSLIG  387

Query  561  PFELCTDKITFTHDSG-SMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
             +EL T +I + HD+G SM+KYHK  T+ GYRALI+SGDHD+C+PY G+EAW RS+GY++
Sbjct  388  SWELYTARIEYYHDTGDSMVKYHKKFTAMGYRALIYSGDHDLCIPYVGTEAWVRSMGYRV  447

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            ID WRPW    QVAGY QGY++NLTFLTIKGAGHTVPEYKPKE LAFY+ WL GK I
Sbjct  448  IDHWRPWYFGGQVAGYTQGYEHNLTFLTIKGAGHTVPEYKPKETLAFYSHWLSGKKI  504



>ref|XP_002447646.1| hypothetical protein SORBIDRAFT_06g011100 [Sorghum bicolor]
 gb|EES11974.1| hypothetical protein SORBIDRAFT_06g011100 [Sorghum bicolor]
Length=492

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM GR+WPLR  ++DG VP WP L    ++PCT D VAT WL   +VR AIHA+ ++L G
Sbjct  318  RMAGRSWPLRLALKDGHVPMWPGL-GGRSLPCTSDEVATTWLDDEDVRAAIHAKPKSLIG  376

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +EL T +I FTHD+G+M+ YHK LT  GYR LI+SGDHD+C+PY G+EAW +S+GY+++
Sbjct  377  SWELYTARIDFTHDTGTMLTYHKKLTGLGYRVLIYSGDHDLCIPYPGTEAWVKSIGYQVV  436

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW   +QVAGY +GY +NLTFLTIKGAGH VPEYKPKEALAFY+RWL G+  
Sbjct  437  DRWRPWYFGDQVAGYTEGYGHNLTFLTIKGAGHAVPEYKPKEALAFYSRWLAGEKF  492



>ref|XP_004975273.1| PREDICTED: serine carboxypeptidase 1-like isoform X2 [Setaria 
italica]
Length=493

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM GR+WPLR  +R G VP WP L    ++PCT D +ATAWL   +VR AIHA+ ++L G
Sbjct  319  RMAGRSWPLRLALRGGHVPMWPGL-GGRSLPCTSDELATAWLDDEDVRAAIHAKPKSLIG  377

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +EL T +I +THD+G+M+ YHK  T+ GYR LI+SGDHD+C+P+ G+EAW RS+GY+++
Sbjct  378  SWELYTARIDYTHDTGTMVSYHKKFTALGYRVLIYSGDHDLCIPFPGTEAWVRSIGYQVV  437

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW   +QVAGY +GYD+NLTFLTIKGAGH VPEYKPKE+LAFY+RWL G+  
Sbjct  438  DRWRPWYFGDQVAGYAEGYDHNLTFLTIKGAGHAVPEYKPKESLAFYSRWLAGEKF  493



>ref|XP_004975272.1| PREDICTED: serine carboxypeptidase 1-like isoform X1 [Setaria 
italica]
Length=523

 Score =   240 bits (613),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM GR+WPLR  +R G VP WP L    ++PCT D +ATAWL   +VR AIHA+ ++L G
Sbjct  349  RMAGRSWPLRLALRGGHVPMWPGL-GGRSLPCTSDELATAWLDDEDVRAAIHAKPKSLIG  407

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +EL T +I +THD+G+M+ YHK  T+ GYR LI+SGDHD+C+P+ G+EAW RS+GY+++
Sbjct  408  SWELYTARIDYTHDTGTMVSYHKKFTALGYRVLIYSGDHDLCIPFPGTEAWVRSIGYQVV  467

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW   +QVAGY +GYD+NLTFLTIKGAGH VPEYKPKE+LAFY+RWL G+  
Sbjct  468  DRWRPWYFGDQVAGYAEGYDHNLTFLTIKGAGHAVPEYKPKESLAFYSRWLAGEKF  523



>ref|XP_008663135.1| PREDICTED: serine carboxypeptidase 1-like [Zea mays]
 gb|AFW58027.1| hypothetical protein ZEAMMB73_889629 [Zea mays]
Length=519

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM GR+WPLR  ++DG VP WP L    ++PCT D VATAWL   +VR AIHA+ ++L G
Sbjct  345  RMSGRSWPLRLALKDGHVPMWPGL-SGRSLPCTSDEVATAWLDDEDVRAAIHAKPKSLIG  403

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +EL T +I FTHD+G+M+ YHK  T+ GYR LI+SGDHD+C+PY G+EAW +S+GY++ 
Sbjct  404  SWELYTARIDFTHDTGTMVSYHKKFTALGYRVLIYSGDHDLCIPYPGTEAWVKSIGYQVT  463

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW   +QVAGY +GY +N+TFLTIKGAGH VPEYKPKEALAFY+RWL G+  
Sbjct  464  DRWRPWYFGDQVAGYTEGYGHNITFLTIKGAGHAVPEYKPKEALAFYSRWLAGEKF  519



>ref|XP_004975271.1| PREDICTED: serine carboxypeptidase 1-like [Setaria italica]
Length=497

 Score =   239 bits (611),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 134/176 (76%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM GR+WPLR  ++DG VP WP L    ++PCT+D +AT WL    VR AIHA+ ++L G
Sbjct  323  RMAGRSWPLRLALKDGHVPMWPGL-GGRSLPCTNDEIATTWLDDEGVRAAIHAKSKSLIG  381

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +EL T +I FTHD+G+M+ YHK  T+ GYR LI+SGDHD+C+PY G+EAW +S+GY+ +
Sbjct  382  SWELYTARIDFTHDTGTMVLYHKKFTALGYRVLIYSGDHDLCIPYPGTEAWVKSIGYQTV  441

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW    QVAGY QGYD+NLTFLTIKGAGH VPEYKPKEA AFY+RWL G+  
Sbjct  442  DRWRPWYFGGQVAGYTQGYDHNLTFLTIKGAGHAVPEYKPKEAFAFYSRWLAGEKF  497



>ref|XP_002863203.1| hypothetical protein ARALYDRAFT_333040 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39462.1| hypothetical protein ARALYDRAFT_333040 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWP+RAPVR GIVP+W QLL   +VPC DD VATAWL+ P +RKAIH ++E+  G
Sbjct  317  RMFGRAWPVRAPVRPGIVPSWSQLLADVSVPCIDDRVATAWLNDPAIRKAIHTKEESEIG  376

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELC+ K++F HD+GSMIK+H+NLT  GYRALI+SGDHDMCVP+TGSEAWT+S+GYK+I
Sbjct  377  RWELCSGKLSFDHDAGSMIKFHRNLTLSGYRALIYSGDHDMCVPFTGSEAWTKSLGYKVI  436

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKG  292
            DEWR WI N+QVAGY QGY  NLTFLTIK 
Sbjct  437  DEWRAWISNDQVAGYTQGYANNLTFLTIKA  466



>prf||1314177B CPase I B
Length=148

 Score =   226 bits (577),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  657  NVPCTDDTVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSR  478
             VPC  D VATAWL +  VR AIHA+  +  GP+ LCTDK+ F HD+GSMI YHKNLTS+
Sbjct  1    GVPCMSDEVATAWLDNAAVRSAIHAQSVSAIGPWLLCTDKLYFVHDAGSMIAYHKNLTSQ  60

Query  477  GYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTI  298
            GYRA+IFSGDHDM VP+TGSEAWT+S+GY ++D WRPWI N QV+GY +GY++ LTF TI
Sbjct  61   GYRAIIFSGDHDMXVPFTGSEAWTKSLGYGVVDSWRPWITNGQVSGYTEGYEHGLTFATI  120

Query  297  KGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            KGAGHTVPEYKP+EA AFY+RWL G  +
Sbjct  121  KGAGHTVPEYKPQEAFAFYSRWLAGSKL  148



>gb|KDO58563.1| hypothetical protein CISIN_1g010880mg [Citrus sinensis]
Length=463

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVP+WPQLL S +VPCTDD VAT WL+   VR AIHAE E++ G
Sbjct  322  RMFGRAWPLRAPVRDGIVPSWPQLLNSNSVPCTDDRVATLWLNDAAVRTAIHAEPESIAG  381

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I F HD+GSMIKYHKNLT RGYRALIFSGDHDMCVP+TGSEAWTRSVGYKI+
Sbjct  382  SWELCTDRILFEHDAGSMIKYHKNLTLRGYRALIFSGDHDMCVPFTGSEAWTRSVGYKIV  441

Query  381  DEWRPWIVNEQVAGYI  334
            D+WRPW  N QVAGY 
Sbjct  442  DKWRPWTSNGQVAGYF  457



>gb|EMT23913.1| Serine carboxypeptidase 1 [Aegilops tauschii]
Length=467

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM G +WPL  PV  G V  WP+L    ++PCT D +AT WL   +VR  IHA+ ++L G
Sbjct  293  RMAGLSWPLGLPVSSGHVTLWPEL-GGRSLPCTSDELATIWLDDEDVRAVIHAKPKSLIG  351

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +EL T +I +THD+GSM++YHK  T+ GYR LI+SGDHD+C+P+TG+EAW RS+GY+++
Sbjct  352  SWELNTARIDYTHDTGSMVEYHKKFTATGYRVLIYSGDHDLCIPFTGTEAWVRSLGYRVV  411

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW    QVAGY QGYD+NLTFLTIKG+GHTVPEYKPKE+LAFYT WL G+ I
Sbjct  412  DSWRPWHFGGQVAGYTQGYDHNLTFLTIKGSGHTVPEYKPKESLAFYTHWLFGEKI  467



>ref|XP_006447984.1| hypothetical protein CICLE_v10014996mg [Citrus clementina]
 gb|ESR61224.1| hypothetical protein CICLE_v10014996mg [Citrus clementina]
Length=486

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVP+WPQLL S +VPCTDD VAT WL+   VR AIHAE E++ G
Sbjct  322  RMFGRAWPLRAPVRDGIVPSWPQLLNSNSVPCTDDRVATLWLNDAAVRTAIHAEPESIAG  381

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELCTD+I F HD+GSMIKYHKNLT RGYRALIFSGDHDMCVP+TGSEAWTRSVGYKI+
Sbjct  382  SWELCTDRILFEHDAGSMIKYHKNLTLRGYRALIFSGDHDMCVPFTGSEAWTRSVGYKIV  441

Query  381  DEWRPWIVNEQVAG  340
            D+WRPW  N QVAG
Sbjct  442  DKWRPWTSNGQVAG  455



>ref|XP_007049588.1| Serine carboxypeptidase-like 20 isoform 2 [Theobroma cacao]
 gb|EOX93745.1| Serine carboxypeptidase-like 20 isoform 2 [Theobroma cacao]
Length=457

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPLRAPVRDGIVPTWPQLL S +VPC DD +AT WL+   VRKAIHAE+E + G
Sbjct  324  RMFGRAWPLRAPVRDGIVPTWPQLLDSQSVPCMDDEIATKWLNDAAVRKAIHAEEETVIG  383

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             ++LCTD I + HD+GSMIKYHKNLTSRGYRALIFSGDHDMCVP+TGS+AWTRSVGYKI+
Sbjct  384  TWQLCTDNILYDHDAGSMIKYHKNLTSRGYRALIFSGDHDMCVPFTGSQAWTRSVGYKIV  443

Query  381  DEWRPWIVNEQVAG  340
            DEWRPW  + QVAG
Sbjct  444  DEWRPWTSHGQVAG  457



>ref|XP_007029290.1| Serine carboxypeptidase-like 20 isoform 2, partial [Theobroma 
cacao]
 gb|EOY09792.1| Serine carboxypeptidase-like 20 isoform 2, partial [Theobroma 
cacao]
Length=467

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSG-NVPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            TRMFGRAWP RAPV+DGIVP WP+L  +  +V C +D VAT WL+  EVRKAIHAE E +
Sbjct  312  TRMFGRAWPFRAPVKDGIVPLWPELAANKLHVSCINDEVATTWLNDAEVRKAIHAEPENV  371

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
             GP+ELCTD+I++ HD+GSMI YHK LT+ GYRALIFSGDHDMCVPYTGS+AWT+S+GYK
Sbjct  372  AGPWELCTDRISYDHDAGSMIPYHKTLTAEGYRALIFSGDHDMCVPYTGSQAWTKSLGYK  431

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIK  295
               +WR W  N+QVAGY+QGY++N+TFLT+K
Sbjct  432  TTIQWRSWFSNQQVAGYLQGYEHNITFLTVK  462



>ref|XP_007029291.1| Serine carboxypeptidase-like 20 isoform 3, partial [Theobroma 
cacao]
 gb|EOY09793.1| Serine carboxypeptidase-like 20 isoform 3, partial [Theobroma 
cacao]
Length=458

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSG-NVPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            TRMFGRAWP RAPV+DGIVP WP+L  +  +V C +D VAT WL+  EVRKAIHAE E +
Sbjct  307  TRMFGRAWPFRAPVKDGIVPLWPELAANKLHVSCINDEVATTWLNDAEVRKAIHAEPENV  366

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
             GP+ELCTD+I++ HD+GSMI YHK LT+ GYRALIFSGDHDMCVPYTGS+AWT+S+GYK
Sbjct  367  AGPWELCTDRISYDHDAGSMIPYHKTLTAEGYRALIFSGDHDMCVPYTGSQAWTKSLGYK  426

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIK  295
               +WR W  N+QVAGY+QGY++N+TFLT+K
Sbjct  427  TTIQWRSWFSNQQVAGYLQGYEHNITFLTVK  457



>emb|CDM85928.1| unnamed protein product [Triticum aestivum]
Length=462

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 130/177 (73%), Gaps = 24/177 (14%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRM GRAWPLRAPV+ G VP W Q + SG VPC   ++                      
Sbjct  310  TRMLGRAWPLRAPVKAGRVPLW-QEVASG-VPCMVSSI----------------------  345

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ LCTDKI F HD+GSMI YHKNLTS+GYRA+IFSGDHDMCVPYTGSEAWT+S+GY +
Sbjct  346  GPWLLCTDKIDFNHDAGSMISYHKNLTSQGYRAIIFSGDHDMCVPYTGSEAWTKSMGYGV  405

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            +D WRPW  NEQV+GY +GY++ LTF TIKGAGHTVPEYKP+EALAFY+RWL G  +
Sbjct  406  VDSWRPWFTNEQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEALAFYSRWLNGSKL  462



>gb|KCW63274.1| hypothetical protein EUGRSUZ_G00901 [Eucalyptus grandis]
Length=481

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 139/178 (78%), Gaps = 2/178 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMF    PL    +D  V + PQ   + ++PC +D +ATAWL++  VR+AIHA   ++ G
Sbjct  304  RMFSYDSPLWLLGKDNTVTSSPQSANAFHIPCFNDDLATAWLNNEAVREAIHAAPASVAG  363

Query  561  PFELCTDKI--TFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
            P+E+C  ++   +T D+GSMI YHK+L S GYRALI+SGDHD  VPYTG++AWTRS+GYK
Sbjct  364  PWEICAIRVRRNYTIDTGSMIPYHKSLISEGYRALIYSGDHDSVVPYTGTQAWTRSLGYK  423

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            I+DEWR WI +EQVAGY+QGYD+NLTFLT+KGAGHTVP+YKP+E+L FYTRWL+GK I
Sbjct  424  IVDEWRSWISSEQVAGYLQGYDHNLTFLTVKGAGHTVPQYKPRESLDFYTRWLDGKPI  481



>ref|XP_011016540.1| PREDICTED: serine carboxypeptidase 1-like isoform X3 [Populus 
euphratica]
Length=379

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL A  +DG  P+W +L   G+VPC +D VAT WL+   VRKAIHAE +++ G
Sbjct  212  RMFGRAWPLWAFEKDGSFPSWSELALQGSVPCVNDEVATTWLNDESVRKAIHAEPKSIAG  271

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+++C+D+I + + +G+M+ YHKNLT++GYRALI+SGDHDMCVP+TG++AWTRS+GYKII
Sbjct  272  PWQICSDRIDYGYSAGNMLPYHKNLTAQGYRALIYSGDHDMCVPFTGTQAWTRSLGYKII  331

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIK  295
            DEWR WI NEQVAGY+QGYD NLTFLTIK
Sbjct  332  DEWRSWISNEQVAGYLQGYDNNLTFLTIK  360



>ref|XP_011016537.1| PREDICTED: serine carboxypeptidase 1-like isoform X1 [Populus 
euphratica]
Length=405

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL A  +DG  P+W +L   G+VPC +D VAT WL+   VRKAIHAE +++ G
Sbjct  238  RMFGRAWPLWAFEKDGSFPSWSELALQGSVPCVNDEVATTWLNDESVRKAIHAEPKSIAG  297

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+++C+D+I + + +G+M+ YHKNLT++GYRALI+SGDHDMCVP+TG++AWTRS+GYKII
Sbjct  298  PWQICSDRIDYGYSAGNMLPYHKNLTAQGYRALIYSGDHDMCVPFTGTQAWTRSLGYKII  357

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIK  295
            DEWR WI NEQVAGY+QGYD NLTFLTIK
Sbjct  358  DEWRSWISNEQVAGYLQGYDNNLTFLTIK  386



>ref|XP_011016538.1| PREDICTED: serine carboxypeptidase 1-like isoform X2 [Populus 
euphratica]
Length=407

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL A  +DG  P+W +L   G+VPC +D VAT WL+   VRKAIHAE +++ G
Sbjct  240  RMFGRAWPLWAFEKDGSFPSWSELALQGSVPCVNDEVATTWLNDESVRKAIHAEPKSIAG  299

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+++C+D+I + + +G+M+ YHKNLT++GYRALI+SGDHDMCVP+TG++AWTRS+GYKII
Sbjct  300  PWQICSDRIDYGYSAGNMLPYHKNLTAQGYRALIYSGDHDMCVPFTGTQAWTRSLGYKII  359

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIK  295
            DEWR WI NEQVAGY+QGYD NLTFLTIK
Sbjct  360  DEWRSWISNEQVAGYLQGYDNNLTFLTIK  388



>ref|XP_010070327.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
 gb|KCW58996.1| hypothetical protein EUGRSUZ_H01620 [Eucalyptus grandis]
Length=496

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 131/177 (74%), Gaps = 6/177 (3%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            T MFG+A P   P+  G +   P+      VPC DD  A  WL+   VRKAIHA   ++ 
Sbjct  326  TGMFGQASPCWPPIDAGALSPAPE------VPCVDDEAAVGWLNDEAVRKAIHAAPASVA  379

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ +C  ++ ++  + SMI YHKNLTS GYR LI+SGDHDM VP+ G++AWTRS+GYKI
Sbjct  380  GPWWICAPRVNYSRGNESMIPYHKNLTSWGYRVLIYSGDHDMAVPFPGTQAWTRSMGYKI  439

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            IDEWRPW++++QVAGY+QGYD N TFLTIKGAGHTVP+ KP+EAL FY+RWL+GK I
Sbjct  440  IDEWRPWMIDDQVAGYLQGYDNNFTFLTIKGAGHTVPQSKPREALEFYSRWLDGKPI  496



>gb|KCW63276.1| hypothetical protein EUGRSUZ_G00904 [Eucalyptus grandis]
Length=492

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 136/178 (76%), Gaps = 2/178 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM     PL    +D ++ + PQ   + ++PC +D  ATAWL++  V++AIHA   ++ G
Sbjct  315  RMLSYDSPLWLLGKDNMITSSPQSANAFHIPCFNDDFATAWLNNEAVQEAIHAAPASVAG  374

Query  561  PFELCTDKI--TFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
            P+E+C  ++   +T D+GSMI YHK+L S GYR LI+SGDHD  VPYTG++AWTRS+GYK
Sbjct  375  PWEICRTRVRRNYTIDTGSMIPYHKSLISEGYRVLIYSGDHDSVVPYTGTQAWTRSLGYK  434

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            I+DEWR WI +EQVAGY+QGYD+NLTFLT+KGAGH VP+YKP+E+L FYTRWL+GK I
Sbjct  435  IVDEWRSWISSEQVAGYLQGYDHNLTFLTVKGAGHAVPQYKPRESLDFYTRWLDGKPI  492



>gb|KCW58999.1| hypothetical protein EUGRSUZ_H01627 [Eucalyptus grandis]
Length=481

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL  PVRDG VP WPQL +  +V C +D VAT+WL++  VR+AIHA    ++G
Sbjct  305  RMFGRAWPLWLPVRDGTVPLWPQLAKKFHVACVNDEVATSWLNNDRVREAIHAASVNVSG  364

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            P+ELCT++I +  +SGSMI YHKNLT++ +RALIFSGDHDMCVP+TGS+AWT+S+GY+I+
Sbjct  365  PWELCTERIKYRRNSGSMIPYHKNLTTQNFRALIFSGDHDMCVPFTGSQAWTQSLGYRIM  424

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIK  295
            DEWRPW+  ++VAGY+Q YD+NLTFLTIK
Sbjct  425  DEWRPWMSADEVAGYLQEYDHNLTFLTIK  453



>ref|XP_010070157.1| PREDICTED: serine carboxypeptidase 1-like [Eucalyptus grandis]
 gb|KCW58762.1| hypothetical protein EUGRSUZ_H01399 [Eucalyptus grandis]
Length=490

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRA P       G   + P   +  ++ C DD  A AWL+   VRKAIHA   ++ 
Sbjct  316  TRMFGRASPFWTTKDAGA--SSPGSQEEFHIECVDDEAAVAWLNDEAVRKAIHAAPASVA  373

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G + +C  +++++ D+GSMI YHKNLTS+GYR LI+SGDHDM VP+TG++AWTRS+GYKI
Sbjct  374  GSWWICASRVSYSVDTGSMIPYHKNLTSQGYRVLIYSGDHDMRVPFTGTQAWTRSLGYKI  433

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            IDEWRPW+ ++QVAGY+QGYD N TFLTIKGAGH VP+ KP+EAL F++RWL+GK I
Sbjct  434  IDEWRPWMTDDQVAGYLQGYDNNFTFLTIKGAGHMVPQTKPREALEFFSRWLDGKPI  490



>gb|EPS74136.1| hypothetical protein M569_00619, partial [Genlisea aurea]
Length=478

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQL--LQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            R+FGRAWPLRAPVRDG VPTWP+L    S  VPC++D VATAWL+  EVRKAIHAE  ++
Sbjct  338  RIFGRAWPLRAPVRDGYVPTWPELGNSDSNKVPCSNDEVATAWLNDEEVRKAIHAENASV  397

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
            +G +ELCTD+I F HD+GSMIKYHKNLTSRGYR LI+SGDHDMCVP+TGS+AWTRS+GYK
Sbjct  398  SGQWELCTDRIRFHHDAGSMIKYHKNLTSRGYRVLIYSGDHDMCVPFTGSQAWTRSLGYK  457

Query  387  IIDEWRPWIVNEQVAGYIQGY  325
             +DEWRPW +++QVAG +  +
Sbjct  458  TVDEWRPWSLDDQVAGSVPAF  478



>ref|XP_010068275.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=689

 Score =   222 bits (566),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 136/178 (76%), Gaps = 2/178 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM     PL    +D ++ + PQ   + ++PC +D  ATAWL++  V++AIHA   ++ G
Sbjct  512  RMLSYDSPLWLLGKDNMITSSPQSANAFHIPCFNDDFATAWLNNEAVQEAIHAAPASVAG  571

Query  561  PFELCTDKI--TFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
            P+E+C  ++   +T D+GSMI YHK+L S GYR LI+SGDHD  VPYTG++AWTRS+GYK
Sbjct  572  PWEICRTRVRRNYTIDTGSMIPYHKSLISEGYRVLIYSGDHDSVVPYTGTQAWTRSLGYK  631

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            I+DEWR WI +EQVAGY+QGYD+NLTFLT+KGAGH VP+YKP+E+L FYTRWL+GK I
Sbjct  632  IVDEWRSWISSEQVAGYLQGYDHNLTFLTVKGAGHAVPQYKPRESLDFYTRWLDGKPI  689



>gb|KCW58759.1| hypothetical protein EUGRSUZ_H01396 [Eucalyptus grandis]
Length=280

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 128/177 (72%), Gaps = 2/177 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            T MF RA P  +  RD    + P      +V C DD  A AWL++  VRKAIHA   ++ 
Sbjct  106  TSMFDRASPFWS-TRD-TEASRPGSQDGYHVKCVDDEAAVAWLNNEAVRKAIHAAPVSVA  163

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G + +C  +++++ D GSMI YHKNLTS GYR LI+SGDHDM VP+TG+EAWTRS+GYK 
Sbjct  164  GSWWICAGRVSYSGDIGSMIPYHKNLTSLGYRVLIYSGDHDMRVPFTGTEAWTRSLGYKT  223

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            IDEWRPW+ ++QVAGY+QGYD N TFL IKGAGH V + KP+EAL FY+RWL+GK I
Sbjct  224  IDEWRPWMTDDQVAGYLQGYDNNFTFLKIKGAGHMVAQTKPREALEFYSRWLDGKPI  280



>ref|XP_008382766.1| PREDICTED: serine carboxypeptidase-like 20 [Malus domestica]
Length=203

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 115/157 (73%), Gaps = 12/157 (8%)
 Frame = -2

Query  684  TWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTGPF--ELCTDKITFTHDSGS  511
            T PQ           DT+  +  SSPE          ALTG F  ELCT +I F HDSG 
Sbjct  55   TLPQPFNCAEQHMHQDTIKCSLSSSPE----------ALTGDFXWELCTSRIEFYHDSGX  104

Query  510  MIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQ  331
            MIKYHKNLT++GYRALI+SGDHDMCVP+TGSEAWTRS+GYKI+DEWRPW  N QVAGY Q
Sbjct  105  MIKYHKNLTAKGYRALIYSGDHDMCVPFTGSEAWTRSLGYKIVDEWRPWTSNGQVAGYTQ  164

Query  330  GYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            GY+ NLTFLT+KG+GHTVPEYKP+EA   ++R+L GK
Sbjct  165  GYENNLTFLTVKGSGHTVPEYKPREAFDXFSRFLAGK  201



>tpg|DAA55432.1| TPA: hypothetical protein ZEAMMB73_969275 [Zea mays]
Length=480

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQ-----SGNVPCTDDTVATAWLSSPEVRKAIHAE  580
            TRM GRAWPLRAPVRDG VP+W +L       S  VPC  D VATAWL++  VR AIHAE
Sbjct  336  TRMHGRAWPLRAPVRDGRVPSWQELAADVASTSSGVPCMSDEVATAWLNNNSVRSAIHAE  395

Query  579  QEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRS  400
              +  GP+ELCTDK+ F HD+GSMI YHKNLTS+GYRA I+SGDHDMCVPYTG+EAWT S
Sbjct  396  PVSSIGPWELCTDKLDFDHDAGSMIIYHKNLTSQGYRAFIYSGDHDMCVPYTGTEAWTAS  455

Query  399  VGYKIIDEWRPWIVNEQVAGYIQGY  325
            +GY ++D WR WIV+EQVAGY+ G+
Sbjct  456  LGYAVVDPWRQWIVDEQVAGYVSGF  480



>gb|KFK39840.1| hypothetical protein AALP_AA3G294800, partial [Arabis alpina]
Length=465

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RMFGRAWPL   VR  IVP+W QLL   N  C DD +AT WL+ P VRKA+HA++E+  G
Sbjct  305  RMFGRAWPLDVAVRPCIVPSWSQLLADSNGFCIDDRIATTWLNDPAVRKAVHAKEESEIG  364

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             + + T +I + H+ GSMI++H+NLT  GYRALI+SGDHDMCVPYTGSEAWT+S+GY ++
Sbjct  365  RWVMYTKQIIYDHNIGSMIEFHRNLTLSGYRALIYSGDHDMCVPYTGSEAWTKSMGYNVV  424

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIK  295
            DEWRPWI N  V G+ QGY  NLTFLTIK
Sbjct  425  DEWRPWISNGMVGGFTQGYANNLTFLTIK  453



>gb|EMT03686.1| Serine carboxypeptidase 1 [Aegilops tauschii]
Length=447

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  666  QSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNL  487
            Q+  +P +   + T     PEV   +     ++ GP+ LCTDKI F HD+GSMI YHKNL
Sbjct  298  QNSKLPTSFKDLGTTNKPFPEVASGVPCMVSSI-GPWLLCTDKIDFNHDAGSMISYHKNL  356

Query  486  TSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTF  307
            TS+GYRA+IFSGDHDMCVPYTGSEAWT+S+GY ++D WRPW  N+QV+GY +GY++ LTF
Sbjct  357  TSQGYRAIIFSGDHDMCVPYTGSEAWTKSMGYGVVDSWRPWFTNDQVSGYTEGYEHGLTF  416

Query  306  LTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
             TIKGAGHTVPEYKP+EALAFY+RWL G  +
Sbjct  417  ATIKGAGHTVPEYKPQEALAFYSRWLNGSKL  447



>gb|EMT11230.1| Serine carboxypeptidase 1 [Aegilops tauschii]
Length=238

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 121/176 (69%), Gaps = 23/176 (13%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            RM G +WPL  PV  G V  WP+L    ++PCT                      ++L G
Sbjct  86   RMAGLSWPLGLPVSSGHVTLWPEL-GGKSLPCT----------------------KSLIG  122

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +EL T +I + HD+GSM++YHK  T+ GYR LI+SGDHD+C+P+TG+EAW RS+GY+++
Sbjct  123  SWELNTARIDYIHDTGSMVEYHKKFTAMGYRVLIYSGDHDLCIPFTGTEAWVRSLGYRVV  182

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            D WRPW    QVAGY QGYD+NLTFLTIKG+GHTVPEYKPKE+LAFYT WL G+ I
Sbjct  183  DSWRPWHFGGQVAGYTQGYDHNLTFLTIKGSGHTVPEYKPKESLAFYTHWLFGEKI  238



>gb|KEH23401.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=463

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 112/136 (82%), Gaps = 4/136 (3%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLL--QSGNVPCTDDTVATAWLSSPEVRKAIHAEQEAL  568
            RMFGRAWP RAPVRDG+V  WPQL+  Q  +VPC +D VAT WL++  VRKAIH ++   
Sbjct  323  RMFGRAWPFRAPVRDGLVTLWPQLMAAQRRHVPCVNDEVATTWLNNDAVRKAIHVDKA--  380

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
            +G ++LCTD+I+F HD+G MI YHKNLT  GYRALIFSGDHDMCVP+TGSEAWTRS+GYK
Sbjct  381  SGAWQLCTDRISFRHDAGGMIPYHKNLTRLGYRALIFSGDHDMCVPFTGSEAWTRSLGYK  440

Query  387  IIDEWRPWIVNEQVAG  340
            ++DEWR WI N+QVAG
Sbjct  441  VVDEWRSWISNDQVAG  456



>gb|KCW58761.1| hypothetical protein EUGRSUZ_H01398 [Eucalyptus grandis]
Length=449

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 124/177 (70%), Gaps = 7/177 (4%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRA P     RD    +       G+    DD  A  WL+   VRKAIHA   ++ 
Sbjct  280  ARMFGRASPFWT-TRDAGASS------PGSHGEPDDEAAVGWLNDEAVRKAIHAAPASVA  332

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ +C  ++ ++  + SMI YHKNLTS GYR LI+SGDHDM VP+ G++AWTRS+GYKI
Sbjct  333  GPWWICAPRVNYSRGNESMIPYHKNLTSWGYRVLIYSGDHDMAVPFPGTQAWTRSMGYKI  392

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            IDEWRPW++++QVAGY+QGYD N TFLTIKGAGH V + KP+EAL FY+ WL+GK I
Sbjct  393  IDEWRPWMIDDQVAGYLQGYDNNFTFLTIKGAGHMVAQTKPREALEFYSHWLDGKPI  449



>ref|XP_010026201.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=495

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 124/177 (70%), Gaps = 7/177 (4%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
             RMFGRA P     RD    +       G+    DD  A  WL+   VRKAIHA   ++ 
Sbjct  326  ARMFGRASPFWT-TRDAGASS------PGSHGEPDDEAAVGWLNDEAVRKAIHAAPASVA  378

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            GP+ +C  ++ ++  + SMI YHKNLTS GYR LI+SGDHDM VP+ G++AWTRS+GYKI
Sbjct  379  GPWWICAPRVNYSRGNESMIPYHKNLTSWGYRVLIYSGDHDMAVPFPGTQAWTRSMGYKI  438

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            IDEWRPW++++QVAGY+QGYD N TFLTIKGAGH V + KP+EAL FY+ WL+GK I
Sbjct  439  IDEWRPWMIDDQVAGYLQGYDNNFTFLTIKGAGHMVAQTKPREALEFYSHWLDGKPI  495



>emb|CCW28854.1| putative serine carboxypeptidase [Arachis duranensis]
Length=447

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSG-NVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            RMFGRAWP  A V++GIVP+WPQL+  G NVPCTDD VA  WL++  VRKAIH   ++L 
Sbjct  272  RMFGRAWPHGAIVKNGIVPSWPQLIHGGANVPCTDDEVAFLWLNNDAVRKAIHTADKSLV  331

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
              + LCTD++++ H  GSMIKYH+ LT  GYRALIFSGDHD+CVPYTGS+AWT S+GY+I
Sbjct  332  NKWVLCTDQLSYHHTLGSMIKYHQYLTFSGYRALIFSGDHDLCVPYTGSQAWTSSLGYQI  391

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTF  307
            IDEWRPW ++ QVAG +     N++ 
Sbjct  392  IDEWRPWFIDGQVAGELATLFQNISL  417



>ref|XP_010026283.1| PREDICTED: serine carboxypeptidase-like 20 [Eucalyptus grandis]
Length=609

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -2

Query  582  EQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTR  403
            E+ ++ G + +C  +++++ D+GSMI YHKNLTS+GYR LI+SGDHDM VP+TG++AWTR
Sbjct  487  ERASVAGSWWICASRVSYSGDTGSMIPYHKNLTSQGYRVLIYSGDHDMTVPFTGTQAWTR  546

Query  402  SVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEG  223
            S+GYKIIDEWRPW+ ++QVAGY+QGYD N TFLTIKGAGH VP+ KP+EAL F++RWL+G
Sbjct  547  SLGYKIIDEWRPWMTDDQVAGYLQGYDNNFTFLTIKGAGHMVPQTKPREALEFFSRWLDG  606

Query  222  KSI  214
            K I
Sbjct  607  KPI  609



>ref|XP_008350580.1| PREDICTED: serine carboxypeptidase-like 20 [Malus domestica]
Length=99

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  510  MIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQ  331
            MIKYHKNLT++GYRALI+SGDHDMCVP+TGSEAWTRS+GYKI+DEWRPW  N QVAGY Q
Sbjct  1    MIKYHKNLTAKGYRALIYSGDHDMCVPFTGSEAWTRSLGYKIVDEWRPWTSNGQVAGYTQ  60

Query  330  GYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGK  220
            GY+ NLTFLT+KG+GHTVPEYKP+EA   ++R+L GK
Sbjct  61   GYENNLTFLTVKGSGHTVPEYKPREAFDLFSRFLAGK  97



>gb|KCW58998.1| hypothetical protein EUGRSUZ_H01623 [Eucalyptus grandis]
Length=99

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  510  MIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQ  331
            MI YHKNLTS+GYR LI+SGDHDM VP+TG++AWTRS+GYKIIDEWRPW+ ++QVAGY+Q
Sbjct  1    MIPYHKNLTSQGYRVLIYSGDHDMTVPFTGTQAWTRSLGYKIIDEWRPWMTDDQVAGYLQ  60

Query  330  GYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            GYD N TFLTIKGAGH VP+ KP+EAL F++RWL+GK I
Sbjct  61   GYDNNFTFLTIKGAGHMVPQTKPREALEFFSRWLDGKPI  99



>ref|XP_010042090.1| PREDICTED: serine carboxypeptidase 1-like [Eucalyptus grandis]
Length=469

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = -2

Query  738  MFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTGP  559
            MF    PL    +D +V + PQ   + ++PC +D  ATAWL++  VR+AIHA   ++ GP
Sbjct  316  MFSYDSPLWLLGKDNMVTSSPQSANAFHMPCFNDDFATAWLNNEAVREAIHAAPASVAGP  375

Query  558  FELCTDKI--TFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            +E+C  ++   +T D+GSMI YHK+L S GYRALI+SGDHD  VPYTG++AWT S+GYKI
Sbjct  376  WEICAIRVQRNYTIDTGSMIPYHKSLISEGYRALIYSGDHDSVVPYTGTQAWTGSLGYKI  435

Query  384  IDEWRPWIVNEQVAGYIQGYDYNLTFLTIK  295
            +DEWR WI +EQVAGY+QGYD+NLTFLT+K
Sbjct  436  VDEWRSWISSEQVAGYLQGYDHNLTFLTVK  465



>ref|XP_005646632.1| peptidase S10, serine carboxypeptidase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22088.1| peptidase S10, serine carboxypeptidase [Coccomyxa subellipsoidea 
C-169]
Length=467

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 113/174 (65%), Gaps = 5/174 (3%)
 Frame = -2

Query  723  WPLRAPVRDG-IVPTWPQLL--QSG-NVPCTDDTVATAWLSSPEVRKAIHAEQEALTGPF  556
            WPL   V +G +VP W  LL  Q G + PC D    + WL    VRKA+HA     TGPF
Sbjct  295  WPLGGVVLEGALVPNWAHLLGRQLGEHPPCLDHRELSVWLDDEAVRKALHAAPVDTTGPF  354

Query  555  ELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDE  376
            + CT +I++THD GSMI  H+ L  +G R LI++GDHDMCVP+TG+E WTR  G  ++D+
Sbjct  355  QECTSRISYTHDLGSMIPTHRQLLKQGMRVLIYNGDHDMCVPHTGAETWTRGFGLPVLDK  414

Query  375  WRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            WRPW  N QVAGY+  Y+  LT+ TI GAGH  PE KP E+LA + R+L  K +
Sbjct  415  WRPWHENTQVAGYVVEYE-GLTYATILGAGHFTPEMKPLESLAIFKRFLYNKKL  467



>gb|ABR16352.1| unknown [Picea sitchensis]
Length=505

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 3/178 (2%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQL-LQSGNVPCTDD-TVATAWLSSPEVRKAIHAEQEAL  568
            RM    W  ++   DG +    QL  Q    P  D   ++  W  +P VRKAIHA+ E +
Sbjct  329  RMSSHGWFTKSS-EDGYLTVQLQLGYQDRPCPTVDKYQLSYIWAKNPYVRKAIHAQSEEI  387

Query  567  TGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYK  388
            TG ++ CT +  + +D  S+I+YH+NLT +GYRALI+SGDHD+ VP+ G++AW RS+ Y 
Sbjct  388  TGEWKRCTPRFKYNYDVRSVIEYHRNLTRKGYRALIYSGDHDLIVPFIGTQAWIRSLNYT  447

Query  387  IIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            I+D+WRPW V+ QVAGY + YD NLTF T+KG GHT PEYKP++    + +W  G+ +
Sbjct  448  IVDDWRPWWVDRQVAGYTRLYDNNLTFATVKGGGHTAPEYKPRQTFVMFKQWTSGEPL  505



>emb|CDX83111.1| BnaA01g21110D [Brassica napus]
Length=317

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 110/176 (63%), Gaps = 20/176 (11%)
 Frame = -2

Query  741  RMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALTG  562
            +MF R WPL      GI+P+W + + + ++PC D+ VAT WL+ P VRKA+H ++++  G
Sbjct  134  KMFRREWPL------GILPSWFEFISTSDIPCLDNIVATTWLNYPAVRKAVHTKEKSKIG  187

Query  561  PFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
             +ELC +   +  D+GS I     ++     AL F              AWT S+GYK++
Sbjct  188  RWELCANASKYQTDAGS-ISNSIEISLSAAIALSFL-------------AWTNSMGYKVV  233

Query  381  DEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            DEWR W+ N+QVAGY  GY  NLTFL IKGAGH+VPE KP+EAL FY R+L G+ I
Sbjct  234  DEWRQWMSNDQVAGYTHGYANNLTFLKIKGAGHSVPEAKPREALDFYRRFLAGEKI  289



>gb|KCW58763.1| hypothetical protein EUGRSUZ_H01399 [Eucalyptus grandis]
Length=469

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = -2

Query  744  TRMFGRAWPLRAPVRDGIVPTWPQLLQSGNVPCTDDTVATAWLSSPEVRKAIHAEQEALT  565
            TRMFGRA P       G   + P   +  ++ C DD  A AWL+   VRKAIHA   ++ 
Sbjct  316  TRMFGRASPFWTTKDAGA--SSPGSQEEFHIECVDDEAAVAWLNDEAVRKAIHAAPASVA  373

Query  564  GPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKI  385
            G + +C  +++++ D+GSMI YHKNLTS+GYR LI+SGDHDM VP+TG++AWTRS+GYKI
Sbjct  374  GSWWICASRVSYSVDTGSMIPYHKNLTSQGYRVLIYSGDHDMRVPFTGTQAWTRSLGYKI  433

Query  384  IDEWRPWIVNEQVAG  340
            IDEWRPW+ ++QVAG
Sbjct  434  IDEWRPWMTDDQVAG  448



>gb|AAL73563.1|AC079632_7 Putative serine carboxypeptidase [Oryza sativa Japonica Group]
 gb|AAM08635.1|AC108883_8 Putative serine carboxypeptidase [Oryza sativa Japonica Group]
 gb|EAZ15041.1| hypothetical protein OsJ_30451 [Oryza sativa Japonica Group]
Length=432

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  636  TVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIF  457
            T++  W ++  VR+A+   Q  +   ++ C   I +T+D  S ++YH +LT+RGYR+LI+
Sbjct  293  TMSRIWANNDTVREALGIHQGTVPS-WQRCNYDILYTYDIKSSVRYHLDLTTRGYRSLIY  351

Query  456  SGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTV  277
            SGDHDM +P+ G++AW RS+ + ++DEWRPW V+ QVAGYI+ Y  NLTF T+KG GHT 
Sbjct  352  SGDHDMIIPFIGTQAWIRSLNFSVVDEWRPWFVDGQVAGYIRSYSNNLTFATVKGGGHTA  411

Query  276  PEYKPKEALAFYTRWLEGKSI  214
            PEY PK+ LA   RW+ G  +
Sbjct  412  PEYMPKQCLAMLARWVSGNPL  432



>ref|NP_001064014.1| Os10g0101100 [Oryza sativa Japonica Group]
 gb|ABB46564.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF25928.1| Os10g0101100 [Oryza sativa Japonica Group]
Length=460

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  636  TVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIF  457
            T++  W ++  VR+A+   Q  +   ++ C   I +T+D  S ++YH +LT+RGYR+LI+
Sbjct  321  TMSRIWANNDTVREALGIHQGTVPS-WQRCNYDILYTYDIKSSVRYHLDLTTRGYRSLIY  379

Query  456  SGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTV  277
            SGDHDM +P+ G++AW RS+ + ++DEWRPW V+ QVAGYI+ Y  NLTF T+KG GHT 
Sbjct  380  SGDHDMIIPFIGTQAWIRSLNFSVVDEWRPWFVDGQVAGYIRSYSNNLTFATVKGGGHTA  439

Query  276  PEYKPKEALAFYTRWLEGKSI  214
            PEY PK+ LA   RW+ G  +
Sbjct  440  PEYMPKQCLAMLARWVSGNPL  460



>ref|XP_003571685.1| PREDICTED: serine carboxypeptidase-like 17 [Brachypodium distachyon]
Length=467

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 95/141 (67%), Gaps = 3/141 (2%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFEL-CTDKITFTHDSGSMIKYHKNLTSRGYRALIF  457
            +++ W ++  VR A+   +   T P  L C     +T D  S ++YH++LTSRGYR+LI+
Sbjct  329  LSSIWANNGAVRAALGVHKG--TVPLWLRCNHGTPYTKDIRSSVEYHRSLTSRGYRSLIY  386

Query  456  SGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTV  277
            SGDHDM VP+ G++AW RS+G+ + DEWRPW VN QVAG+ + Y  NLTF T+KG GHT 
Sbjct  387  SGDHDMVVPFVGTQAWIRSLGFSVQDEWRPWYVNAQVAGFTRTYSNNLTFATVKGGGHTA  446

Query  276  PEYKPKEALAFYTRWLEGKSI  214
            PEYKPKE L    RWL G  +
Sbjct  447  PEYKPKECLDMVARWLSGHPL  467



>ref|XP_006662125.1| PREDICTED: serine carboxypeptidase-like 18-like [Oryza brachyantha]
Length=525

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 96/141 (68%), Gaps = 1/141 (1%)
 Frame = -2

Query  636  TVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIF  457
            T++  W ++  VR+A+   Q  +   ++ C   + +T D  S ++YH +LT+RGYR+LI+
Sbjct  386  TMSRIWANNDTVREALGIHQGTVPS-WQRCNYDVLYTSDIKSSVRYHLDLTTRGYRSLIY  444

Query  456  SGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTV  277
            SGDHDM +P+ G++AW +S+ + ++DEWRPW VN QVAGY + Y  NLTF T+KG GHT 
Sbjct  445  SGDHDMVIPFIGTQAWIKSLNFPVVDEWRPWFVNGQVAGYTRSYSNNLTFATVKGGGHTA  504

Query  276  PEYKPKEALAFYTRWLEGKSI  214
            PEY PK+ LA   RW+ G  +
Sbjct  505  PEYMPKQCLAMLGRWVSGDPL  525



>ref|XP_010321497.1| PREDICTED: serine carboxypeptidase-like 12 [Solanum lycopersicum]
Length=459

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 102/159 (64%), Gaps = 9/159 (6%)
 Frame = -2

Query  684  TWPQLLQSGNVPCTDD--TVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGS  511
            T+PQ      V C  +   +A  W +   VR A+H  ++ + G +E C   ++F     +
Sbjct  308  TYPQ------VKCRKEWHALALIWANDNNVRDALHVRKKTI-GAWEECRGNLSFGDIINN  360

Query  510  MIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQ  331
             I YH NL+ +G+R+LI+SGDHDM VP+  ++ W +S+ Y IID+WRPWIV+ QVAGY +
Sbjct  361  TILYHSNLSRKGFRSLIYSGDHDMVVPFISTQVWIKSLNYSIIDDWRPWIVDGQVAGYTR  420

Query  330  GYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
             Y   +TF+T+KGAGHT PEYKP ++LA   RWL  +S+
Sbjct  421  SYSNKMTFVTVKGAGHTTPEYKPVQSLAMLKRWLSYESL  459



>ref|XP_008790304.1| PREDICTED: uncharacterized protein LOC103707550 [Phoenix dactylifera]
Length=982

 Score =   152 bits (384),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W  +  VR+A++  +  +   ++ C   + +T+D  S IK+H NLTSRGYRAL++SGDHD
Sbjct  848  WADNDTVREALNIRKGTVQH-WQRCNHDLLYTYDIPSSIKFHLNLTSRGYRALVYSGDHD  906

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+ G++ W RS+ + I+D+WRPW V+ QVAG+ + Y  NLTF T+KGAGHT PEY+P
Sbjct  907  MGVPFVGTQGWIRSLNFSIVDDWRPWSVDGQVAGFTRTYSNNLTFATVKGAGHTAPEYRP  966

Query  261  KEALAFYTRWLEGKSI  214
            KE LA   RWL G  +
Sbjct  967  KECLAMLQRWLSGAPL  982


 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W  +  VR+A++  +  +   ++ C   + +TH+  S +K+H NLTSRGYRAL++SGDHD
Sbjct  342  WADNDTVREALNIRKGTVQH-WQRCNSDLLYTHNVPSSLKFHLNLTSRGYRALVYSGDHD  400

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+ G++ W RS+ + I+D+WRPW  + QVAG+ + Y  NLTF T+KGAGHT PEY+P
Sbjct  401  MLVPFLGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNNLTFATVKGAGHTAPEYRP  460

Query  261  KEALAFYTRWLEG  223
            KE LA   RWL G
Sbjct  461  KECLAMLQRWLSG  473



>ref|XP_009384628.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384629.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W ++  VR+A+   +E     +  C   I +T+D  S +KYH +LTSRGYRAL +SGDHD
Sbjct  338  WANNDTVREALGV-REGTKQMWVRCNYGINYTNDVSSSLKYHLSLTSRGYRALAYSGDHD  396

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+ G++AW RS+ + I+D+WR W V+ QVAG+ + Y  NLTF+TIKG GHT PEYKP
Sbjct  397  MSVPFVGTQAWIRSLNFSIVDDWRSWFVDGQVAGFTRTYSNNLTFVTIKGGGHTAPEYKP  456

Query  261  KEALAFYTRWLEGKSI  214
            KE LA   RW  G  +
Sbjct  457  KECLAMVDRWFAGSPL  472



>ref|XP_010936154.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=499

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W  +  VR+A++  +  +   ++ C   + + HD  S +K+H NLTSRGYRAL++SGDHD
Sbjct  365  WADNDTVREALNIHKGTVQ-QWQRCNYGLPYAHDIPSSLKFHLNLTSRGYRALVYSGDHD  423

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            + VP+ G++AW RS+ + I+D+WRPW  + QVAG+ + Y  NLTF T+KGAGHT PEY+P
Sbjct  424  LLVPFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNNLTFATVKGAGHTAPEYRP  483

Query  261  KEALAFYTRWLEGKSI  214
            KE L    RWL G  +
Sbjct  484  KECLVMLQRWLSGAPL  499



>ref|XP_010061646.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW68630.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=477

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            ++ +W +   VR+A+H  + ++ G ++ C +++ +T+D  S ++YH  L++RG R+LI+S
Sbjct  339  LSYSWTNDDNVREALHIRKGSI-GDWQRCNNELNYTNDISSTLQYHAKLSARGCRSLIYS  397

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHDM VP+ G++AW RS+ Y IID+WR W+V  QVAGY + Y   +TF T+KG GHT P
Sbjct  398  GDHDMIVPFMGTQAWIRSLNYSIIDDWRSWMVRGQVAGYTRTYSNGMTFATVKGGGHTAP  457

Query  273  EYKPKEALAFYTRWL  229
            EYKP+E  A + RW+
Sbjct  458  EYKPEECFAMFERWI  472



>ref|XP_008790306.1| PREDICTED: uncharacterized protein LOC103707552 [Phoenix dactylifera]
Length=972

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W  +  VR+A++  +  +   ++ C   + +T+D  S IK+H NLTSRGYRAL++SGDHD
Sbjct  838  WADNDTVREALNIHKGTVQH-WQRCNHDLLYTYDIPSSIKFHLNLTSRGYRALVYSGDHD  896

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+ G++ W RS+ + I+D+WRPW  + QVAG+ + Y  NLTF T+KGAGHT PEY+P
Sbjct  897  MAVPFVGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNNLTFATVKGAGHTAPEYRP  956

Query  261  KEALAFYTRWLEG  223
            KE LA   RWL G
Sbjct  957  KECLAMLQRWLSG  969


 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W  +  VR+A++  +  +   ++ C   + +T+D  S IK+H NLTSRGYRAL++SGDHD
Sbjct  342  WADNDTVREALNIHKGTVQH-WQRCNHDLLYTYDIPSSIKFHLNLTSRGYRALVYSGDHD  400

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            + +P+ G++ W RS+ + I+D+WRPW  + QVAG+ + Y  NLTF T+KGAGH  PEY+P
Sbjct  401  LLIPFLGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRAYSNNLTFATVKGAGHLAPEYRP  460

Query  261  KEALAFYTRWLEGKSI  214
            KE+LA   RWL G  +
Sbjct  461  KESLAMLQRWLSGAPL  476



>ref|XP_010237149.1| PREDICTED: serine carboxypeptidase-like 18 [Brachypodium distachyon]
Length=313

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 101/150 (67%), Gaps = 7/150 (5%)
 Frame = -2

Query  648  CTDD--TVATAWLSSPEVRKAIHAEQEALTGPFEL-CTDKITFTHDSGSMIKYHKNLTSR  478
            C D+   +++ W +  EVR+A+   + ++  P  L C   I +T D  S ++YH++L + 
Sbjct  166  CRDEGYVMSSIWANKEEVREALGVHKGSV--PLWLRCNHGIPYTTDILSSVEYHRSLLTS  223

Query  477  G--YRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFL  304
            G  YR+L++SGDHDM VP+ G++AW RS+G+ I+D+WRPW  + QVAG+ + Y  NLTF 
Sbjct  224  GGGYRSLVYSGDHDMVVPFVGTQAWIRSLGFAIVDQWRPWYADIQVAGFTRMYSNNLTFA  283

Query  303  TIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            T+KG GHT PEYKPKE LA   RWL G+ +
Sbjct  284  TVKGGGHTAPEYKPKECLAMVVRWLSGRPL  313



>gb|KHG16860.1| Serine carboxypeptidase-like 19 [Gossypium arboreum]
Length=339

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 91/136 (67%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W +   VR A+H  + ++ G +  C   + + +D  + + YH NL+++GYR LI+SGDHD
Sbjct  205  WANDDNVRNALHIRKGSI-GKWLRCNHGLPYNNDVPTSLPYHANLSAKGYRYLIYSGDHD  263

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+  ++AW R + Y+IID+WRPW+V  QVAGY + Y   +TF T+KG GHT PEYKP
Sbjct  264  MVVPHLATQAWIRFLNYQIIDDWRPWMVQSQVAGYTRTYSNRMTFATVKGGGHTAPEYKP  323

Query  261  KEALAFYTRWLEGKSI  214
             E  A +TRW+ G+ +
Sbjct  324  AECFAMFTRWISGQPL  339



>tpg|DAA39924.1| TPA: hypothetical protein ZEAMMB73_827985 [Zea mays]
Length=122

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -2

Query  549  CTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWR  370
            C   I +  D  S +KYH ++T++GY++L++SGDHDM VPY G+++W RS+ + I+D+WR
Sbjct  11   CNTDIPYLKDIKSSVKYHLDVTTKGYKSLVYSGDHDMGVPYIGTQSWIRSLNFSIVDDWR  70

Query  369  PWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWLEGKSI  214
            PW V+ QVAGY   Y  NLTF T+KGAGHT PEY P++ LA  +RWL G ++
Sbjct  71   PWYVDGQVAGYTVLYSNNLTFATVKGAGHTAPEYMPRQCLAMLSRWLAGDTL  122



>emb|CDY11114.1| BnaC06g23660D [Brassica napus]
Length=439

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 97/140 (69%), Gaps = 2/140 (1%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            ++T W +   VRKA+   +E++ G +  C   I + HD  S + YHKN +  GYR+LIFS
Sbjct  302  LSTYWANDKTVRKALQINEESI-GEWIRCNLDIPYNHDIVSSVPYHKNNSISGYRSLIFS  360

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHDM VPY G++AW RS+ Y II++WRPW++++Q+AGY + Y   +TF TIK +GHT P
Sbjct  361  GDHDMAVPYLGTQAWIRSLNYSIINDWRPWMIDDQIAGYTRTYANKMTFATIKASGHT-P  419

Query  273  EYKPKEALAFYTRWLEGKSI  214
            EYKP+E+   + RW+ G+ +
Sbjct  420  EYKPEESFIMFERWISGQPL  439



>ref|XP_010936148.1| PREDICTED: serine carboxypeptidase-like 18 isoform X4 [Elaeis 
guineensis]
Length=342

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W ++  VR+ ++  +  +   ++ C   + + HD  S +K+H NLTSRG+RAL++SGDHD
Sbjct  208  WANNDTVREVLNIHKGTVQ-QWQRCNYGLPYAHDIPSSLKFHLNLTSRGHRALVYSGDHD  266

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+ G++AW RS+ + I+D+WRPW    QVAG+ + Y  NLTF T+KGAGHT PEY+P
Sbjct  267  MIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNNLTFATVKGAGHTAPEYRP  326

Query  261  KEALAFYTRWLEGKSI  214
            KE L    RWL G  +
Sbjct  327  KECLVMLQRWLSGAPL  342



>ref|XP_006390568.1| hypothetical protein EUTSA_v10018572mg [Eutrema salsugineum]
 gb|ESQ27854.1| hypothetical protein EUTSA_v10018572mg [Eutrema salsugineum]
Length=438

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 98/140 (70%), Gaps = 2/140 (1%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            ++T W +   VRKA+   ++++ G +  C   I +THD  S + YHKN +  GYR+LIFS
Sbjct  301  LSTYWANDETVRKALQINEKSI-GEWVRCNWYIAYTHDILSSVPYHKNNSINGYRSLIFS  359

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHDM VP+ G++AW RS+ Y +ID WRPW++N+Q+AGY + Y   +TF T+KG+GHT+ 
Sbjct  360  GDHDMVVPFVGTQAWIRSLNYSLIDGWRPWMINDQIAGYTRTYANKMTFATVKGSGHTL-  418

Query  273  EYKPKEALAFYTRWLEGKSI  214
            EYKP+E+   + RW+ G+ +
Sbjct  419  EYKPEESFIMFQRWINGQPL  438



>ref|XP_002460078.1| hypothetical protein SORBIDRAFT_02g022430 [Sorghum bicolor]
 gb|EER96599.1| hypothetical protein SORBIDRAFT_02g022430 [Sorghum bicolor]
Length=457

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 96/139 (69%), Gaps = 3/139 (2%)
 Frame = -2

Query  636  TVATAWLSSPEVRKAIHAEQEALTGPFEL-CTDKITFTHDSGSMIKYHKNLTSRGYRALI  460
            T++  W ++  VR+A+   +   T P  L C   IT+  D  S +KYH ++T++GYR+L+
Sbjct  318  TLSRLWANNATVREALGIHKG--TVPLWLRCNKGITYVKDIQSSVKYHLDVTTKGYRSLV  375

Query  459  FSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHT  280
            +SGDHDM VPY G+++W RS+ + ++D+WRPW V+ QVAGY   Y  NLTF T+KGAGHT
Sbjct  376  YSGDHDMAVPYIGTQSWIRSLNFSVVDDWRPWYVDGQVAGYTTLYSNNLTFATVKGAGHT  435

Query  279  VPEYKPKEALAFYTRWLEG  223
             PEY P++ LA  +RWL G
Sbjct  436  APEYMPRQCLAMLSRWLAG  454



>ref|XP_007018463.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15688.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=386

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 11/159 (7%)
 Frame = -2

Query  675  QLLQSGNVPCTDDT----------VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFT  526
            Q +   NV C  D           +++ W +   V+KAIH  + ++ G ++ C   + +T
Sbjct  224  QNINPSNVECQKDLQYYTKTYSVLLSSYWANDGNVQKAIHIRKGSI-GQWKRCDFGLPYT  282

Query  525  HDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQV  346
             D  S   YH NL++RGYRAL++SGDHDM VP+ G+EAW +S+ Y I+D+WRPW+V +QV
Sbjct  283  ADLPSSFLYHVNLSTRGYRALVYSGDHDMLVPFLGTEAWIKSLNYPIVDDWRPWMVQDQV  342

Query  345  AGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRWL  229
            AGY + Y   +T+ +IK  GHT PEYKP E  A + RW+
Sbjct  343  AGYTRTYSNQMTYASIKRGGHTAPEYKPAECFAMFKRWI  381



>ref|XP_002878647.1| hypothetical protein ARALYDRAFT_900755 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54906.1| hypothetical protein ARALYDRAFT_900755 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 92/141 (65%), Gaps = 2/141 (1%)
 Frame = -2

Query  636  TVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIF  457
            T+AT W ++  VR+A+   + ++ G +  C   I +  D  S I YH N +  GYR+LI+
Sbjct  49   TLATYWANTERVREALQIRKRSI-GKWTRCNRNIDYNDDIISSIPYHMNNSINGYRSLIY  107

Query  456  SGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTV  277
            SGDHDM VP+  +EAW RS+ Y IID+WRPWI+N Q+AGY   Y   +T+ TIKG GHT 
Sbjct  108  SGDHDMEVPFLATEAWIRSLNYPIIDDWRPWIINNQIAGYTMTYANKMTYATIKGGGHTA  167

Query  276  PEYKPKEALAFYTRWLEGKSI  214
             EYKP+E+   + RW+ G+ +
Sbjct  168  -EYKPEESFIMFQRWISGQPL  187



>ref|XP_010108030.1| Serine carboxypeptidase-like 3 [Morus notabilis]
 gb|EXC17676.1| Serine carboxypeptidase-like 3 [Morus notabilis]
Length=248

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -2

Query  639  DTVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALI  460
            D ++  W + P VRKA+H  Q+   G ++ C     + ++  S ++YH NL+++GYR+LI
Sbjct  108  DLLSQYWANDPHVRKALHV-QKGTIGEWKRCNYGFPYQYNVRSSVEYHANLSAKGYRSLI  166

Query  459  FSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHT  280
            +SGDHDM VP+  ++AW RS+ Y I+D+WR W+V   +AGY + Y   +TF T++ AGHT
Sbjct  167  YSGDHDMQVPFLATQAWIRSLNYSIVDDWRSWVVQGHIAGYTRTYSNLMTFATVRVAGHT  226

Query  279  VPEYKPKEALAFYTRWLE  226
             P+YKPKE  A + RW+ 
Sbjct  227  APQYKPKECFAMFKRWIH  244



>ref|XP_010936146.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=394

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W ++  VR+ ++  +  +   ++ C   + + HD  S +K+H NLTSRG+RAL++SGDHD
Sbjct  260  WANNDTVREVLNIHKGTVQ-QWQRCNYGLPYAHDIPSSLKFHLNLTSRGHRALVYSGDHD  318

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+ G++AW RS+ + I+D+WRPW    QVAG+ + Y  NLTF T+KGAGHT PEY+P
Sbjct  319  MIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNNLTFATVKGAGHTAPEYRP  378

Query  261  KEALAFYTRWLEGKSI  214
            KE L    RWL G  +
Sbjct  379  KECLVMLQRWLSGAPL  394



>ref|XP_003573759.1| PREDICTED: serine carboxypeptidase-like 18 [Brachypodium distachyon]
Length=461

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 105/175 (60%), Gaps = 12/175 (7%)
 Frame = -2

Query  726  AWPLRAPVRDGIVP--TWPQLLQSGN------VPCTDD--TVATAWLSSPEVRKAIHAEQ  577
             + LR+P  D + P  T  +LL   N      V C D+   ++  W   PEVR+ +   +
Sbjct  282  GFALRSPA-DTVFPRRTAARLLVQENDMLGLPVECRDNGYRLSYTWADDPEVRETL-GIK  339

Query  576  EALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSV  397
            E   G +  CT    F HD  S + +H+ LT+RGYRAL+++GDHDM + + G++ W R++
Sbjct  340  EGTIGAWSRCTTLSHFRHDLASTVPHHRELTTRGYRALVYNGDHDMDMTFVGTQQWIRAL  399

Query  396  GYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEALAFYTRW  232
            GY ++  WRPW  N QVAG+   Y++NLTF T+KG GHT PEY+PKE LA   RW
Sbjct  400  GYGVVAPWRPWYANRQVAGFATEYEHNLTFATVKGGGHTAPEYRPKECLAMLDRW  454



>ref|XP_006472320.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472321.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            +A  W +   VRKA+H  Q +  G +  C   + +TH+ G+   YH +L+++GYR+LI+S
Sbjct  329  LARYWDNDHNVRKALHVRQGS-KGEWIRCNYDLPYTHEIGNSFSYHVSLSTKGYRSLIYS  387

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHDM +P+ G+EAW +S+ Y I+D+WRPWI++ QVAGY + Y   +T+ T+KG GHT P
Sbjct  388  GDHDMLIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAP  447

Query  273  EYKPKEALAFYTRWLE  226
            EY+P E  A + RW+ 
Sbjct  448  EYRPAECYAMFQRWIN  463



>ref|XP_010936145.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=394

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 91/136 (67%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W  +  VR+ ++  +  +   ++ C   + + HD  S +K+H NLTSRG+RAL++SGDHD
Sbjct  260  WADNDTVREVLNIHKGTVQ-QWQRCNYGLPYAHDIPSSLKFHLNLTSRGHRALVYSGDHD  318

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+ G++AW RS+ + I+D+WRPW    QVAG+ + Y  NLTF T+KGAGHT PEY+P
Sbjct  319  MIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNNLTFATVKGAGHTAPEYRP  378

Query  261  KEALAFYTRWLEGKSI  214
            KE L    RWL G  +
Sbjct  379  KECLVMLQRWLSGAPL  394



>ref|XP_010936147.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Elaeis 
guineensis]
Length=370

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = -2

Query  609  PEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVP  430
            P ++  +  E       ++ C   + + HD  S +K+H NLTSRG+RAL++SGDHDM VP
Sbjct  239  PLLKADLPLECRGTVQQWQRCNYGLPYAHDIPSSLKFHLNLTSRGHRALVYSGDHDMIVP  298

Query  429  YTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPKEAL  250
            + G++AW RS+ + I+D+WRPW    QVAG+ + Y  NLTF T+KGAGHT PEY+PKE L
Sbjct  299  FVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNNLTFATVKGAGHTAPEYRPKECL  358

Query  249  AFYTRWLEGKSI  214
                RWL G  +
Sbjct  359  VMLQRWLSGAPL  370



>ref|XP_006433655.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
 gb|ESR46895.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
Length=467

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            +A  W +   VRKA+H  Q +  G +  C   + +TH+ G+   YH +L+++GYR+LI+S
Sbjct  329  LARYWDNDHNVRKALHIRQGS-KGEWIRCNYDLPYTHEIGNSFSYHVSLSTKGYRSLIYS  387

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHDM +P+ G+EAW +S+ Y I+D+WRPWI++ QVAGY + Y   +T+ T+KG GHT P
Sbjct  388  GDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAP  447

Query  273  EYKPKEALAFYTRWLE  226
            EY+P E  A + RW+ 
Sbjct  448  EYRPAECYAMFQRWIN  463



>gb|KDO81468.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=467

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            +A  W +   VRKA+H  Q +  G +  C   + +TH+ G+   YH +L+++GYR+LI+S
Sbjct  329  LARYWDNDHNVRKALHIRQGS-KGEWIRCNYDLPYTHEIGNSFSYHVSLSTKGYRSLIYS  387

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHDM +P+ G+EAW +S+ Y I+D+WRPWI++ QVAGY + Y   +T+ T+KG GHT P
Sbjct  388  GDHDMLIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAP  447

Query  273  EYKPKEALAFYTRWLE  226
            EY+P E  A + RW+ 
Sbjct  448  EYRPAECYAMFQRWIN  463



>ref|XP_009382032.1| PREDICTED: serine carboxypeptidase-like 7 [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 93/140 (66%), Gaps = 0/140 (0%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            ++ AW ++  VR+A+   + ++            +T+D  S IKYH +LTSRGYRAL++S
Sbjct  340  LSHAWANNDTVRQALGIREGSVQIWLRCDIGLNNYTYDVLSSIKYHLSLTSRGYRALVYS  399

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHD+ VP+ G++AW RS+ + I+D+WRPW V  QVAG+ + Y  NLTF T+KG GHT P
Sbjct  400  GDHDLTVPFLGTQAWIRSLNFSIVDDWRPWSVEGQVAGFTRSYSNNLTFATVKGGGHTAP  459

Query  273  EYKPKEALAFYTRWLEGKSI  214
            EY+PKE  A   RWL G  +
Sbjct  460  EYQPKECFAMVQRWLSGAPL  479



>gb|ACF86146.1| unknown [Zea mays]
Length=289

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 91/143 (64%), Gaps = 3/143 (2%)
 Frame = -2

Query  654  VPCTDD--TVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTS  481
            V C D+   ++  W   PEVR+A+    E   G +  CT    + HD  ++I YH NLT 
Sbjct  141  VECRDNGYRLSYIWADDPEVREAL-GILEGSIGSWSRCTMLSHYRHDVTTVIPYHVNLTK  199

Query  480  RGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLT  301
             GYRAL+++GDHD+ + + G++ W RS+GY I+ +WRPW  N QVAG+ + Y +NLTF T
Sbjct  200  AGYRALVYNGDHDLDMTFVGTQEWIRSIGYPIVSDWRPWFANRQVAGFTRTYAHNLTFAT  259

Query  300  IKGAGHTVPEYKPKEALAFYTRW  232
            +KG GHT PEY+PKE  A   RW
Sbjct  260  VKGGGHTAPEYRPKECQAMLDRW  282



>ref|XP_002464850.1| hypothetical protein SORBIDRAFT_01g027540 [Sorghum bicolor]
 gb|EER91848.1| hypothetical protein SORBIDRAFT_01g027540 [Sorghum bicolor]
Length=495

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 91/143 (64%), Gaps = 3/143 (2%)
 Frame = -2

Query  654  VPCTDD--TVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTS  481
            V C D+   ++  W   PEVR+A+    E   G +  CT    F HD  ++I YH NLT 
Sbjct  347  VECRDNGYRLSYIWADDPEVREAL-GIHEGSIGSWSRCTMLTHFRHDLATVIPYHVNLTK  405

Query  480  RGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLT  301
             GYRAL+++GDHDM + Y G++ W R++GY I+ +WRPW  N QVAG+ + Y +NLTF T
Sbjct  406  AGYRALVYNGDHDMDMTYVGTQEWIRTMGYPIVSDWRPWYANRQVAGFTRTYAHNLTFAT  465

Query  300  IKGAGHTVPEYKPKEALAFYTRW  232
            +KG GHT PEY+PKE  A   RW
Sbjct  466  VKGGGHTAPEYRPKECQAMLDRW  488



>gb|EMS46782.1| Serine carboxypeptidase-like 18 [Triticum urartu]
Length=364

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            ++  W ++  VR+A+   +  +      C   I +T+D  S +++H ++T+RGYR+LI+S
Sbjct  226  LSMIWANNDTVREALGIHKGTVPSWLR-CNFDIRYTNDIFSSVEHHLDVTTRGYRSLIYS  284

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHDM VP  G++AW +S+ + ++DEWRPW V+ QVAGY + Y  NLTF T+KG GHT P
Sbjct  285  GDHDMIVPSIGTQAWIKSLNFSVVDEWRPWYVDAQVAGYTRSYSNNLTFATVKGGGHTAP  344

Query  273  EYKPKEALAFYTRWLEGKSI  214
            EY PK+ LA + RWL G+ +
Sbjct  345  EYMPKQCLAMFARWLSGEPL  364



>ref|XP_008644920.1| PREDICTED: serine carboxypeptidase-like 2 [Zea mays]
Length=496

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -2

Query  678  PQLLQSGNVPCTDD--TVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMI  505
            P       V C ++   ++  W   PEVR A+   + ++ G +  CT    + HD  + I
Sbjct  338  PGFFTKQPVECRNNGYRLSNIWADDPEVRDALGIHKASI-GSWSRCTMLPYYRHDVSTAI  396

Query  504  KYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGY  325
             YH NLT  GYRAL++SGDHD+ + + G++ W R +GY I+ +WRPW VN QVAG+ + Y
Sbjct  397  PYHVNLTKAGYRALVYSGDHDLGMTFVGTQEWIRRIGYPIVSDWRPWFVNRQVAGFTRTY  456

Query  324  DYNLTFLTIKGAGHTVPEYKPKEALAFYTRW  232
             +NLTF T+KG GHT PEY+PKE LA   RW
Sbjct  457  AHNLTFATVKGGGHTAPEYRPKECLAMLDRW  487



>gb|AFW69059.1| hypothetical protein ZEAMMB73_397726, partial [Zea mays]
Length=495

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -2

Query  678  PQLLQSGNVPCTDD--TVATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMI  505
            P       V C ++   ++  W   PEVR A+   + ++ G +  CT    + HD  + I
Sbjct  338  PGFFTKQPVECRNNGYRLSNIWADDPEVRDALGIHKASI-GSWSRCTMLPYYRHDVSTAI  396

Query  504  KYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGY  325
             YH NLT  GYRAL++SGDHD+ + + G++ W R +GY I+ +WRPW VN QVAG+ + Y
Sbjct  397  PYHVNLTKAGYRALVYSGDHDLGMTFVGTQEWIRRIGYPIVSDWRPWFVNRQVAGFTRTY  456

Query  324  DYNLTFLTIKGAGHTVPEYKPKEALAFYTRW  232
             +NLTF T+KG GHT PEY+PKE LA   RW
Sbjct  457  AHNLTFATVKGGGHTAPEYRPKECLAMLDRW  487



>ref|XP_010320198.1| PREDICTED: serine carboxypeptidase-like 17 [Solanum lycopersicum]
Length=476

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 99/152 (65%), Gaps = 4/152 (3%)
 Frame = -2

Query  675  QLLQSGNVPCTDD--TVATAWLSSPEVRKAIHAEQEALTGPFELCT-DKITFTHDSGSMI  505
            ++L  G + C  D   ++  W    +VR+A+H  + ++ G ++ C  D + +    G+ I
Sbjct  321  EMLYLGRLRCRFDWEKMSYHWADDDKVREALHVRRGSI-GKWKRCAGDALPYQKIIGNSI  379

Query  504  KYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGY  325
             YH NL+ +GYR+LI+SGDHD  +PYT +EAW RS+ Y I+D+WRPWIV+ QVAGY + Y
Sbjct  380  PYHANLSVKGYRSLIYSGDHDTMIPYTSTEAWIRSLNYSIVDDWRPWIVDGQVAGYTRTY  439

Query  324  DYNLTFLTIKGAGHTVPEYKPKEALAFYTRWL  229
               +TF T+KG GHT PEYKP E LA   RWL
Sbjct  440  SNKMTFATVKGGGHTAPEYKPVECLAMLRRWL  471



>ref|XP_009395245.1| PREDICTED: serine carboxypeptidase-like 12 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            +A  W ++  VR+A+H ++    G ++ CT  + +T D  S IKYH ++TS GYRAL++S
Sbjct  328  LAYYWANTDIVREALHIKK-GTVGEWQRCTYDLPYTRDIKSSIKYHLSVTSSGYRALVYS  386

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHDM +P+ G+  WTRS+ + +ID WR W V+ QVAGY   Y  NLTF+T+KGAGHT  
Sbjct  387  GDHDMLIPFVGTNQWTRSLNFSVIDNWRSWHVDGQVAGYATTYSNNLTFVTVKGAGHTAV  446

Query  273  EYKPKEALAFYTRWLEGKSI  214
            EYK KE LA   RWL  K +
Sbjct  447  EYKNKECLAMIRRWLSHKPL  466



>ref|XP_005851231.1| hypothetical protein CHLNCDRAFT_33865 [Chlorella variabilis]
 gb|EFN59129.1| hypothetical protein CHLNCDRAFT_33865 [Chlorella variabilis]
Length=351

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 106/176 (60%), Gaps = 9/176 (5%)
 Frame = -2

Query  729  RAWPLRAPVRDGIVPTWPQLL-QSGNVP-CTDDTVATAWLSSPEVRKAIHAEQEALTGPF  556
            R WPL   + DG V    QLL Q G+ P C D     A+ + P VR+AIHAE     G F
Sbjct  171  RRWPLLGGLHDGPVTGLVQLLGQLGHTPPCLDSREMWAFCNDPAVRRAIHAEPIEKIGSF  230

Query  555  ELCT--DKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDMCVPYTGSEAWTRSVGYKII  382
            + CT  D+I +THD GSM+  H++L  RG  ALI+SGDHDM VP+TG+EAWT  +G ++ 
Sbjct  231  DECTNGDRIHYTHDRGSMLPVHRDLIGRGLTALIYSGDHDMAVPHTGTEAWTSWLGRQLG  290

Query  381  DE--WRPWIVNEQVAGYIQGYDYN---LTFLTIKGAGHTVPEYKPKEALAFYTRWL  229
             E  W PW   +  A  + GY  +   L + T++GAGH VPE  P EAL  ++R+L
Sbjct  291  VERPWAPWHTADHQASCVAGYTVHYRGLVYATVRGAGHMVPETNPAEALELFSRFL  346



>ref|XP_010936155.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=476

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W  +  VR+A++  +  +   ++ C   + + HD  S +K+H NLTS GYRAL++SGDHD
Sbjct  342  WADNDTVREALNIHKGTVQ-QWQRCNYGLPYAHDVPSSLKFHLNLTSIGYRALVYSGDHD  400

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+ G++AW RS+ + I+D+WRPW  + QVAG+ + Y  NLTF T+KGAGHT PEY+P
Sbjct  401  MIVPFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNNLTFATVKGAGHTAPEYRP  460

Query  261  KEALAFYTRWL  229
            KE L    RWL
Sbjct  461  KECLVMLQRWL  471



>ref|XP_009105991.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Brassica 
rapa]
Length=441

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = -2

Query  633  VATAWLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFS  454
            + T W +   VRKA+   +E++ G +  C   I +T+D  S + YHKN +  GY +LIFS
Sbjct  304  LVTYWANDKTVRKALQINEESI-GEWVRCRYGIPYTYDIISSVPYHKNNSINGYPSLIFS  362

Query  453  GDHDMCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVP  274
            GDHDM VPY G++AW R++ Y IID+WRPW++N+Q+AGY + Y   +TF T+KG GHT P
Sbjct  363  GDHDMAVPYLGTQAWIRALNYSIIDDWRPWMINDQIAGYTRTYANKMTFATVKGGGHT-P  421

Query  273  EYKPKEALAFYTRWLEGKSI  214
            EYKP E+   + RW+ G+ +
Sbjct  422  EYKPDESSIMFQRWINGQPL  441



>ref|XP_008799202.1| PREDICTED: serine carboxypeptidase 1 [Phoenix dactylifera]
Length=454

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = -2

Query  618  LSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHDM  439
              + + R+A+HA   A++GP++ CT +I +  +  S+  YH NLT +GYRA  +SGDHDM
Sbjct  319  FDAEDSRQALHAMPVAVSGPWKRCTKRIRYERNILSLTPYHLNLTMKGYRAFFYSGDHDM  378

Query  438  CVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKPK  259
             +PYT +  W R+  Y +I++W PW V  Q+AGY   +D+NL F T KGAGHTV EY P+
Sbjct  379  VMPYTATLQWIRTFNYSVIEKWHPWFVENQIAGYAIRFDHNLLFATFKGAGHTVTEYMPR  438

Query  258  EALAFYTRWLEG  223
            EAL  Y +W++G
Sbjct  439  EALIAYQKWIDG  450



>gb|KJB58677.1| hypothetical protein B456_009G221000 [Gossypium raimondii]
Length=455

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W +   VR A+H  + ++ G +  C   + + +D  + + YH NL+++GYR LI+SGDHD
Sbjct  321  WANDDNVRNALHIRKGSI-GKWLRCNHGLPYNNDVPTSLPYHANLSAKGYRYLIYSGDHD  379

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            M VP+  ++AW R + Y IID+WRPW+V  QVAGY + Y   +TF T+KG GHT PEYKP
Sbjct  380  MVVPHLATQAWIRFLNYPIIDDWRPWMVQSQVAGYTRTYSNRMTFATVKGGGHTAPEYKP  439

Query  261  KEALAFYTRWLEGKSI  214
             E LA  TRW+ G+ +
Sbjct  440  AECLAMLTRWISGQPL  455



>ref|XP_008778119.1| PREDICTED: serine carboxypeptidase-like 18, partial [Phoenix 
dactylifera]
Length=271

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 91/136 (67%), Gaps = 1/136 (1%)
 Frame = -2

Query  621  WLSSPEVRKAIHAEQEALTGPFELCTDKITFTHDSGSMIKYHKNLTSRGYRALIFSGDHD  442
            W +S   RKA+H ++  +   ++ C   + +T D  + I YH ++TS+GYRAL++SGDHD
Sbjct  137  WANSNVTRKALHIKKGTVR-EWQRCNLDLPYTKDIPNNINYHLSITSKGYRALVYSGDHD  195

Query  441  MCVPYTGSEAWTRSVGYKIIDEWRPWIVNEQVAGYIQGYDYNLTFLTIKGAGHTVPEYKP  262
            + VP+ G++AWTRS+ + ++DEWR W V   +AGY   Y  NLTF T++GAGHT PEYKP
Sbjct  196  LVVPFLGTQAWTRSLNFSVVDEWRSWHVGGHIAGYTTTYSNNLTFATVRGAGHTAPEYKP  255

Query  261  KEALAFYTRWLEGKSI  214
            +E  A   RW+  + +
Sbjct  256  EECFAMVQRWISSRPL  271



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420