BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020N03

Length=755
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004231468.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    267   8e-85   Solanum lycopersicum
ref|XP_009775151.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    266   4e-84   Nicotiana sylvestris
ref|XP_006365590.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    265   7e-84   Solanum tuberosum [potatoes]
ref|XP_009622651.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    254   1e-79   Nicotiana tomentosiformis
ref|XP_008243095.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    249   1e-77   Prunus mume [ume]
ref|XP_007202272.1|  hypothetical protein PRUPE_ppa008876mg             247   5e-77   Prunus persica
ref|XP_009366271.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    242   6e-75   Pyrus x bretschneideri [bai li]
ref|XP_008383690.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    240   4e-74   
ref|XP_004287200.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    239   6e-74   Fragaria vesca subsp. vesca
ref|XP_008394237.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    239   6e-74   
ref|XP_009366273.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    239   9e-74   Pyrus x bretschneideri [bai li]
ref|XP_010655908.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    238   2e-73   Vitis vinifera
gb|KDP37529.1|  hypothetical protein JCGZ_05968                         238   2e-73   Jatropha curcas
ref|XP_010261280.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    236   4e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010655907.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    236   1e-72   Vitis vinifera
ref|XP_008383698.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    236   1e-72   
emb|CDP14406.1|  unnamed protein product                                230   2e-70   Coffea canephora [robusta coffee]
ref|XP_011070448.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    228   2e-69   Sesamum indicum [beniseed]
ref|XP_010112544.1|  E3 ubiquitin ligase BIG BROTHER-related protein    228   3e-69   
ref|XP_002521533.1|  ring finger protein, putative                      226   6e-69   Ricinus communis
ref|XP_006437609.1|  hypothetical protein CICLE_v10032094mg             226   2e-68   Citrus clementina [clementine]
gb|KJB12378.1|  hypothetical protein B456_002G015500                    224   2e-68   Gossypium raimondii
gb|KHG29072.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...    223   2e-68   Gossypium arboreum [tree cotton]
gb|KJB31860.1|  hypothetical protein B456_005G211500                    224   3e-68   Gossypium raimondii
gb|KJB31859.1|  hypothetical protein B456_005G211500                    225   4e-68   Gossypium raimondii
gb|KDO52706.1|  hypothetical protein CISIN_1g019980mg                   225   4e-68   Citrus sinensis [apfelsine]
ref|XP_008445883.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    224   5e-68   Cucumis melo [Oriental melon]
ref|XP_007142774.1|  hypothetical protein PHAVU_007G015800g             224   1e-67   Phaseolus vulgaris [French bean]
gb|EYU20483.1|  hypothetical protein MIMGU_mgv1a013375mg                219   4e-67   Erythranthe guttata [common monkey flower]
ref|XP_004497227.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    223   4e-67   Cicer arietinum [garbanzo]
gb|KHN23096.1|  E3 ubiquitin ligase BIG BROTHER-related                 222   6e-67   Glycine soja [wild soybean]
ref|XP_004143619.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    221   7e-67   Cucumis sativus [cucumbers]
ref|XP_003555845.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    221   9e-67   Glycine max [soybeans]
ref|XP_002310069.1|  zinc finger family protein                         221   9e-67   
gb|KJB31861.1|  hypothetical protein B456_005G211500                    219   5e-66   Gossypium raimondii
ref|XP_003536731.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    220   5e-66   Glycine max [soybeans]
emb|CAC10211.1|  E3 ubiquitin ligase BIG BROTHER-related protein        215   1e-65   Cicer arietinum [garbanzo]
gb|KDO52705.1|  hypothetical protein CISIN_1g019980mg                   218   1e-65   Citrus sinensis [apfelsine]
ref|XP_003555846.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    218   2e-65   Glycine max [soybeans]
ref|XP_011002254.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    217   3e-65   Populus euphratica
ref|XP_011002253.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    217   5e-65   Populus euphratica
ref|XP_004497226.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    217   6e-65   Cicer arietinum [garbanzo]
ref|XP_011002252.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    216   1e-64   Populus euphratica
ref|XP_007043263.1|  RING/U-box superfamily protein                     218   1e-64   
ref|XP_010688665.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    215   2e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008383707.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    213   1e-63   
ref|XP_010688664.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    210   2e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU35575.1|  hypothetical protein MIMGU_mgv1a010240mg                209   6e-62   Erythranthe guttata [common monkey flower]
gb|KHG07975.1|  E3 ubiquitin ligase BIG BROTHER-related -like pro...    202   8e-61   Gossypium arboreum [tree cotton]
ref|XP_003592713.1|  RING finger protein                                205   2e-60   Medicago truncatula
ref|XP_011022026.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    204   4e-60   Populus euphratica
ref|XP_006382946.1|  hypothetical protein POPTR_0005s09300g             204   5e-60   
ref|XP_006382945.1|  hypothetical protein POPTR_0005s09300g             203   5e-60   
ref|XP_011022025.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    203   6e-60   Populus euphratica
gb|ACJ86011.1|  unknown                                                 203   1e-59   Medicago truncatula
ref|XP_006851962.1|  hypothetical protein AMTR_s00041p00192380          200   5e-59   Amborella trichopoda
ref|XP_010932524.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    200   6e-59   Elaeis guineensis
ref|XP_008789253.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    198   3e-58   Phoenix dactylifera
ref|XP_009395387.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    198   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003592714.1|  RING finger protein                                199   5e-58   Medicago truncatula
gb|ACJ85919.1|  unknown                                                 199   5e-58   Medicago truncatula
ref|XP_008795341.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    197   5e-58   Phoenix dactylifera
ref|XP_010906327.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    191   2e-55   Elaeis guineensis
ref|XP_004957470.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    191   2e-55   Setaria italica
ref|XP_006406443.1|  hypothetical protein EUTSA_v10021098mg             191   3e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010508204.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    191   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009111410.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    190   9e-55   Brassica rapa
ref|XP_002883210.1|  zinc finger family protein                         190   1e-54   
emb|CDY42218.1|  BnaA01g25770D                                          189   2e-54   Brassica napus [oilseed rape]
ref|XP_009145730.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    189   2e-54   Brassica rapa
ref|XP_010466157.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    189   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010487949.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    189   4e-54   Camelina sativa [gold-of-pleasure]
ref|NP_566651.1|  E3 ubiquitin ligase BIG BROTHER-like protein          189   5e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487948.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    188   1e-53   Camelina sativa [gold-of-pleasure]
gb|EPS72594.1|  hypothetical protein M569_02164                         179   3e-53   Genlisea aurea
emb|CDY33429.1|  BnaC01g32960D                                          185   7e-53   Brassica napus [oilseed rape]
ref|XP_009392890.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    184   9e-53   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY25357.1|  BnaA05g19270D                                          184   2e-52   Brassica napus [oilseed rape]
gb|AAM61025.1|  unknown                                                 184   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541856.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    182   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_002460573.1|  hypothetical protein SORBIDRAFT_02g031050          181   2e-51   Sorghum bicolor [broomcorn]
emb|CDY24595.1|  BnaC05g32790D                                          181   3e-51   Brassica napus [oilseed rape]
ref|XP_006661480.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    179   3e-51   Oryza brachyantha
ref|XP_006298094.1|  hypothetical protein CARUB_v10014137mg             181   4e-51   Capsella rubella
ref|NP_001150748.1|  protein binding protein                            180   5e-51   Zea mays [maize]
tpg|DAA62493.1|  TPA: putative RING zinc finger domain superfamil...    180   5e-51   
ref|NP_001149296.1|  LOC100282919                                       180   7e-51   Zea mays [maize]
ref|XP_003574899.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    179   9e-51   Brachypodium distachyon [annual false brome]
ref|XP_010235389.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    179   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_002445744.1|  hypothetical protein SORBIDRAFT_07g024950          179   1e-50   Sorghum bicolor [broomcorn]
ref|XP_003578515.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    180   1e-50   Brachypodium distachyon [annual false brome]
ref|XP_009395284.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    177   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ88925.1|  predicted protein                                      178   5e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK39312.1|  hypothetical protein AALP_AA3G228600                    177   5e-50   Arabis alpina [alpine rockcress]
tpg|DAA40634.1|  TPA: putative RING zinc finger domain superfamil...    176   2e-49   
gb|EAZ07897.1|  hypothetical protein OsI_30152                          174   5e-49   Oryza sativa Indica Group [Indian rice]
ref|NP_001062434.1|  Os08g0548300                                       174   5e-49   
gb|EEC84951.1|  hypothetical protein OsI_32172                          174   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006659662.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    173   2e-48   Oryza brachyantha
ref|NP_001063778.1|  Os09g0535100                                       174   2e-48   
ref|XP_008789252.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    172   3e-48   
dbj|BAK04753.1|  predicted protein                                      171   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW65071.1|  hypothetical protein EUGRSUZ_G02582                     169   8e-47   Eucalyptus grandis [rose gum]
gb|EMS64698.1|  E3 ubiquitin ligase BIG BROTHER-related protein         166   1e-46   Triticum urartu
ref|XP_010067008.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    169   3e-46   Eucalyptus grandis [rose gum]
ref|XP_004974139.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    167   5e-46   Setaria italica
gb|ACG31571.1|  hypothetical protein                                    166   6e-46   Zea mays [maize]
ref|NP_001131853.1|  uncharacterized LOC100193231                       166   7e-46   Zea mays [maize]
ref|XP_009418697.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    160   9e-44   
ref|XP_002445741.1|  hypothetical protein SORBIDRAFT_07g024936          155   9e-44   
ref|XP_006859208.1|  hypothetical protein AMTR_s00070p00189230          152   4e-41   
ref|XP_008651502.1|  PREDICTED: protein binding protein isoform X2      153   9e-41   
ref|XP_008651501.1|  PREDICTED: protein binding protein isoform X1      152   2e-40   Zea mays [maize]
gb|ADE77661.1|  unknown                                                 150   7e-40   Picea sitchensis
gb|EMT04037.1|  RING-H2 finger protein ATL3F                            147   6e-39   
gb|KCW65072.1|  hypothetical protein EUGRSUZ_G02582                     147   2e-38   Eucalyptus grandis [rose gum]
gb|AFW65659.1|  putative RING zinc finger domain superfamily protein    144   1e-37   
gb|ABK26080.1|  unknown                                                 144   2e-37   Picea sitchensis
gb|EEE70120.1|  hypothetical protein OsJ_30137                          144   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001769627.1|  predicted protein                                  135   4e-34   
gb|AFA26144.1|  E3 ubiquitin ligase big-brother-like protein            127   2e-33   Lolium perenne [perennial ryegrass]
gb|KJB12380.1|  hypothetical protein B456_002G015500                    127   1e-31   Gossypium raimondii
ref|XP_010413127.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    125   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008349923.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    124   3e-30   Malus domestica [apple tree]
ref|XP_009364991.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    124   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_010512780.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         123   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008349929.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    123   5e-30   
ref|XP_010065007.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    122   6e-30   Eucalyptus grandis [rose gum]
ref|XP_009138675.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    121   1e-29   Brassica rapa
emb|CDX93901.1|  BnaC04g20600D                                          121   2e-29   
ref|XP_009354734.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    121   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_009138670.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    121   2e-29   
ref|XP_008231277.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         121   3e-29   Prunus mume [ume]
ref|XP_009138669.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    122   4e-29   
ref|XP_010667359.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    120   4e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_680148.1|  E3 ubiquitin ligase BIG BROTHER                       120   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009354730.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    120   5e-29   
ref|XP_009354732.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    120   8e-29   
ref|XP_006482888.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    119   1e-28   
ref|XP_002878521.1|  hypothetical protein ARALYDRAFT_324777             119   1e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_006292296.1|  hypothetical protein CARUB_v10018505mg             119   1e-28   Capsella rubella
ref|XP_007218202.1|  hypothetical protein PRUPE_ppa010554mg             119   1e-28   Prunus persica
ref|XP_002983644.1|  hypothetical protein SELMODRAFT_19194              115   2e-28   
ref|XP_008375171.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         119   3e-28   Malus domestica [apple tree]
ref|XP_002531910.1|  protein binding protein, putative                  117   7e-28   
gb|ABR17882.1|  unknown                                                 117   7e-28   Picea sitchensis
ref|XP_003558702.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    117   8e-28   Brachypodium distachyon [annual false brome]
ref|XP_010536033.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    117   1e-27   Tarenaya hassleriana [spider flower]
emb|CBI18994.3|  unnamed protein product                                115   1e-27   Vitis vinifera
ref|XP_008778611.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    114   1e-27   Phoenix dactylifera
ref|XP_010664190.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    115   1e-27   
ref|XP_006439127.1|  hypothetical protein CICLE_v10032570mg             116   2e-27   
ref|XP_009394740.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    116   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP07764.1|  unnamed protein product                                117   2e-27   Coffea canephora [robusta coffee]
ref|XP_006482886.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    116   2e-27   Citrus sinensis [apfelsine]
gb|KGN45134.1|  hypothetical protein Csa_7G428220                       116   2e-27   Cucumis sativus [cucumbers]
ref|XP_008461284.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    116   2e-27   Cucumis melo [Oriental melon]
ref|XP_008461282.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    116   2e-27   Cucumis melo [Oriental melon]
ref|XP_002468417.1|  hypothetical protein SORBIDRAFT_01g045580          116   2e-27   
ref|XP_010229112.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    116   2e-27   
ref|XP_009396390.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    116   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394739.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    116   2e-27   
ref|XP_009394737.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    116   2e-27   
ref|XP_004251782.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    114   3e-27   Solanum lycopersicum
ref|XP_011027491.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    115   3e-27   Populus euphratica
ref|XP_006350142.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    114   3e-27   Solanum tuberosum [potatoes]
gb|KHG02120.1|  E3 ubiquitin ligase BIG BROTHER -like protein           115   4e-27   Gossypium arboreum [tree cotton]
ref|XP_010032421.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    115   4e-27   Eucalyptus grandis [rose gum]
gb|KJB21876.1|  hypothetical protein B456_004G019200                    115   4e-27   Gossypium raimondii
ref|XP_007137421.1|  hypothetical protein PHAVU_009G125700g             114   6e-27   Phaseolus vulgaris [French bean]
ref|XP_010936603.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         115   7e-27   Elaeis guineensis
ref|XP_007052540.1|  RING/U-box superfamily protein isoform 1           114   8e-27   
ref|XP_010255520.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         114   8e-27   Nelumbo nucifera [Indian lotus]
gb|EMT12530.1|  RING finger protein 44                                  115   9e-27   
ref|XP_011003433.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    113   1e-26   Populus euphratica
ref|XP_004306531.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         114   1e-26   Fragaria vesca subsp. vesca
ref|XP_010664189.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    113   1e-26   
gb|AIZ68183.1|  E3 ubiquitin ligase BIG BROTHER-like protein            114   1e-26   Ornithogalum longebracteatum [sea-onion]
dbj|BAK04699.1|  predicted protein                                      114   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011101177.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    114   2e-26   Sesamum indicum [beniseed]
ref|XP_010695299.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         114   2e-26   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAG92476.1|  unnamed protein product                                114   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800799.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    114   2e-26   Phoenix dactylifera
gb|EMS63320.1|  E3 ubiquitin ligase BIG BROTHER                         114   2e-26   Triticum urartu
emb|CAH67282.1|  OSIGBa0111L12.9                                        114   2e-26   Oryza sativa [red rice]
ref|XP_007014997.1|  RING/U-box superfamily protein isoform 1           113   2e-26   Theobroma cacao [chocolate]
ref|XP_004985526.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    113   2e-26   Setaria italica
ref|XP_008651491.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    113   2e-26   
ref|NP_001148727.1|  LOC100282343                                       113   2e-26   
ref|XP_008227150.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    113   3e-26   Prunus mume [ume]
ref|XP_004290892.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    112   3e-26   Fragaria vesca subsp. vesca
ref|NP_001049123.1|  Os03g0173900                                       113   3e-26   
ref|XP_004502478.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    113   3e-26   
ref|XP_007133839.1|  hypothetical protein PHAVU_011G213300g             113   3e-26   Phaseolus vulgaris [French bean]
gb|KDP43466.1|  hypothetical protein JCGZ_16753                         112   3e-26   Jatropha curcas
ref|NP_001053604.1|  Os04g0571200                                       114   4e-26   
ref|XP_004502471.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    114   4e-26   
ref|XP_003540530.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    113   4e-26   
emb|CAD41576.3|  OSJNBa0088I22.8                                        114   4e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EEE58414.1|  hypothetical protein OsJ_09608                          113   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649482.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    112   5e-26   
gb|EAY95219.1|  hypothetical protein OsI_17037                          113   5e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010527674.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    112   5e-26   
ref|NP_001140719.1|  uncharacterized LOC100272794                       112   5e-26   Zea mays [maize]
gb|EAY88740.1|  hypothetical protein OsI_10215                          114   5e-26   Oryza sativa Indica Group [Indian rice]
gb|EPS58031.1|  hypothetical protein M569_16786                         108   6e-26   Genlisea aurea
ref|XP_002279794.2|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         112   6e-26   Vitis vinifera
ref|XP_004165039.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    109   7e-26   
emb|CDP05240.1|  unnamed protein product                                112   8e-26   Coffea canephora [robusta coffee]
gb|AFK40026.1|  unknown                                                 109   1e-25   Lotus japonicus
ref|XP_011025427.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    111   1e-25   Populus euphratica
ref|NP_001242183.1|  uncharacterized protein LOC100805963               110   1e-25   
ref|XP_010277675.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    110   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006383587.1|  hypothetical protein POPTR_0005s20250g             108   2e-25   
ref|XP_006345461.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   2e-25   
ref|XP_006591894.1|  PREDICTED: uncharacterized protein LOC100805...    111   2e-25   
ref|XP_004151219.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    109   2e-25   
ref|XP_006850185.1|  hypothetical protein AMTR_s00022p00246320          112   2e-25   
ref|XP_006590306.1|  PREDICTED: uncharacterized protein LOC100793...    110   2e-25   Glycine max [soybeans]
ref|XP_002313299.2|  hypothetical protein POPTR_0009s06680g             110   2e-25   
ref|NP_001242079.1|  uncharacterized protein LOC100793907               110   2e-25   Glycine max [soybeans]
ref|XP_004510966.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   2e-25   
ref|XP_008450441.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   2e-25   Cucumis melo [Oriental melon]
ref|XP_009414750.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    111   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300971.2|  zinc finger family protein                         110   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011042092.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   2e-25   Populus euphratica
ref|XP_003606783.1|  E3 ubiquitin-protein ligase                        110   3e-25   
ref|XP_007213834.1|  hypothetical protein PRUPE_ppa010371mg             110   3e-25   Prunus persica
ref|XP_002303894.2|  hypothetical protein POPTR_0003s20350g             110   3e-25   
gb|EMT14836.1|  RING finger protein 44                                  110   3e-25   
ref|XP_004142225.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   3e-25   Cucumis sativus [cucumbers]
ref|XP_003606782.1|  E3 ubiquitin-protein ligase                        110   3e-25   
ref|XP_011087589.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         110   3e-25   Sesamum indicum [beniseed]
ref|XP_006470593.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   3e-25   Citrus sinensis [apfelsine]
ref|XP_003602037.1|  RING finger protein                                109   3e-25   
ref|XP_007150374.1|  hypothetical protein PHAVU_005G148200g             110   3e-25   Phaseolus vulgaris [French bean]
gb|KGN54171.1|  hypothetical protein Csa_4G290860                       110   3e-25   Cucumis sativus [cucumbers]
gb|AES88979.2|  E3 ubiquitin ligase BIG brother-like protein            110   3e-25   Medicago truncatula
gb|EYU27063.1|  hypothetical protein MIMGU_mgv1a012318mg                110   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_010933875.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    110   4e-25   Elaeis guineensis
gb|AFK44486.1|  unknown                                                 110   4e-25   Medicago truncatula
ref|XP_011080278.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   4e-25   Sesamum indicum [beniseed]
ref|XP_009607181.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   4e-25   Nicotiana tomentosiformis
ref|NP_001235447.1|  uncharacterized protein LOC100526881               108   4e-25   Glycine max [soybeans]
ref|XP_002299947.2|  hypothetical protein POPTR_0001s27470g             110   5e-25   
ref|XP_010257293.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   5e-25   Nelumbo nucifera [Indian lotus]
gb|KGN66475.1|  hypothetical protein Csa_1G613470                       110   5e-25   Cucumis sativus [cucumbers]
ref|XP_009376879.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   5e-25   
ref|XP_008219608.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   5e-25   Prunus mume [ume]
ref|XP_009355176.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    110   5e-25   Pyrus x bretschneideri [bai li]
gb|ACU23155.1|  unknown                                                 109   5e-25   Glycine max [soybeans]
ref|XP_011011041.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    109   6e-25   Populus euphratica
ref|XP_008649613.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   6e-25   
ref|XP_009763746.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    109   6e-25   Nicotiana sylvestris
ref|XP_003542854.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    109   6e-25   Glycine max [soybeans]
ref|XP_007226705.1|  hypothetical protein PRUPE_ppa020151mg             108   8e-25   
ref|XP_009612485.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    108   9e-25   Nicotiana tomentosiformis
ref|XP_007132006.1|  hypothetical protein PHAVU_011G058800g             109   9e-25   Phaseolus vulgaris [French bean]
gb|AES88980.2|  E3 ubiquitin ligase BIG brother-like protein            108   1e-24   Medicago truncatula
gb|KDP22078.1|  hypothetical protein JCGZ_25909                         108   1e-24   Jatropha curcas
ref|XP_008449726.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    108   1e-24   Cucumis melo [Oriental melon]
gb|KJB55369.1|  hypothetical protein B456_009G072700                    108   1e-24   Gossypium raimondii
ref|XP_010317579.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    108   1e-24   Solanum lycopersicum
gb|KHN21712.1|  E3 ubiquitin ligase BIG BROTHER-related                 107   1e-24   Glycine soja [wild soybean]
ref|XP_008466738.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   1e-24   Cucumis melo [Oriental melon]
ref|XP_008338661.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    108   1e-24   Malus domestica [apple tree]
ref|XP_004173830.1|  PREDICTED: uncharacterized LOC101217935            108   1e-24   
ref|XP_008449725.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    108   1e-24   Cucumis melo [Oriental melon]
ref|XP_004149804.1|  PREDICTED: uncharacterized protein LOC101217935    108   1e-24   Cucumis sativus [cucumbers]
gb|KHN19446.1|  E3 ubiquitin ligase BIG BROTHER                         109   2e-24   Glycine soja [wild soybean]
ref|XP_004507101.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    108   2e-24   Cicer arietinum [garbanzo]
emb|CDP18780.1|  unnamed protein product                                108   2e-24   Coffea canephora [robusta coffee]
ref|XP_011076491.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    108   2e-24   Sesamum indicum [beniseed]
ref|XP_006356379.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    108   2e-24   Solanum tuberosum [potatoes]
gb|KDP32837.1|  hypothetical protein JCGZ_12129                         107   2e-24   Jatropha curcas
ref|XP_009767003.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    107   2e-24   Nicotiana sylvestris
ref|XP_009599844.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    107   3e-24   Nicotiana tomentosiformis
ref|XP_009759906.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    106   3e-24   Nicotiana sylvestris
gb|KHN05193.1|  E3 ubiquitin ligase BIG BROTHER-related                 107   3e-24   Glycine soja [wild soybean]
ref|XP_004291799.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    107   3e-24   
ref|XP_009376874.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    107   4e-24   
gb|KEH19070.1|  E3 ubiquitin ligase BIG brother-like protein            107   4e-24   
ref|XP_009375062.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    107   4e-24   
ref|XP_008364357.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    107   4e-24   
ref|XP_005650352.1|  hypothetical protein COCSUDRAFT_60820              112   5e-24   
dbj|BAH56825.1|  AT3G63530                                              107   5e-24   
dbj|BAK01921.1|  predicted protein                                      107   6e-24   
ref|XP_010031812.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    107   6e-24   
ref|XP_002285497.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER         107   6e-24   
ref|XP_010277674.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   7e-24   
ref|XP_003580354.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    107   7e-24   
gb|EYU46268.1|  hypothetical protein MIMGU_mgv1a012496mg                106   8e-24   
ref|XP_004957408.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    104   8e-24   
ref|XP_010530207.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    106   9e-24   
ref|XP_010673617.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    106   1e-23   
ref|XP_010238402.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    104   1e-23   
ref|XP_010934460.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    106   1e-23   
ref|XP_006652662.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    106   1e-23   
ref|XP_010324408.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER i...    107   1e-23   
ref|XP_008795395.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    106   1e-23   
ref|XP_008795391.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    105   1e-23   
ref|XP_002462697.1|  hypothetical protein SORBIDRAFT_02g030410          103   2e-23   
ref|XP_010246935.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    105   2e-23   
ref|XP_002299230.1|  hypothetical protein POPTR_0001s05710g             105   2e-23   
gb|EYU20581.1|  hypothetical protein MIMGU_mgv1a014065mg                104   2e-23   
ref|XP_009769401.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    105   2e-23   
ref|XP_009622995.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    105   3e-23   
ref|XP_002520340.1|  ring finger protein, putative                      104   3e-23   
ref|NP_001131721.1|  uncharacterized protein LOC100193086               104   3e-23   
ref|XP_008667134.1|  PREDICTED: uncharacterized protein LOC100193...    104   4e-23   
ref|XP_002446955.1|  hypothetical protein SORBIDRAFT_06g025850          104   4e-23   
ref|XP_007161474.1|  hypothetical protein PHAVU_001G072100g             103   4e-23   
ref|XP_003544702.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    103   5e-23   
dbj|BAJ88799.1|  predicted protein                                      102   5e-23   
ref|XP_006596212.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    103   5e-23   
ref|XP_009397505.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    104   5e-23   
ref|XP_009624975.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    104   6e-23   
ref|NP_001063719.1|  Os09g0525400                                       102   6e-23   
emb|CDX77848.1|  BnaC03g53710D                                          103   7e-23   
ref|XP_004250877.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    103   8e-23   
gb|KDO83394.1|  hypothetical protein CISIN_1g026092mg                   103   8e-23   
ref|XP_007019133.1|  RING/U-box superfamily protein, putative           102   1e-22   
ref|NP_001131757.1|  LOC100193125                                       101   1e-22   
ref|XP_008347746.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    102   1e-22   
ref|XP_003578472.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    101   1e-22   
ref|XP_007014999.1|  RING/U-box superfamily protein isoform 3           103   2e-22   
ref|XP_006660863.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like    101   2e-22   
ref|XP_009379051.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    102   2e-22   
ref|XP_010536035.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    102   2e-22   
emb|CDY67192.1|  BnaA06g38750D                                          101   3e-22   
ref|XP_009347272.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    101   3e-22   
ref|XP_006353353.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    102   4e-22   
ref|XP_009150236.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    101   4e-22   
ref|XP_003633258.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    101   4e-22   
ref|XP_011037811.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...    102   4e-22   
ref|XP_010919236.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    102   5e-22   
gb|ACU24020.1|  unknown                                                 100   5e-22   
ref|XP_010919239.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    102   5e-22   
ref|XP_003542148.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    100   6e-22   
ref|XP_002282713.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    101   6e-22   
ref|XP_011101176.1|  PREDICTED: RING-H2 finger protein ATL66-like...    101   9e-22   
ref|XP_006857887.1|  hypothetical protein AMTR_s00069p00114060          101   9e-22   
ref|XP_010426169.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    100   1e-21   
ref|XP_004976537.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...    100   1e-21   
gb|KFK32642.1|  hypothetical protein AALP_AA6G269700                    103   1e-21   
ref|XP_006292300.1|  hypothetical protein CARUB_v10018510mg           99.8    1e-21   
ref|XP_010515040.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  99.8    1e-21   
ref|XP_010693485.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  99.8    2e-21   
gb|KDO80559.1|  hypothetical protein CISIN_1g044318mg                 98.6    3e-21   
ref|XP_010088242.1|  hypothetical protein L484_012525                   102   3e-21   
ref|XP_010245103.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  99.0    3e-21   
ref|XP_006472813.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  98.6    4e-21   
ref|XP_007150376.1|  hypothetical protein PHAVU_005G148200g           99.0    4e-21   
ref|XP_010102330.1|  hypothetical protein L484_015278                 98.6    7e-21   
ref|XP_006404408.1|  hypothetical protein EUTSA_v10010717mg           96.7    2e-20   
gb|EPS68702.1|  hypothetical protein M569_06065                       93.2    2e-20   
ref|XP_010031808.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  93.2    3e-20   
ref|NP_190302.1|  C3HC4 type RING finger protein                      95.9    3e-20   
ref|XP_004507099.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  95.9    8e-20   
gb|KJB64502.1|  hypothetical protein B456_010G052000                  94.7    9e-20   
gb|KJB59292.1|  hypothetical protein B456_009G247800                  94.7    9e-20   
ref|XP_001438747.1|  hypothetical protein                             96.3    1e-19   
ref|XP_001439828.1|  hypothetical protein                             95.9    1e-19   
gb|AET02171.2|  E3 ubiquitin ligase BIG brother, putative             95.1    2e-19   
tpg|DAA48756.1|  TPA: putative RING zinc finger domain superfamil...  90.1    2e-19   
ref|XP_010278556.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER       94.4    2e-19   
ref|NP_001056653.1|  Os06g0125800                                     94.7    2e-19   
ref|XP_010503329.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  94.0    2e-19   
ref|XP_002877551.1|  zinc finger family protein                       93.6    2e-19   
ref|XP_010095417.1|  Proteasome subunit beta type-3-A                 97.4    3e-19   
ref|XP_002946544.1|  hypothetical protein VOLCADRAFT_86603            90.5    6e-19   
gb|ABG73441.1|  zinc finger C3HC4 type family protein                 92.4    7e-19   
ref|XP_010934458.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  92.8    9e-19   
ref|XP_010934461.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  92.4    9e-19   
emb|CDY27083.1|  BnaA02g11030D                                        92.0    9e-19   
ref|XP_003627695.1|  E3 ubiquitin-protein ligase Arkadia              92.8    1e-18   
gb|EMS51607.1|  E3 ubiquitin ligase BIG BROTHER                       92.4    1e-18   
gb|EAR85086.3|  zinc finger, C3HC4 type (RING finger) protein         92.8    2e-18   
ref|XP_002318242.1|  hypothetical protein POPTR_0012s13650g           90.9    2e-18   
ref|XP_001032749.2|  hypothetical  protein                            92.4    3e-18   
emb|CDX91624.1|  BnaC02g15360D                                        89.7    5e-18   
ref|XP_006402265.1|  hypothetical protein EUTSA_v10006197mg           90.1    5e-18   
ref|XP_006655731.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  90.1    5e-18   
ref|XP_010537205.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  90.5    5e-18   
gb|EMS50286.1|  E3 ubiquitin ligase BIG BROTHER                       89.4    6e-18   
ref|XP_010106196.1|  hypothetical protein L484_009620                 90.9    9e-18   
ref|XP_006281611.1|  hypothetical protein CARUB_v10027729mg           89.4    1e-17   
ref|XP_004964385.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  89.0    1e-17   
ref|XP_001690515.1|  hypothetical protein CHLREDRAFT_161785           88.2    1e-17   
ref|XP_002317370.2|  zinc finger family protein                       91.7    2e-17   
ref|XP_002865895.1|  hypothetical protein ARALYDRAFT_918255           88.2    2e-17   
ref|XP_004035295.1|  hypothetical protein IMG5_101120                 85.9    2e-17   
ref|XP_008646568.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  89.4    2e-17   
ref|XP_010919238.1|  PREDICTED: uncharacterized protein LOC105043...  88.6    2e-17   
ref|XP_008378206.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  87.4    4e-17   
ref|XP_003541074.2|  PREDICTED: RING finger protein 38-like           89.7    5e-17   
ref|XP_007134874.1|  hypothetical protein PHAVU_010G083200g           85.9    5e-17   
ref|XP_002504378.1|  ring-h2 finger protein                           88.2    5e-17   
ref|XP_002865896.1|  protein binding protein                          87.4    6e-17   
ref|XP_009398728.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  87.0    6e-17   
ref|XP_006401859.1|  hypothetical protein EUTSA_v10015344mg           87.4    6e-17   
ref|XP_008805566.1|  PREDICTED: uncharacterized protein LOC103718487  89.7    6e-17   
ref|XP_011403142.1|  PREDICTED: RING finger protein 44-like           85.5    9e-17   
ref|XP_009336167.1|  PREDICTED: probable E3 ubiquitin-protein lig...  89.4    9e-17   
ref|NP_200027.2|  RING/U-box domain-containing protein                87.0    9e-17   
ref|XP_011008298.1|  PREDICTED: E3 ubiquitin-protein ligase arkad...  89.4    1e-16   
ref|XP_010473696.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  86.3    1e-16   
ref|NP_001148879.1|  protein binding protein                          86.3    1e-16   
gb|AFM35765.1|  hypothetical protein                                  81.6    2e-16   
ref|XP_004489089.1|  PREDICTED: RING finger protein 44-like           88.2    2e-16   
gb|KDO60069.1|  hypothetical protein CISIN_1g045064mg                 83.2    2e-16   
gb|KEH38658.1|  zinc finger, C3HC4 type (RING finger) protein         88.2    2e-16   
emb|CBJ32426.1|  ring finger protein                                  84.3    3e-16   
ref|XP_006360055.1|  PREDICTED: uncharacterized protein LOC102588...  87.8    3e-16   
emb|CDW87640.1|  zinc finger                                          85.5    3e-16   
gb|EHJ76189.1|  eIF2B-beta protein                                    88.2    5e-16   
gb|KHN41422.1|  E3 ubiquitin ligase BIG BROTHER                       86.7    5e-16   
ref|XP_006582144.1|  PREDICTED: RING finger protein 38-like isofo...  86.7    5e-16   
gb|KEH38657.1|  zinc finger, C3HC4 type (RING finger) protein         85.1    6e-16   
ref|XP_011038901.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  87.0    6e-16   
gb|KDP36261.1|  hypothetical protein JCGZ_09826                       87.0    7e-16   
ref|XP_006370029.1|  hypothetical protein POPTR_0001s38280g           86.7    7e-16   
gb|ACG24763.1|  protein binding protein                               84.3    7e-16   
ref|XP_009034624.1|  hypothetical protein AURANDRAFT_52667            84.7    7e-16   
gb|ACN25846.1|  unknown                                               84.3    7e-16   
ref|XP_002734949.1|  PREDICTED: RING finger protein 38-like isofo...  86.7    7e-16   
gb|KJB45753.1|  hypothetical protein B456_007G325600                  86.7    8e-16   
ref|XP_009399993.1|  PREDICTED: probable E3 ubiquitin-protein lig...  86.3    8e-16   
emb|CDY00512.1|  BnaA10g07610D                                        84.0    8e-16   
ref|XP_009399992.1|  PREDICTED: probable E3 ubiquitin-protein lig...  86.3    8e-16   
ref|XP_009587082.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-l...  80.5    8e-16   
ref|XP_009106931.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  84.3    8e-16   
ref|XP_007146478.1|  hypothetical protein PHAVU_006G043800g           82.4    9e-16   
ref|XP_009106940.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  84.3    9e-16   
ref|XP_007149419.1|  hypothetical protein PHAVU_005G068800g           86.3    9e-16   
ref|XP_003596355.1|  RING finger-like protein                         84.7    9e-16   
gb|ACG39701.1|  protein binding protein                               83.6    1e-15   
ref|XP_006652769.1|  PREDICTED: uncharacterized protein LOC102712...  84.7    1e-15   
ref|XP_011098261.1|  PREDICTED: probable E3 ubiquitin-protein lig...  83.2    1e-15   
ref|XP_006495092.1|  PREDICTED: uncharacterized protein LOC102621...  85.9    1e-15   
ref|XP_006451752.1|  hypothetical protein CICLE_v10007976mg           85.9    1e-15   
ref|XP_010473673.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-like  82.8    1e-15   
emb|CDY31919.1|  BnaC09g28250D                                        83.2    1e-15   
emb|CBI20233.3|  unnamed protein product                              85.5    1e-15   
ref|XP_004248251.1|  PREDICTED: uncharacterized protein LOC101263764  85.5    2e-15   
emb|CDP05971.1|  unnamed protein product                              85.5    2e-15   
gb|ELW69870.1|  RING finger protein 38                                80.5    2e-15   
gb|KJB82013.1|  hypothetical protein B456_013G172300                  85.5    2e-15   
ref|XP_010922541.1|  PREDICTED: probable E3 ubiquitin-protein lig...  85.5    2e-15   
ref|XP_002282878.1|  PREDICTED: uncharacterized protein LOC100264059  85.5    2e-15   
emb|CDY68521.1|  BnaCnng59350D                                        84.7    2e-15   
ref|XP_010175522.1|  PREDICTED: E3 ubiquitin-protein ligase RNF38     81.3    2e-15   
ref|XP_001847450.1|  ring finger protein                              85.1    2e-15   
gb|KDD76012.1|  hypothetical protein H632_c397p1                      82.4    2e-15   
ref|XP_001656980.1|  AAEL000523-PA                                    85.1    3e-15   
ref|XP_005849379.1|  hypothetical protein CHLNCDRAFT_143853           82.4    3e-15   
ref|XP_001429673.1|  hypothetical protein                             82.4    3e-15   
ref|XP_002160653.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  83.2    3e-15   
gb|KFB38316.1|  ring finger protein                                   85.1    4e-15   
gb|KHG14993.1|  E3 ubiquitin ligase BIG BROTHER -like protein         84.3    4e-15   
gb|AEQ94064.1|  MIP32849p1                                            82.8    4e-15   
ref|XP_008798284.1|  PREDICTED: uncharacterized protein LOC103713214  84.3    4e-15   
emb|CAE01827.2|  OSJNBa0041A02.20                                     83.2    4e-15   
ref|XP_002881786.1|  hypothetical protein ARALYDRAFT_483242           81.6    4e-15   
ref|XP_009758408.1|  PREDICTED: uncharacterized protein LOC104211...  84.3    4e-15   
ref|XP_011211358.1|  PREDICTED: putative uncharacterized protein ...  85.5    4e-15   
ref|XP_009758406.1|  PREDICTED: uncharacterized protein LOC104211...  84.3    4e-15   
ref|XP_008647854.1|  PREDICTED: protein binding protein isoform X1    82.4    4e-15   
gb|ACG47159.1|  protein binding protein                               82.0    4e-15   
ref|XP_008647855.1|  PREDICTED: protein binding protein isoform X2    82.4    5e-15   
gb|ETN59777.1|  ring finger protein                                   84.7    5e-15   
ref|XP_002518375.1|  ring finger protein, putative                    84.3    5e-15   
ref|XP_007021617.1|  Ring finger protein, putative isoform 1          84.0    5e-15   
gb|KHN36398.1|  E3 ubiquitin ligase BIG BROTHER                       83.6    5e-15   
emb|CDW71600.1|  zinc finger protein                                  83.6    6e-15   
ref|XP_003761403.1|  PREDICTED: RING finger protein 38                80.9    6e-15   
ref|XP_007245664.1|  PREDICTED: RING finger protein 44 isoform X2     83.2    6e-15   
gb|KJB77651.1|  hypothetical protein B456_012G149900                  84.3    6e-15   
ref|XP_008939047.1|  PREDICTED: E3 ubiquitin-protein ligase RNF38     81.3    6e-15   
ref|XP_010324381.1|  PREDICTED: uncharacterized protein LOC101248...  84.0    7e-15   
ref|XP_009127427.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER       79.7    7e-15   
ref|XP_010442736.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  80.5    7e-15   
ref|XP_010324380.1|  PREDICTED: uncharacterized protein LOC101248...  84.0    8e-15   
ref|XP_004328150.1|  PREDICTED: RING finger protein 38-like           81.3    8e-15   
ref|XP_011069666.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  84.0    8e-15   
ref|XP_007212380.1|  hypothetical protein PRUPE_ppa003782mg           83.6    8e-15   
ref|XP_008226444.1|  PREDICTED: uncharacterized protein LOC103326020  83.6    8e-15   
ref|XP_011069665.1|  PREDICTED: E3 ubiquitin-protein ligase MBR2-...  84.0    9e-15   
emb|CBI25581.3|  unnamed protein product                              78.6    9e-15   
ref|NP_001236041.1|  uncharacterized protein LOC100500299             79.3    1e-14   
ref|XP_007245663.1|  PREDICTED: RING finger protein 44 isoform X1     82.8    1e-14   
ref|XP_011257059.1|  PREDICTED: RING finger protein 44 isoform X2     83.6    1e-14   
ref|XP_010908847.1|  PREDICTED: E3 ubiquitin-protein ligase MBR1-...  83.2    1e-14   
ref|XP_003728567.1|  PREDICTED: uncharacterized protein LOC585279...  83.2    1e-14   
ref|XP_005098690.1|  PREDICTED: E3 ubiquitin-protein ligase RNF6-...  82.8    1e-14   
ref|XP_790205.3|  PREDICTED: uncharacterized protein LOC585279 is...  83.2    1e-14   
ref|XP_001517302.2|  PREDICTED: E3 ubiquitin-protein ligase RNF38...  82.8    1e-14   
gb|ACN33835.1|  unknown                                               81.6    1e-14   
ref|XP_005504647.1|  PREDICTED: RING finger protein 38-like isofo...  82.4    1e-14   
ref|NP_001149055.1|  protein binding protein                          81.6    1e-14   



>ref|XP_004231468.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Solanum lycopersicum]
Length=314

 Score =   267 bits (683),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 169/188 (90%), Gaps = 3/188 (2%)
 Frame = -2

Query  688  GSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllal  509
            GS V E+DEDAFDVHAHDEASEDEN G+ELDPSAF SDEAYARALQ+AEEREMAARLLAL
Sbjct  127  GSDVGEDDEDAFDVHAHDEASEDENQGVELDPSAFSSDEAYARALQDAEEREMAARLLAL  186

Query  508  AGINE---GQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASL  338
            AGINE   GQ   EED G NSQDAWE+VDPDELSYEEL+ALG+VVGTESRGLSADTIASL
Sbjct  187  AGINEMYVGQRQDEEDRGINSQDAWEDVDPDELSYEELIALGDVVGTESRGLSADTIASL  246

Query  337  PSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSA  158
            PS+NYK+Q   +G  DSCVICRLDYEDGE LTVLSCKH+YHSEC+NNWL+INKVCP+CS 
Sbjct  247  PSVNYKTQTASEGTTDSCVICRLDYEDGEKLTVLSCKHTYHSECLNNWLQINKVCPICST  306

Query  157  EVSTSGNS  134
            EVSTSGNS
Sbjct  307  EVSTSGNS  314



>ref|XP_009775151.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nicotiana 
sylvestris]
Length=319

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 169/187 (90%), Gaps = 3/187 (2%)
 Frame = -2

Query  685  SHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalA  506
            S+VDE++EDAFDVHAHDEA EDEN GIELDPSAF SDEAYARALQ+AEER+MAARLLALA
Sbjct  133  SNVDEDEEDAFDVHAHDEAGEDENQGIELDPSAFSSDEAYARALQDAEERDMAARLLALA  192

Query  505  GINE---GQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLP  335
            GINE   GQA   ED G NSQDAWE+VDPDELSYEEL+ALGEVVGTESRGLSADTIASLP
Sbjct  193  GINEMYVGQAQDGEDRGINSQDAWEDVDPDELSYEELIALGEVVGTESRGLSADTIASLP  252

Query  334  SMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAE  155
            S+NYK+Q   DG  DSCVICRL+YEDG+ LTVLSCKHSYHSEC+NNWL+INKVCP+CS E
Sbjct  253  SVNYKAQTASDGTTDSCVICRLEYEDGDQLTVLSCKHSYHSECLNNWLQINKVCPMCSTE  312

Query  154  VSTSGNS  134
            VSTSGNS
Sbjct  313  VSTSGNS  319



>ref|XP_006365590.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Solanum 
tuberosum]
Length=313

 Score =   265 bits (676),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 169/188 (90%), Gaps = 3/188 (2%)
 Frame = -2

Query  688  GSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllal  509
            GS+VDE+DEDAFDVHAH+EASEDEN G+ELDPSAF SDEAYARALQ+AEEREMAARLLAL
Sbjct  126  GSNVDEDDEDAFDVHAHEEASEDENQGVELDPSAFSSDEAYARALQDAEEREMAARLLAL  185

Query  508  AGINE---GQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASL  338
            AGINE   GQ   EED   NSQDAWE+VDPDELSYEEL+ALGEVVGTESRGLSADTIASL
Sbjct  186  AGINEMYVGQTQDEEDRAINSQDAWEDVDPDELSYEELIALGEVVGTESRGLSADTIASL  245

Query  337  PSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSA  158
            PS+ YK+Q   +G  DSCVICRLDYEDG+ LTVLSCKH+YHSEC+NNWL+INKVCP+CS 
Sbjct  246  PSVIYKTQTASEGTTDSCVICRLDYEDGDKLTVLSCKHTYHSECLNNWLQINKVCPICST  305

Query  157  EVSTSGNS  134
            EVSTSGNS
Sbjct  306  EVSTSGNS  313



>ref|XP_009622651.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nicotiana 
tomentosiformis]
Length=331

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 160/178 (90%), Gaps = 3/178 (2%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE---GQ  488
            AFDVHAHDEA EDEN GIELDPSAF SDEAYARALQ+AEEREMAARLLALAGINE   GQ
Sbjct  154  AFDVHAHDEAGEDENQGIELDPSAFSSDEAYARALQDAEEREMAARLLALAGINEMYVGQ  213

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
            A   ED G NSQDAWE+VDPDELSYEEL+ALGEVVGTESRGLSADTIASLPS+NYK+Q  
Sbjct  214  AQDREDRGINSQDAWEDVDPDELSYEELIALGEVVGTESRGLSADTIASLPSVNYKAQTA  273

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
             +G  DSCVICRL+YEDG+ LTVLSCKHSYHSEC+NNWL+INKVCP+CS EVSTSGNS
Sbjct  274  SEGTTDSCVICRLEYEDGDQLTVLSCKHSYHSECLNNWLQINKVCPMCSTEVSTSGNS  331



>ref|XP_008243095.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Prunus mume]
Length=316

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 165/186 (89%), Gaps = 1/186 (1%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+ VD  DEDAFDVHAHD+A ED+N  +E DP+ F SDEAYARALQ+AE+REMAARL+A
Sbjct  132  DGTEVDN-DEDAFDVHAHDDAGEDDNPRVEYDPAVFSSDEAYARALQDAEDREMAARLMA  190

Query  511  lAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS  332
            LAGIN+ +    E+HG NSQD WEEVDPDELSYEEL+ALGEVVGTESRGLSADTIASLPS
Sbjct  191  LAGINDREVEHTEEHGGNSQDTWEEVDPDELSYEELIALGEVVGTESRGLSADTIASLPS  250

Query  331  MNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++YK+ + Q+G+N+SCVICRLDYE GE LT+LSCKHSYHSECINNWL INKVCPVCSAEV
Sbjct  251  VSYKTGSGQNGSNESCVICRLDYEAGENLTILSCKHSYHSECINNWLTINKVCPVCSAEV  310

Query  151  STSGNS  134
            STSGNS
Sbjct  311  STSGNS  316



>ref|XP_007202272.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica]
 gb|EMJ03471.1| hypothetical protein PRUPE_ppa008876mg [Prunus persica]
Length=316

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 164/186 (88%), Gaps = 1/186 (1%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+ VD  DEDAFDVH HD+A ED+N  +E DP+ F SDEAYARALQ+AE+REMAARL+A
Sbjct  132  DGTEVDN-DEDAFDVHGHDDAGEDDNPRVEYDPAVFSSDEAYARALQDAEDREMAARLMA  190

Query  511  lAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS  332
            LAGIN+ +    E+HG NSQD WEEVDPDELSYEEL+ALGEVVGTESRGLSADTIASLPS
Sbjct  191  LAGINDREVEHTEEHGGNSQDTWEEVDPDELSYEELIALGEVVGTESRGLSADTIASLPS  250

Query  331  MNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++YK+ + Q+G+N+SCVICRLDYE GE LT+LSCKHSYHSECINNWL INKVCPVCSAEV
Sbjct  251  VSYKTGSGQNGSNESCVICRLDYEAGENLTILSCKHSYHSECINNWLTINKVCPVCSAEV  310

Query  151  STSGNS  134
            STSGNS
Sbjct  311  STSGNS  316



>ref|XP_009366271.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Pyrus x bretschneideri]
Length=320

 Score =   242 bits (618),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 165/186 (89%), Gaps = 1/186 (1%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+ VD  DEDAF++HAHD+A ED+N  +E  P+ F SDEAYARALQ+AE+REMAARL+A
Sbjct  136  DGTEVDN-DEDAFNLHAHDDAGEDDNPIVEYGPAVFSSDEAYARALQDAEDREMAARLMA  194

Query  511  lAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS  332
            L+GIN+ +    E+H  NSQD WEE+DPDELSYEELLALGEVVGTESRGLSADTIASLPS
Sbjct  195  LSGINDREVEDTEEHHGNSQDTWEEIDPDELSYEELLALGEVVGTESRGLSADTIASLPS  254

Query  331  MNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++YK+ ++Q+G+N+SCVICRLD+EDGE LT+LSCKHSYHSECINNWL INKVCPVCSAEV
Sbjct  255  VSYKTGSSQNGSNESCVICRLDFEDGENLTILSCKHSYHSECINNWLTINKVCPVCSAEV  314

Query  151  STSGNS  134
            STSGNS
Sbjct  315  STSGNS  320



>ref|XP_008383690.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Malus domestica]
Length=315

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 164/186 (88%), Gaps = 1/186 (1%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+ VD  DEDAFD+HA D+A ED+N  +E  P+   SDEAYARALQ+AE+REMAARL+A
Sbjct  131  DGTEVDS-DEDAFDLHAXDDAGEDDNPSVEYGPAVXSSDEAYARALQDAEDREMAARLMA  189

Query  511  lAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS  332
            L+GIN+ +    E+HG NSQD WEE+DPDELSYEELLALGEVVGTE+RGLSADTIASLPS
Sbjct  190  LSGINDREVEDTEEHGGNSQDTWEEIDPDELSYEELLALGEVVGTENRGLSADTIASLPS  249

Query  331  MNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++YK+ ++Q+G+N+SCVICRLD+EDGE LT+LSCKHSYHSECINNWL INK+CPVCSAEV
Sbjct  250  VSYKTGSSQNGSNESCVICRLDFEDGENLTILSCKHSYHSECINNWLTINKICPVCSAEV  309

Query  151  STSGNS  134
            STSGNS
Sbjct  310  STSGNS  315



>ref|XP_004287200.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Fragaria 
vesca subsp. vesca]
Length=306

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+  D ++EDAFDVHAH++A +D N  +  DP+ F SDEAYARALQ+AE+R+MAARL+A
Sbjct  121  DGTDADNDEEDAFDVHAHEDAGDDHNPSVVYDPAVFSSDEAYARALQDAEDRDMAARLMA  180

Query  511  lAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS  332
             AGI++ +A   E+ G NSQDAWEEVDPDELSYEELLALGEVVGTESRGL ADTIASLPS
Sbjct  181  FAGIDDREAEDTENQGGNSQDAWEEVDPDELSYEELLALGEVVGTESRGLPADTIASLPS  240

Query  331  MNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++YK  N Q+G+N+SC ICRLDYEDGE LTVLSC HSYHSECINNWL INKVCPVC AEV
Sbjct  241  VSYKMGNGQNGSNESCAICRLDYEDGENLTVLSCTHSYHSECINNWLTINKVCPVCIAEV  300

Query  151  STSGNS  134
            STSGNS
Sbjct  301  STSGNS  306



>ref|XP_008394237.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Malus 
domestica]
Length=319

 Score =   239 bits (611),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  667  DEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQ  488
            DEDAFDVHAHD+A E++N  +E DP+ F SDEAYARALQ+AE+REMAARL+ALA IN+ +
Sbjct  142  DEDAFDVHAHDDAGENDNPSVEYDPAVFSSDEAYARALQDAEDREMAARLMALARINDRE  201

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
                E+HG NSQD W+EVDPDELSYEEL AL EVVGTESRGLSAD IASLPS++YK+ + 
Sbjct  202  VEDTEEHGGNSQDTWDEVDPDELSYEELJALAEVVGTESRGLSADNIASLPSVSYKTGSX  261

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            Q+G+N+SCVICRLDYEDGE LT+LSCKHSYHSECINNWL INKVCPVCSAEVSTSGNS
Sbjct  262  QNGSNESCVICRLDYEDGENLTLLSCKHSYHSECINNWLXINKVCPVCSAEVSTSGNS  319



>ref|XP_009366273.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Pyrus x bretschneideri]
Length=317

 Score =   239 bits (610),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 166/186 (89%), Gaps = 4/186 (2%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+ VD  DEDAF++HAHD+A ED+N  +E  P+ F SDEAYARALQ+AE+REMAARL+A
Sbjct  136  DGTEVDN-DEDAFNLHAHDDAGEDDNPIVEYGPAVFSSDEAYARALQDAEDREMAARLMA  194

Query  511  lAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS  332
            L+GIN+    +EE HG NSQD WEE+DPDELSYEELLALGEVVGTESRGLSADTIASLPS
Sbjct  195  LSGINDQD--TEEHHG-NSQDTWEEIDPDELSYEELLALGEVVGTESRGLSADTIASLPS  251

Query  331  MNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++YK+ ++Q+G+N+SCVICRLD+EDGE LT+LSCKHSYHSECINNWL INKVCPVCSAEV
Sbjct  252  VSYKTGSSQNGSNESCVICRLDFEDGENLTILSCKHSYHSECINNWLTINKVCPVCSAEV  311

Query  151  STSGNS  134
            STSGNS
Sbjct  312  STSGNS  317



>ref|XP_010655908.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Vitis vinifera]
 emb|CBI29028.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -2

Query  667  DEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQ  488
            DEDAFDVHA  +  ED+N  IE DP+ F SDEAYARALQ  EE+EMAARLLALAGI++  
Sbjct  133  DEDAFDVHAQADDGEDDNPTIEFDPAVFSSDEAYARALQHIEEQEMAARLLALAGIHDHG  192

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
                EDHG NSQD WEEVDPDELSYEELLALGEV+GTESRGLS+DTIASLPS+ YK+Q+ 
Sbjct  193  VEDTEDHGGNSQDTWEEVDPDELSYEELLALGEVIGTESRGLSSDTIASLPSVTYKAQSN  252

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            Q+G+NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWL+INKVCP+CS EVS+S
Sbjct  253  QEGSNDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLQINKVCPICSTEVSSS  307



>gb|KDP37529.1| hypothetical protein JCGZ_05968 [Jatropha curcas]
Length=314

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  661  DAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQAL  482
            DAFDVHAH +A  D N  ++LDP+ F SDEAYARALQ+AEEREMAARLLALAGINE +  
Sbjct  142  DAFDVHAHTDADVDNNPAVDLDPAMFSSDEAYARALQDAEEREMAARLLALAGINEREVE  201

Query  481  SEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQD  302
              ED G NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS+N+K+ ++Q+
Sbjct  202  DVEDLGANSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSVNFKAGSSQN  261

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            G+NDSCVICRLDY+DGETLTVLSCKHSYHSECIN+WL+INKVCPVCS EVS+S
Sbjct  262  GSNDSCVICRLDYDDGETLTVLSCKHSYHSECINDWLKINKVCPVCSKEVSSS  314



>ref|XP_010261280.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Nelumbo nucifera]
Length=278

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = -2

Query  667  DEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQ  488
            DEDAFDVHA  +A  D N   ELDPSAF SDEAYARALQEAE       L    GIN+ +
Sbjct  105  DEDAFDVHARVDAG-DNNQATELDPSAFDSDEAYARALQEAEMAVHLMALA---GINDWE  160

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
            A   EDHG NSQD WEEVDPDELSYEELLALGEVVGTESRGLSAD IASLPS++Y +Q+ 
Sbjct  161  AEDSEDHGSNSQDTWEEVDPDELSYEELLALGEVVGTESRGLSADMIASLPSVSYNAQSN  220

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            QDG+ D CVICRLDYEDGETLTVLSCKHSYHSECI NWL+INKVCPVCSAEVSTS
Sbjct  221  QDGSTDQCVICRLDYEDGETLTVLSCKHSYHSECITNWLQINKVCPVCSAEVSTS  275



>ref|XP_010655907.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Vitis vinifera]
Length=314

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 155/181 (86%), Gaps = 6/181 (3%)
 Frame = -2

Query  667  DEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQ  488
            DEDAFDVHA  +  ED+N  IE DP+ F SDEAYARALQ  EE+EMAARLLALAGI++ +
Sbjct  133  DEDAFDVHAQADDGEDDNPTIEFDPAVFSSDEAYARALQHIEEQEMAARLLALAGIHDRE  192

Query  487  ALSE------EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMN  326
             L        EDHG NSQD WEEVDPDELSYEELLALGEV+GTESRGLS+DTIASLPS+ 
Sbjct  193  CLFRNGVEDTEDHGGNSQDTWEEVDPDELSYEELLALGEVIGTESRGLSSDTIASLPSVT  252

Query  325  YKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            YK+Q+ Q+G+NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWL+INKVCP+CS EVS+
Sbjct  253  YKAQSNQEGSNDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLQINKVCPICSTEVSS  312

Query  145  S  143
            S
Sbjct  313  S  313



>ref|XP_008383698.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Malus domestica]
Length=312

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 163/186 (88%), Gaps = 4/186 (2%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+ VD  DEDAFD+HA D+A ED+N  +E  P+   SDEAYARALQ+AE+REMAARL+A
Sbjct  131  DGTEVDS-DEDAFDLHAXDDAGEDDNPSVEYGPAVXSSDEAYARALQDAEDREMAARLMA  189

Query  511  lAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS  332
            L+GIN+      E+HG NSQD WEE+DPDELSYEELLALGEVVGTE+RGLSADTIASLPS
Sbjct  190  LSGINDQDT---EEHGGNSQDTWEEIDPDELSYEELLALGEVVGTENRGLSADTIASLPS  246

Query  331  MNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++YK+ ++Q+G+N+SCVICRLD+EDGE LT+LSCKHSYHSECINNWL INK+CPVCSAEV
Sbjct  247  VSYKTGSSQNGSNESCVICRLDFEDGENLTILSCKHSYHSECINNWLTINKICPVCSAEV  306

Query  151  STSGNS  134
            STSGNS
Sbjct  307  STSGNS  312



>emb|CDP14406.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 159/178 (89%), Gaps = 3/178 (2%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE---GQ  488
            AFDV+A DE  ED++  +E+DPSA+ SDEAYARALQ+AEEREMAARLL++AGINE   G+
Sbjct  125  AFDVNAQDEEEEDDSQNVEIDPSAYSSDEAYARALQDAEEREMAARLLSMAGINEMVIGE  184

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
            A  EE+   NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLP+M+YKSQ T
Sbjct  185  ADDEEEDDGNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPAMSYKSQCT  244

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            + G+ DSCVICRLDYE+G+ LTVLSCKHSYH +CINNWL+INKVCPVCSAEVSTSGNS
Sbjct  245  EAGSTDSCVICRLDYEEGDRLTVLSCKHSYHPDCINNWLKINKVCPVCSAEVSTSGNS  302



>ref|XP_011070448.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Sesamum indicum]
Length=303

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 156/180 (87%), Gaps = 8/180 (4%)
 Frame = -2

Query  655  FDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSE  476
            FDVHAH E +ED     ELDPSAF SDEAYARALQ+AEEREMAARLLALAGIN G  + E
Sbjct  126  FDVHAHAEEAEDTQ-NAELDPSAFSSDEAYARALQDAEEREMAARLLALAGIN-GMVVGE  183

Query  475  EDHGQ------NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ  314
            ++  +      N QDAWEEVDPDELSYEELLALG+VVGTESRGLSADTIASLPS+NYKSQ
Sbjct  184  DEEEELDEHDGNPQDAWEEVDPDELSYEELLALGDVVGTESRGLSADTIASLPSINYKSQ  243

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
              Q+G+ND+CVICRLDYEDG+TLTVLSCKHSYHSECINNWL+INKVCPVCSAEVSTSG S
Sbjct  244  GIQEGSNDTCVICRLDYEDGDTLTVLSCKHSYHSECINNWLQINKVCPVCSAEVSTSGKS  303



>ref|XP_010112544.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
 gb|EXC33997.1| E3 ubiquitin ligase BIG BROTHER-related protein [Morus notabilis]
Length=342

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 160/200 (80%), Gaps = 20/200 (10%)
 Frame = -2

Query  673  EEDEDAFDVHA-HDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGIN  497
            E DEDAFD HA HD+  ED ++ +E DP+ F SDEAYARALQ+AEEREMAARLLALAGIN
Sbjct  143  ENDEDAFDAHAHHDDDGEDNSISVEYDPAVFSSDEAYARALQDAEEREMAARLLALAGIN  202

Query  496  ---EGQALSE----------------EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTE  374
               E  + SE                E+ G NSQDAWEEVDPDELSYEELLALGEVVGTE
Sbjct  203  DRLEIMSRSEILVIFVFLDEVEDSEPEESGDNSQDAWEEVDPDELSYEELLALGEVVGTE  262

Query  373  SRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNW  194
            SRGLSA  IASLPS+NYK+ ++Q G+NDSCVICRLDYEDGETLT+LSCKHSYH ECINNW
Sbjct  263  SRGLSASGIASLPSVNYKTGSSQSGSNDSCVICRLDYEDGETLTLLSCKHSYHPECINNW  322

Query  193  LRINKVCPVCSAEVSTSGNS  134
            L+INKVCPVCS EVSTSGNS
Sbjct  323  LKINKVCPVCSTEVSTSGNS  342



>ref|XP_002521533.1| ring finger protein, putative [Ricinus communis]
 gb|EEF40804.1| ring finger protein, putative [Ricinus communis]
Length=316

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 152/176 (86%), Gaps = 7/176 (4%)
 Frame = -2

Query  661  DAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQAL  482
            DAFDVH    A+ D      LDP  F SDEAYARALQ+AEEREMAARLLA AGIN+ Q  
Sbjct  148  DAFDVHESGGAAAD------LDPCMFSSDEAYARALQDAEEREMAARLLAFAGIND-QVE  200

Query  481  SEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQD  302
              +DHG NSQDAWEEVDPDELSYEEL+ALGEVVG+ESRGLSADTIASLP++NYK+ ++Q+
Sbjct  201  DTDDHGGNSQDAWEEVDPDELSYEELIALGEVVGSESRGLSADTIASLPTVNYKAGSSQN  260

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            G NDSCVICRLDYEDGETLT+LSCKHSYHSECINNWL+INKVCPVCS EVSTSG+S
Sbjct  261  GTNDSCVICRLDYEDGETLTLLSCKHSYHSECINNWLKINKVCPVCSTEVSTSGHS  316



>ref|XP_006437609.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
 ref|XP_006484518.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Citrus 
sinensis]
 gb|ESR50849.1| hypothetical protein CICLE_v10032094mg [Citrus clementina]
Length=328

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  646  HAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEEDH  467
            HAH+E  ED N  +E D   F SDEAYARALQ+AEER+MAARLLALA I++ +    EDH
Sbjct  158  HAHEEVEEDNNPSVEYDSDVFSSDEAYARALQDAEERDMAARLLALAEIHDREIEDPEDH  217

Query  466  GQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDS  287
            G +SQD WEEVDPDELSYEELLALGEVVG+ESRGLSADT+A+LP++NYK+  +Q+G+NDS
Sbjct  218  GGHSQDTWEEVDPDELSYEELLALGEVVGSESRGLSADTLATLPTVNYKAGTSQNGSNDS  277

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            CVICRLDYEDGETLTVLSCKHSYHSECINNWL+INKVCPVCSAEVSTSG+S
Sbjct  278  CVICRLDYEDGETLTVLSCKHSYHSECINNWLKINKVCPVCSAEVSTSGHS  328



>gb|KJB12378.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
Length=287

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 156/187 (83%), Gaps = 5/187 (3%)
 Frame = -2

Query  697  EEDGSHVDEEDEDAFDVHAHDEASEDEN-LGIELDPSAFPSDeayaralqeaeeremaar  521
            E DG+  D  D DAFD H H E  ED+N   +ELDP+ F SDEAYARALQ+AEERE+AAR
Sbjct  103  EYDGT--DAGDVDAFDFHDHSEDGEDDNDASVELDPADFSSDEAYARALQDAEEREVAAR  160

Query  520  llalAGINEGQALSEEDHGQ--NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTI  347
            LLALAGIN+G  ++ EDHG   NSQD WEEVDPDELSYEELLAL EV GTESRGLSAD+I
Sbjct  161  LLALAGINDGGTVTLEDHGHGGNSQDTWEEVDPDELSYEELLALAEVAGTESRGLSADSI  220

Query  346  ASLPSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPV  167
            ASLPS+ +K+ N+Q G NDSCVICR+DYEDG++LT LSCKHSYH ECINNWL+INKVCPV
Sbjct  221  ASLPSLIFKAGNSQTGTNDSCVICRVDYEDGDSLTALSCKHSYHPECINNWLKINKVCPV  280

Query  166  CSAEVST  146
            CSAEVST
Sbjct  281  CSAEVST  287



>gb|KHG29072.1| E3 ubiquitin ligase BIG BROTHER-related -like protein [Gossypium 
arboreum]
Length=243

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  625  EDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEEDHGQNSQDA  446
            ED N   ELDP+AF SDEA+ARALQ+AEEREMAARLLALAGIN+ +  + EDHG +SQD 
Sbjct  80   EDNNPSAELDPAAFSSDEAFARALQDAEEREMAARLLALAGINDREIFTLEDHGGHSQDT  139

Query  445  WEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLD  266
            WEEVDPDELSYEELLALGEVVGTESRGLSAD++ASLPS+ YK+ ++Q G+NDSCVICR+D
Sbjct  140  WEEVDPDELSYEELLALGEVVGTESRGLSADSLASLPSIKYKAGSSQTGSNDSCVICRVD  199

Query  265  YEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            Y+DG++LTVLSCKHSYH ECINNWL+INKVCPVCSAEVSTSG S
Sbjct  200  YDDGDSLTVLSCKHSYHPECINNWLKINKVCPVCSAEVSTSGQS  243



>gb|KJB31860.1| hypothetical protein B456_005G211500 [Gossypium raimondii]
Length=297

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = -2

Query  649  VHAHDE-ASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEE  473
            VHAH E   ED N   ELDP+AF SDEA+ARALQ+AEEREMAARLLALAGIN+    + E
Sbjct  125  VHAHAEDGDEDNNPSAELDPAAFSSDEAFARALQDAEEREMAARLLALAGINDRGIFTLE  184

Query  472  DHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAN  293
            DHG +SQD WEEVDPDELSYEELLALGEVVGTESRGLSAD++ASLPS+ YK+ ++Q G+N
Sbjct  185  DHGGHSQDTWEEVDPDELSYEELLALGEVVGTESRGLSADSLASLPSIKYKAGSSQTGSN  244

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            DSCVICR+DY+DG++LTVLSCKHSYH ECINNWL+INKVCPVCS EVSTSG S
Sbjct  245  DSCVICRVDYDDGDSLTVLSCKHSYHPECINNWLKINKVCPVCSVEVSTSGQS  297



>gb|KJB31859.1| hypothetical protein B456_005G211500 [Gossypium raimondii]
Length=332

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = -2

Query  649  VHAHDE-ASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEE  473
            VHAH E   ED N   ELDP+AF SDEA+ARALQ+AEEREMAARLLALAGIN+    + E
Sbjct  160  VHAHAEDGDEDNNPSAELDPAAFSSDEAFARALQDAEEREMAARLLALAGINDRGIFTLE  219

Query  472  DHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAN  293
            DHG +SQD WEEVDPDELSYEELLALGEVVGTESRGLSAD++ASLPS+ YK+ ++Q G+N
Sbjct  220  DHGGHSQDTWEEVDPDELSYEELLALGEVVGTESRGLSADSLASLPSIKYKAGSSQTGSN  279

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            DSCVICR+DY+DG++LTVLSCKHSYH ECINNWL+INKVCPVCS EVSTSG S
Sbjct  280  DSCVICRVDYDDGDSLTVLSCKHSYHPECINNWLKINKVCPVCSVEVSTSGQS  332



>gb|KDO52706.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=328

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  646  HAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEEDH  467
            HAH+E  ED N  +E D   F SDEAYARALQ+AEER+MAARLLALA I++ +    EDH
Sbjct  158  HAHEEVEEDNNPSVEYDSDVFSSDEAYARALQDAEERDMAARLLALAEIHDREIEDPEDH  217

Query  466  GQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDS  287
            G +SQD WEEVDPDELSYEELLALGEVVG+ESRGLSADT+A+LP++NYK   +Q+G+NDS
Sbjct  218  GGHSQDTWEEVDPDELSYEELLALGEVVGSESRGLSADTLATLPTVNYKGGTSQNGSNDS  277

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            CVICRLDYEDGETLTVLSCKHSYHSECINNWL+INKVCPVCSAEVSTSG+S
Sbjct  278  CVICRLDYEDGETLTVLSCKHSYHSECINNWLKINKVCPVCSAEVSTSGHS  328



>ref|XP_008445883.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Cucumis melo]
Length=328

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 160/188 (85%), Gaps = 1/188 (1%)
 Frame = -2

Query  697  EEDGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarl  518
            E DG+ V++ED D FDVHAH++  E  N   ELDP  F SDEAYARALQ+AE+REMAARL
Sbjct  141  EFDGTDVNDED-DVFDVHAHEDGGEHNNSNFELDPGNFSSDEAYARALQDAEDREMAARL  199

Query  517  lalAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASL  338
            LALAG+ +  A   +D G+NSQD WE+VDPDELSYEELLALGEVVGTESRGLSADTIASL
Sbjct  200  LALAGLQDHDADDTDDQGENSQDTWEDVDPDELSYEELLALGEVVGTESRGLSADTIASL  259

Query  337  PSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSA  158
            PS+N+K+ + Q G+NDSCVICRLD+EDGETLTVLSCKHSYHS+CI NWL+INKVCPVCSA
Sbjct  260  PSINFKAGSDQTGSNDSCVICRLDFEDGETLTVLSCKHSYHSDCITNWLKINKVCPVCSA  319

Query  157  EVSTSGNS  134
            EVST+  S
Sbjct  320  EVSTATGS  327



>ref|XP_007142774.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris]
 gb|AGV54364.1| RING-finger protein [Phaseolus vulgaris]
 gb|ESW14768.1| hypothetical protein PHAVU_007G015800g [Phaseolus vulgaris]
Length=347

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALS  479
            AFDVHAH  A E +N  IE DP  F SDEAYARALQEAEEREMAARLLALAGIN+ +A  
Sbjct  172  AFDVHAHASAGEHDNPSIEFDPDVFSSDEAYARALQEAEEREMAARLLALAGINDREAED  231

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
             E+HG NSQDAWE+VDPDELSYEELLALGEVVGTESRGLS DTIA LPS+NYK  + Q G
Sbjct  232  IEEHGANSQDAWEDVDPDELSYEELLALGEVVGTESRGLSTDTIACLPSLNYKIGSDQHG  291

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            +NDSCVICR+D+EDGE+LT LSCKH YH ECINNWL+INKVCPVCS EVS SG
Sbjct  292  SNDSCVICRVDFEDGESLTHLSCKHLYHPECINNWLKINKVCPVCSTEVSASG  344



>gb|EYU20483.1| hypothetical protein MIMGU_mgv1a013375mg [Erythranthe guttata]
Length=222

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 155/188 (82%), Gaps = 6/188 (3%)
 Frame = -2

Query  691  DGS--HVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarl  518
            DGS   VD+E EDAFDVHA     E ++   E+DPSAF SDEAYARALQ+AEEREMAARL
Sbjct  39   DGSDVEVDDEAEDAFDVHARAAGLESDSQNDEVDPSAFSSDEAYARALQDAEEREMAARL  98

Query  517  lalAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASL  338
            LALAGIN+    +EE+HG N+QDAWEEVDPDELSYEEL+ALG+V+GTESRGLSAD IASL
Sbjct  99   LALAGIND----NEEEHGSNAQDAWEEVDPDELSYEELIALGDVIGTESRGLSADAIASL  154

Query  337  PSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSA  158
            PS+NY S+ T +G  DSCVICRLDYED + LTVLSCKH YH ECI+NWL INKVCPVCSA
Sbjct  155  PSVNYNSKGTHEGNGDSCVICRLDYEDDDNLTVLSCKHLYHPECISNWLNINKVCPVCSA  214

Query  157  EVSTSGNS  134
            EVS  G S
Sbjct  215  EVSIPGKS  222



>ref|XP_004497227.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Cicer arietinum]
Length=336

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALS  479
            AFDVHAH  A E +N  IE DP  F SDEAYARALQEAEEREMAARLLALAGIN+ +   
Sbjct  160  AFDVHAHASAGEHDNPIIEFDPELFSSDEAYARALQEAEEREMAARLLALAGINDQETED  219

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
             E+HG NSQDAWE+VDPDELSYEELLALGEVVGTESRGLS DTIA LPS+NYK+ + Q G
Sbjct  220  MEEHGANSQDAWEDVDPDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKTGSDQHG  279

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            +NDSCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EVS S  S
Sbjct  280  SNDSCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASSGS  334



>gb|KHN23096.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=335

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALS  479
            AFDVHAH  A E +N  IE DP  F SDEAYARALQEAEEREMAARLLA AGIN+ +   
Sbjct  160  AFDVHAHASAGEHDNPTIEFDPDVFSSDEAYARALQEAEEREMAARLLAFAGINDREEED  219

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
             E+HG NSQDAWE+VDPDELSYEELLALGE VGTESRGLS DTIA LPS+NYK+ + Q G
Sbjct  220  IEEHGANSQDAWEDVDPDELSYEELLALGEAVGTESRGLSTDTIACLPSVNYKTGSDQHG  279

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            +NDSCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EVS SG
Sbjct  280  SNDSCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASG  332



>ref|XP_004143619.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis 
sativus]
 ref|XP_004165268.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis 
sativus]
 gb|KGN50445.1| hypothetical protein Csa_5G175690 [Cucumis sativus]
Length=323

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  670  EDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEG  491
            +DED FDVHAH++  E  N   ELDP  F SDEAYARALQ+AE+REMAARLLALA + + 
Sbjct  144  DDEDVFDVHAHEDGGEHNNSNFELDPGNFSSDEAYARALQDAEDREMAARLLALARLQDQ  203

Query  490  QALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN  311
             A   +D G+NSQD WE+VDPDELSYEELLALGEVVGTESRGLSADTIASLPS+N+K+ +
Sbjct  204  DADDTDDQGENSQDTWEDVDPDELSYEELLALGEVVGTESRGLSADTIASLPSINFKAGS  263

Query  310  TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
             Q G+NDSCVICRLD+EDGETLTVLSCKHSYHS+C+ NWL+INK+CPVCSAEVST+  S
Sbjct  264  DQTGSNDSCVICRLDFEDGETLTVLSCKHSYHSDCVTNWLKINKICPVCSAEVSTATGS  322



>ref|XP_003555845.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
1 [Glycine max]
Length=335

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALS  479
            AFDVHAH  A E +N  IE DP  F SDEAYARALQEAEEREMAARLLA AGIN+ +   
Sbjct  160  AFDVHAHASAGEHDNPTIEFDPDVFSSDEAYARALQEAEEREMAARLLAFAGINDREEED  219

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
             E+HG NSQDAWE+VDPDELSYEELLALGE VGTESRGLS DTIA LPS+NYK+ + Q G
Sbjct  220  IEEHGANSQDAWEDVDPDELSYEELLALGEAVGTESRGLSTDTIACLPSVNYKTGSDQHG  279

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            +NDSCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EVS SG
Sbjct  280  SNDSCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASG  332



>ref|XP_002310069.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE90519.1| zinc finger family protein [Populus trichocarpa]
Length=320

 Score =   221 bits (563),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 157/179 (88%), Gaps = 2/179 (1%)
 Frame = -2

Query  667  DEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGIN-EG  491
            D DA DVHAH + + D+N  +E+DPS + SDEAYARALQEAEER++AARLLALA +N + 
Sbjct  143  DGDAIDVHAHAD-NRDDNTEVEIDPSVYSSDEAYARALQEAEERDIAARLLALASLNGDA  201

Query  490  QALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN  311
            +  SEED G NSQ+ WEEVDPDELSYEELLALGEVVGTESRGLSAD IASLPS+NYK+ +
Sbjct  202  EEDSEEDLGDNSQETWEEVDPDELSYEELLALGEVVGTESRGLSADIIASLPSINYKAGS  261

Query  310  TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            +Q+G+NDSCVICRLDYEDGETLT+LSCKHSYHSECINNWL+INKVCP CS EVST+ +S
Sbjct  262  SQNGSNDSCVICRLDYEDGETLTLLSCKHSYHSECINNWLKINKVCPFCSTEVSTAAHS  320



>gb|KJB31861.1| hypothetical protein B456_005G211500 [Gossypium raimondii]
Length=326

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 150/173 (87%), Gaps = 7/173 (4%)
 Frame = -2

Query  649  VHAHDE-ASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEE  473
            VHAH E   ED N   ELDP+AF SDEA+ARALQ+AEEREMAARLLALAGIN+      +
Sbjct  160  VHAHAEDGDEDNNPSAELDPAAFSSDEAFARALQDAEEREMAARLLALAGIND------K  213

Query  472  DHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAN  293
            DHG +SQD WEEVDPDELSYEELLALGEVVGTESRGLSAD++ASLPS+ YK+ ++Q G+N
Sbjct  214  DHGGHSQDTWEEVDPDELSYEELLALGEVVGTESRGLSADSLASLPSIKYKAGSSQTGSN  273

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            DSCVICR+DY+DG++LTVLSCKHSYH ECINNWL+INKVCPVCS EVSTSG S
Sbjct  274  DSCVICRVDYDDGDSLTVLSCKHSYHPECINNWLKINKVCPVCSVEVSTSGQS  326



>ref|XP_003536731.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform 1 
[Glycine max]
Length=344

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALS  479
            AFD HAH  A E +N  IE DP  F SDEAYARALQEAEEREMA RLLALAGIN+ +   
Sbjct  169  AFDAHAHASAGEHDNPSIEFDPDLFSSDEAYARALQEAEEREMAVRLLALAGINDREEED  228

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
             E+HG NSQDAWE+VDPDELSYEELLAL EVVGTESRGLS DTIA LPS+NYK+ + Q G
Sbjct  229  IEEHGANSQDAWEDVDPDELSYEELLALSEVVGTESRGLSTDTIACLPSVNYKTGSDQHG  288

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            ++DSCVICR+DYEDGE+LTVLSCKH YH ECINNWL+INKVCPVCS EVS SG
Sbjct  289  SHDSCVICRVDYEDGESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASG  341



>emb|CAC10211.1| E3 ubiquitin ligase BIG BROTHER-related protein, partial [Cicer 
arietinum]
Length=233

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 150/181 (83%), Gaps = 6/181 (3%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE-GQAL  482
            AFDVHAH  A E +N  IE DP  F SDEAYARALQEAEEREMAARLLALAGIN+   ++
Sbjct  51   AFDVHAHASAGEHDNPIIEFDPELFSSDEAYARALQEAEEREMAARLLALAGINDLSFSI  110

Query  481  SEE-----DHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKS  317
            +EE     +HG NSQDAWE+VDPDELSYEELLALGEVVGTESRGLS DTIA LPS+NYK+
Sbjct  111  TEETEDMEEHGANSQDAWEDVDPDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKT  170

Query  316  QNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
             + Q G+NDSCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EVS S  
Sbjct  171  GSDQHGSNDSCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASSG  230

Query  136  S  134
            S
Sbjct  231  S  231



>gb|KDO52705.1| hypothetical protein CISIN_1g019980mg [Citrus sinensis]
Length=333

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 5/176 (3%)
 Frame = -2

Query  646  HAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEEDH  467
            HAH+E  ED N  +E D   F SDEAYARALQ+AEER+MAARLLALA I++ +    EDH
Sbjct  158  HAHEEVEEDNNPSVEYDSDVFSSDEAYARALQDAEERDMAARLLALAEIHDREIEDPEDH  217

Query  466  GQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDS  287
            G +SQD WEEVDPDELSYEELLALGEVVG+ESRGLSADT+A+LP++NYK   +Q+G+NDS
Sbjct  218  GGHSQDTWEEVDPDELSYEELLALGEVVGSESRGLSADTLATLPTVNYKGGTSQNGSNDS  277

Query  286  C-----VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            C     VICRLDYEDGETLTVLSCKHSYHSECINNWL+INKVCPVCSAEVSTSG+S
Sbjct  278  CLGFSCVICRLDYEDGETLTVLSCKHSYHSECINNWLKINKVCPVCSAEVSTSGHS  333



>ref|XP_003555846.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
2 [Glycine max]
Length=341

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 146/179 (82%), Gaps = 6/179 (3%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE-----  494
            AFDVHAH  A E +N  IE DP  F SDEAYARALQEAEEREMAARLLA AGIN+     
Sbjct  160  AFDVHAHASAGEHDNPTIEFDPDVFSSDEAYARALQEAEEREMAARLLAFAGINDLSFSI  219

Query  493  -GQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKS  317
             G+    E+HG NSQDAWE+VDPDELSYEELLALGE VGTESRGLS DTIA LPS+NYK+
Sbjct  220  SGEEEDIEEHGANSQDAWEDVDPDELSYEELLALGEAVGTESRGLSTDTIACLPSVNYKT  279

Query  316  QNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
             + Q G+NDSCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EVS SG
Sbjct  280  GSDQHGSNDSCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASG  338



>ref|XP_011002254.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X3 
[Populus euphratica]
Length=326

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGIN-EGQAL  482
            AFDVHAH + + D+N  +E+DPS + SDEAYARALQEAEER++AARLLALA +N + +  
Sbjct  152  AFDVHAHAD-NRDDNTEVEIDPSVYSSDEAYARALQEAEERDIAARLLALASLNGDAEED  210

Query  481  SEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQD  302
            SEED G NSQ+ WEEVDPDELSYEELLALGEVVG ESRGLSAD IASL S+NYK+ ++Q+
Sbjct  211  SEEDLGNNSQETWEEVDPDELSYEELLALGEVVGIESRGLSADIIASLASINYKAGSSQN  270

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            G+ND+CVICRLDYEDGETLT+LSCKHSYHSECINNWL+INKVCPVCS EVST+ +S
Sbjct  271  GSNDTCVICRLDYEDGETLTLLSCKHSYHSECINNWLKINKVCPVCSTEVSTAAHS  326



>ref|XP_011002253.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Populus euphratica]
Length=327

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 155/177 (88%), Gaps = 3/177 (2%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGIN--EGQA  485
            AFDVHAH + + D+N  +E+DPS + SDEAYARALQEAEER++AARLLALA +N  + + 
Sbjct  152  AFDVHAHAD-NRDDNTEVEIDPSVYSSDEAYARALQEAEERDIAARLLALASLNGRDAEE  210

Query  484  LSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQ  305
             SEED G NSQ+ WEEVDPDELSYEELLALGEVVG ESRGLSAD IASL S+NYK+ ++Q
Sbjct  211  DSEEDLGNNSQETWEEVDPDELSYEELLALGEVVGIESRGLSADIIASLASINYKAGSSQ  270

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            +G+ND+CVICRLDYEDGETLT+LSCKHSYHSECINNWL+INKVCPVCS EVST+ +S
Sbjct  271  NGSNDTCVICRLDYEDGETLTLLSCKHSYHSECINNWLKINKVCPVCSTEVSTAAHS  327



>ref|XP_004497226.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Cicer arietinum]
Length=342

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 150/181 (83%), Gaps = 6/181 (3%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE-GQAL  482
            AFDVHAH  A E +N  IE DP  F SDEAYARALQEAEEREMAARLLALAGIN+   ++
Sbjct  160  AFDVHAHASAGEHDNPIIEFDPELFSSDEAYARALQEAEEREMAARLLALAGINDLSFSI  219

Query  481  SEE-----DHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKS  317
            +EE     +HG NSQDAWE+VDPDELSYEELLALGEVVGTESRGLS DTIA LPS+NYK+
Sbjct  220  TEETEDMEEHGANSQDAWEDVDPDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKT  279

Query  316  QNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
             + Q G+NDSCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EVS S  
Sbjct  280  GSDQHGSNDSCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASSG  339

Query  136  S  134
            S
Sbjct  340  S  340



>ref|XP_011002252.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Populus euphratica]
Length=329

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 155/179 (87%), Gaps = 5/179 (3%)
 Frame = -2

Query  658  AFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGIN----EG  491
            AFDVHAH + + D+N  +E+DPS + SDEAYARALQEAEER++AARLLALA +N    + 
Sbjct  152  AFDVHAHAD-NRDDNTEVEIDPSVYSSDEAYARALQEAEERDIAARLLALASLNGITGDA  210

Query  490  QALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN  311
            +  SEED G NSQ+ WEEVDPDELSYEELLALGEVVG ESRGLSAD IASL S+NYK+ +
Sbjct  211  EEDSEEDLGNNSQETWEEVDPDELSYEELLALGEVVGIESRGLSADIIASLASINYKAGS  270

Query  310  TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            +Q+G+ND+CVICRLDYEDGETLT+LSCKHSYHSECINNWL+INKVCPVCS EVST+ +S
Sbjct  271  SQNGSNDTCVICRLDYEDGETLTLLSCKHSYHSECINNWLKINKVCPVCSTEVSTAAHS  329



>ref|XP_007043263.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOX99094.1| RING/U-box superfamily protein [Theobroma cacao]
Length=392

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = -2

Query  646  HAHDE-ASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEED  470
            HAH E   ED N  +E +P+ F SDEAYARALQ+AEEREMAARLLALAG+N+   ++ ED
Sbjct  223  HAHAENGEEDYNPNVEFNPAVFSSDEAYARALQDAEEREMAARLLALAGLNDRGIVTLED  282

Query  469  HGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAND  290
            HG NSQD WEEVDPDELSYEELLALGEVVGTESRGLSAD+IASLPS+ YK+ ++Q G+ND
Sbjct  283  HGGNSQDTWEEVDPDELSYEELLALGEVVGTESRGLSADSIASLPSVTYKAGSSQTGSND  342

Query  289  SCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            SCV+CR+DYEDG++LTVLSCKHSYH ECINNWL+INKVCPVCSAEVSTSG
Sbjct  343  SCVVCRVDYEDGDSLTVLSCKHSYHPECINNWLKINKVCPVCSAEVSTSG  392



>ref|XP_010688665.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=333

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -2

Query  649  VHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEED  470
            +HAH+++ +D+   +ELDPSAFP DEAYARALQ+AEEREMAARLLA+AGI E + +  ED
Sbjct  162  IHAHEDSGDDDAPEVELDPSAFPDDEAYARALQDAEEREMAARLLAIAGITEREIVDVED  221

Query  469  HGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAND  290
             G NSQD WE+VDPDELSYEEL+ALGEVVGTESRGLSADTIASLPS NY S + ++   D
Sbjct  222  QGNNSQDTWEDVDPDELSYEELIALGEVVGTESRGLSADTIASLPSTNYISPDNKETEAD  281

Query  289  SCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            +CVICRLDYEDG+ LT L CKH+YHS+CINNWL I K CPVCS EVSTSGNS
Sbjct  282  TCVICRLDYEDGDALTTLPCKHAYHSDCINNWLEIKKACPVCSTEVSTSGNS  333



>ref|XP_008383707.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X3 [Malus domestica]
Length=302

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+ VD  DEDAFD+HA D+A ED+N  +E  P+   SDEAYARALQ+AE+REMAARL+A
Sbjct  131  DGTEVDS-DEDAFDLHAXDDAGEDDNPSVEYGPAVXSSDEAYARALQDAEDREMAARLMA  189

Query  511  lAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS  332
            L+GIN+ +    E+HG NSQD WEE+DPDELSYEELLALGEVVGTE+RGLSADTIASLPS
Sbjct  190  LSGINDREVEDTEEHGGNSQDTWEEIDPDELSYEELLALGEVVGTENRGLSADTIASLPS  249

Query  331  MNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVC  173
            ++YK+ ++Q+G+N+SCVICRLD+EDGE LT+LSCKHSYHSECINNWL INK C
Sbjct  250  VSYKTGSSQNGSNESCVICRLDFEDGENLTILSCKHSYHSECINNWLTINKPC  302



>ref|XP_010688664.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=336

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 3/175 (2%)
 Frame = -2

Query  649  VHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEED  470
            +HAH+++ +D+   +ELDPSAFP DEAYARALQ+AEEREMAARLLA+AGI E + +  ED
Sbjct  162  IHAHEDSGDDDAPEVELDPSAFPDDEAYARALQDAEEREMAARLLAIAGITEREIVDVED  221

Query  469  HGQNSQ---DAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
             G NSQ   D WE+VDPDELSYEEL+ALGEVVGTESRGLSADTIASLPS NY S + ++ 
Sbjct  222  QGNNSQVSQDTWEDVDPDELSYEELIALGEVVGTESRGLSADTIASLPSTNYISPDNKET  281

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
              D+CVICRLDYEDG+ LT L CKH+YHS+CINNWL I K CPVCS EVSTSGNS
Sbjct  282  EADTCVICRLDYEDGDALTTLPCKHAYHSDCINNWLEIKKACPVCSTEVSTSGNS  336



>gb|EYU35575.1| hypothetical protein MIMGU_mgv1a010240mg [Erythranthe guttata]
Length=318

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 154/206 (75%), Gaps = 20/206 (10%)
 Frame = -2

Query  691  DGS--HVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarl  518
            DGS   VD+E EDAFDVHA     E ++   E+DPSAF SDEAYARALQ+AEEREMAARL
Sbjct  113  DGSDVEVDDEAEDAFDVHARAGGVESDSQNDEVDPSAFSSDEAYARALQDAEEREMAARL  172

Query  517  lalAGINE------------------GQALSEEDHGQNSQDAWEEVDPDELSYEELLALG  392
            LALAGIN+                       EE+HG N+QDAWEEVDPDELSYEEL+ALG
Sbjct  173  LALAGINDMVVGEDDEEEDDDDDDDGEYDEDEEEHGSNAQDAWEEVDPDELSYEELIALG  232

Query  391  EVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHS  212
            +V+GTESRGLSAD IASLPS+NY S+ T +G  DSCVICRLDYED + LTVLSCKH YH 
Sbjct  233  DVIGTESRGLSADAIASLPSVNYNSKGTHEGNGDSCVICRLDYEDDDNLTVLSCKHLYHP  292

Query  211  ECINNWLRINKVCPVCSAEVSTSGNS  134
            ECI+NWL INKVCPVCSAEVS  G S
Sbjct  293  ECISNWLNINKVCPVCSAEVSIPGKS  318



>gb|KHG07975.1| E3 ubiquitin ligase BIG BROTHER-related -like protein [Gossypium 
arboreum]
Length=193

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  505  GINEGQALSEEDHGQ--NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS  332
            GIN+   ++ EDHG   NSQD WEEVDPDELSYEELLAL EVVGTESRGLSAD+IASLPS
Sbjct  72   GINDRGTVTLEDHGHGGNSQDTWEEVDPDELSYEELLALAEVVGTESRGLSADSIASLPS  131

Query  331  MNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            + YK+ N+Q G NDSCVICR+DYEDG++LT LSCKHSYH ECINNWL+INKVCPVCSAEV
Sbjct  132  LIYKAGNSQTGTNDSCVICRVDYEDGDSLTALSCKHSYHPECINNWLKINKVCPVCSAEV  191

Query  151  ST  146
            ST
Sbjct  192  ST  193



>ref|XP_003592713.1| RING finger protein [Medicago truncatula]
 gb|AES62964.1| RING-finger ubiquitin ligase [Medicago truncatula]
Length=333

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 141/170 (83%), Gaps = 3/170 (2%)
 Frame = -2

Query  640  HDEAS---EDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEED  470
            HD AS    + N  IE DP  F SDEAYARALQEAEEREMAARLLALAGI++  A   E+
Sbjct  161  HDHASVGDRENNPVIEFDPELFSSDEAYARALQEAEEREMAARLLALAGIHDQDAEDMEE  220

Query  469  HGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAND  290
            H  NSQDAWE+VDPDELSYEELLALGEVVGTESRGLS DTIA LPS+NYK+ + Q G+ND
Sbjct  221  HAANSQDAWEDVDPDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKAGSDQLGSND  280

Query  289  SCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            SCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EVS SG
Sbjct  281  SCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASG  330



>ref|XP_011022026.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Populus euphratica]
Length=309

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 150/173 (87%), Gaps = 2/173 (1%)
 Frame = -2

Query  646  HAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEEDH  467
            HAH +A + ++   E+DPS + SDEAYARALQEAEERE+AARLLALAG+N+ +   + + 
Sbjct  137  HAHADAGDHDSTEGEIDPSVYSSDEAYARALQEAEEREVAARLLALAGLNDRETEEDTEE  196

Query  466  GQ--NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAN  293
             +  NSQD WEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS+NYK+ + Q+G+N
Sbjct  197  DREDNSQDTWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSINYKTGSNQNGSN  256

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            DSCVICRLDYEDGETLT+LSCKHSYHS+CINNWL+INK CP+CS EVSTS +S
Sbjct  257  DSCVICRLDYEDGETLTLLSCKHSYHSDCINNWLKINKACPLCSTEVSTSAHS  309



>ref|XP_006382946.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
 gb|ERP60743.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
Length=316

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  460  NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCV  281
            NSQD WEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS+NYK+ ++Q+G+NDSCV
Sbjct  208  NSQDTWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSINYKTGSSQNGSNDSCV  267

Query  280  ICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            ICRLDYEDGETLT+LSCKHSYHSECINNWL+INK CPVC+ EVSTS +S
Sbjct  268  ICRLDYEDGETLTLLSCKHSYHSECINNWLKINKACPVCNTEVSTSAHS  316



>ref|XP_006382945.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
 gb|ERP60742.1| hypothetical protein POPTR_0005s09300g [Populus trichocarpa]
Length=314

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = -2

Query  460  NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCV  281
            NSQD WEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS+NYK+ ++Q+G+NDSCV
Sbjct  206  NSQDTWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSINYKTGSSQNGSNDSCV  265

Query  280  ICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            ICRLDYEDGETLT+LSCKHSYHSECINNWL+INK CPVC+ EVSTS +S
Sbjct  266  ICRLDYEDGETLTLLSCKHSYHSECINNWLKINKACPVCNTEVSTSAHS  314



>ref|XP_011022025.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Populus euphratica]
Length=311

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 151/175 (86%), Gaps = 4/175 (2%)
 Frame = -2

Query  646  HAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE----GQALS  479
            HAH +A + ++   E+DPS + SDEAYARALQEAEERE+AARLLALAG+N+     +  +
Sbjct  137  HAHADAGDHDSTEGEIDPSVYSSDEAYARALQEAEEREVAARLLALAGLNDITGETEEDT  196

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
            EED   NSQD WEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPS+NYK+ + Q+G
Sbjct  197  EEDREDNSQDTWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSINYKTGSNQNG  256

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            +NDSCVICRLDYEDGETLT+LSCKHSYHS+CINNWL+INK CP+CS EVSTS +S
Sbjct  257  SNDSCVICRLDYEDGETLTLLSCKHSYHSDCINNWLKINKACPLCSTEVSTSAHS  311



>gb|ACJ86011.1| unknown [Medicago truncatula]
Length=332

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 140/171 (82%), Gaps = 3/171 (2%)
 Frame = -2

Query  643  AHDEAS---EDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEE  473
             HD AS    + N  IE DP  F SDEAYARALQEAEEREMAARLLALAGI++  A   E
Sbjct  159  VHDHASVGDRENNPVIEFDPELFSSDEAYARALQEAEEREMAARLLALAGIHDQDAEDME  218

Query  472  DHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAN  293
            +H  NSQDAWE+VDPDELSYEELLALGEVVGTESRGLS DTIA LPS+NYK+ + Q G+N
Sbjct  219  EHAANSQDAWEDVDPDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKAGSDQLGSN  278

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            DSCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EV  SG
Sbjct  279  DSCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVFASG  329



>ref|XP_006851962.1| hypothetical protein AMTR_s00041p00192380 [Amborella trichopoda]
 gb|ERN13429.1| hypothetical protein AMTR_s00041p00192380 [Amborella trichopoda]
Length=279

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 153/197 (78%), Gaps = 15/197 (8%)
 Frame = -2

Query  697  EEDGSHVDE-------EDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaee  539
            EEDG  +DE       +DEDAFDV A  +A+++EN   E+DPSAF SDEAYARALQ+ EE
Sbjct  83   EEDGDDLDENGGNERDDDEDAFDVIARADAADEEN---EIDPSAFDSDEAYARALQDVEE  139

Query  538  remaarllalAGINEGQA----LSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTES  371
            REMA  L+AL GIN G A      EE+   NSQD W+EVDPD+LSYEEL+ALGEVVGTE+
Sbjct  140  REMAIHLMALTGIN-GWAGEEEDHEEEEDSNSQDTWQEVDPDDLSYEELIALGEVVGTET  198

Query  370  RGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWL  191
            RGLSAD IASLPS  YK+Q+T +GA + CVICR+DYE+G+ LT L CKH YHSECINNWL
Sbjct  199  RGLSADMIASLPSSKYKAQSTAEGAIEQCVICRVDYEEGDDLTDLLCKHRYHSECINNWL  258

Query  190  RINKVCPVCSAEVSTSG  140
            +INKVCP+CS EVSTS 
Sbjct  259  KINKVCPLCSTEVSTSA  275



>ref|XP_010932524.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Elaeis 
guineensis]
Length=285

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 143/176 (81%), Gaps = 11/176 (6%)
 Frame = -2

Query  664  EDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQA  485
            EDAFD  A+D +         +DP+ F SDEA+ARALQ+AEE E+A RL+ALAG+N+   
Sbjct  118  EDAFD--ANDRS---------VDPAEFESDEAFARALQDAEEAEVAVRLMALAGLNDWGI  166

Query  484  LSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQ  305
                DHG +SQDAWEEVDPD+ SYEEL+ALGEVVGTE+RGLSADTIASLPS+NY++ + Q
Sbjct  167  EDHGDHGSHSQDAWEEVDPDDYSYEELVALGEVVGTENRGLSADTIASLPSVNYEAGSAQ  226

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            DG  D CVICRL+YEDGE+L +LSCKH+YHSECIN WL+INKVCPVCS EVSTSGN
Sbjct  227  DGNTDQCVICRLEYEDGESLVMLSCKHTYHSECINKWLQINKVCPVCSTEVSTSGN  282



>ref|XP_008789253.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Phoenix dactylifera]
Length=285

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 140/176 (80%), Gaps = 11/176 (6%)
 Frame = -2

Query  664  EDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQA  485
            EDAFD  A+D +         +DP+ F SDEA+ARALQ AEE E+A RL+AL+G+N+   
Sbjct  118  EDAFD--ANDRS---------VDPAEFESDEAFARALQNAEEAEVAVRLMALSGLNDWAV  166

Query  484  LSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQ  305
               EDH  +SQDAWEEVDPD+ SYEEL+ALGEVVGTE+RGLSADTIASLPS+NYK+ + Q
Sbjct  167  EDHEDHDSHSQDAWEEVDPDDYSYEELVALGEVVGTENRGLSADTIASLPSVNYKAGSAQ  226

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            DG  D CVICRL+YEDGE+L +LSCKH+YHSECIN WL INKVCPVCS EVSTSG 
Sbjct  227  DGNTDQCVICRLEYEDGESLVMLSCKHTYHSECINKWLLINKVCPVCSTEVSTSGT  282



>ref|XP_009395387.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 140/175 (80%), Gaps = 11/175 (6%)
 Frame = -2

Query  667  DEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQ  488
            DEDAFD +  D            DP+ F  DEA+ARALQ+AEERE+A RL+AL G+NE  
Sbjct  131  DEDAFDANDSD-----------ADPAEFEDDEAFARALQDAEEREVAVRLMALTGLNEWA  179

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
            +    DHG NSQD W+EVDPDE SYEEL+ALGEVVGTESRGLSADTIA+LPS++YK++N 
Sbjct  180  SDDHGDHGSNSQDTWQEVDPDEYSYEELVALGEVVGTESRGLSADTIAALPSVSYKAENA  239

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            QDG+ + CVICRL+YE+G++L +LSCKH YHSEC+N WL+INKVCPVCSAEVSTS
Sbjct  240  QDGSAEQCVICRLEYEEGDSLVLLSCKHKYHSECVNKWLQINKVCPVCSAEVSTS  294



>ref|XP_003592714.1| RING finger protein [Medicago truncatula]
 gb|AES62965.1| RING-finger ubiquitin ligase [Medicago truncatula]
Length=339

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 144/177 (81%), Gaps = 9/177 (5%)
 Frame = -2

Query  643  AHDEAS---EDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE-GQALSE  476
             HD AS    + N  IE DP  F SDEAYARALQEAEEREMAARLLALAGI++   +++E
Sbjct  160  VHDHASVGDRENNPVIEFDPELFSSDEAYARALQEAEEREMAARLLALAGIHDLSFSITE  219

Query  475  -----EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN  311
                 E+H  NSQDAWE+VDPDELSYEELLALGEVVGTESRGLS DTIA LPS+NYK+ +
Sbjct  220  DAEDMEEHAANSQDAWEDVDPDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKAGS  279

Query  310  TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
             Q G+NDSCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EVS SG
Sbjct  280  DQLGSNDSCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASG  336



>gb|ACJ85919.1| unknown [Medicago truncatula]
 gb|AFK45820.1| unknown [Medicago truncatula]
Length=339

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 144/177 (81%), Gaps = 9/177 (5%)
 Frame = -2

Query  643  AHDEAS---EDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE-GQALSE  476
             HD AS    + N  IE DP  F SDEAYARALQEAEEREMAARLLALAGI++   +++E
Sbjct  160  VHDHASVGDRENNPVIEFDPELFSSDEAYARALQEAEEREMAARLLALAGIHDLSFSITE  219

Query  475  -----EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN  311
                 E+H  NSQDAWE+VDPDELSYEELLALGEVVGTESRGLS DTIA LPS+NYK+ +
Sbjct  220  DAEDMEEHAANSQDAWEDVDPDELSYEELLALGEVVGTESRGLSTDTIACLPSVNYKAGS  279

Query  310  TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
             Q G+NDSCVICR+DYED E+LTVLSCKH YH ECINNWL+INKVCPVCS EVS SG
Sbjct  280  DQLGSNDSCVICRVDYEDDESLTVLSCKHLYHPECINNWLKINKVCPVCSTEVSASG  336



>ref|XP_008795341.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Phoenix 
dactylifera]
Length=285

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 142/176 (81%), Gaps = 11/176 (6%)
 Frame = -2

Query  664  EDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQA  485
            EDAFD  A+D +         +D + F SDEA+ARALQ+AEERE+A RL+ALAG+N+   
Sbjct  118  EDAFD--ANDRS---------IDSAEFESDEAFARALQDAEEREVAVRLMALAGLNDWGV  166

Query  484  LSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQ  305
             +  DHG +SQDAWEEVDPDE SYEEL+ALGEVVGTESRGLSA TIASLPS+NYK+ + Q
Sbjct  167  ENHGDHGNHSQDAWEEVDPDEYSYEELVALGEVVGTESRGLSAVTIASLPSVNYKAGSVQ  226

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            DG  D CVICRL+YEDGE++ VLSCKH+YHSECI  WL+INKVCP+CS EVSTSGN
Sbjct  227  DGNTDQCVICRLEYEDGESIVVLSCKHAYHSECIYKWLQINKVCPICSTEVSTSGN  282



>ref|XP_010906327.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Elaeis 
guineensis]
Length=280

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  469  HGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAND  290
            HG +SQDAWEEVDPDE SYEEL+ALGEV+G+ SRGLSAD IASLPS+N+K+ + QDG  D
Sbjct  167  HGNHSQDAWEEVDPDEYSYEELVALGEVIGSASRGLSADRIASLPSVNFKAGSMQDGNTD  226

Query  289  SCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
             CVICRL+YEDGE+L VLSCKH+YHSECIN WL+INKVCP+CS EVSTSGN
Sbjct  227  QCVICRLEYEDGESLVVLSCKHTYHSECINKWLQINKVCPLCSTEVSTSGN  277



>ref|XP_004957470.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Setaria 
italica]
Length=323

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = -2

Query  601  LDPSAFPSDeayaralqeaeeremaarllalAGINEGQALS---EEDHGQNSQDAWEEVD  431
            +DP+ F  DEAYARALQ+AEERE+AARL+ALAG+++ +A+    EEDH  + Q+AW+EVD
Sbjct  163  VDPADFEDDEAYARALQDAEEREVAARLMALAGLSDWRAVDVEHEEDHVNDPQEAWQEVD  222

Query  430  PDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYEDGE  251
            PDE SYEEL+ALGEVVGTESRGLSADT+ASLPS+ YK+QN QDG  + CVICR+++EDGE
Sbjct  223  PDEYSYEELVALGEVVGTESRGLSADTLASLPSVKYKAQNVQDGNTEQCVICRVEFEDGE  282

Query  250  TLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            +L  L CKHSYH ECIN WL+INKVCP+CSAEVSTSGN 
Sbjct  283  SLIALPCKHSYHPECINQWLQINKVCPMCSAEVSTSGNK  321



>ref|XP_006406443.1| hypothetical protein EUTSA_v10021098mg [Eutrema salsugineum]
 gb|ESQ47896.1| hypothetical protein EUTSA_v10021098mg [Eutrema salsugineum]
Length=335

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 141/174 (81%), Gaps = 3/174 (2%)
 Frame = -2

Query  661  DAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGI-NEGQA  485
            DA DVHAH++  ED+    + +  A   DEAYARALQEA+EREMAARL AL+G  +  + 
Sbjct  159  DAPDVHAHEDDQEDDGRNSDTEEVANSDDEAYARALQEADEREMAARLSALSGFADRVED  218

Query  484  LSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQ  305
            L +EDH   SQDAW+E+DPDELSYEELLALGE+VGTESRGLSADTIA+LPS  YK  + Q
Sbjct  219  LEDEDH--TSQDAWDEMDPDELSYEELLALGEIVGTESRGLSADTIATLPSKRYKDGDNQ  276

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            +G N+SCVICRLDYED + L +L CKHSYHSECINNWL+INK+CPVCSAEVSTS
Sbjct  277  NGTNESCVICRLDYEDNDDLILLPCKHSYHSECINNWLKINKICPVCSAEVSTS  330



>ref|XP_010508204.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Camelina 
sativa]
Length=337

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 143/175 (82%), Gaps = 4/175 (2%)
 Frame = -2

Query  664  EDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGI-NEGQ  488
            EDA DVHA++   ED+    +++  A+  DEAYARALQ+AEER+MAARL AL+G+ N  +
Sbjct  161  EDAPDVHANENDQEDDG-NSDIEEVAYSDDEAYARALQDAEERDMAARLSALSGLANRVE  219

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
             L +E H   SQDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  + 
Sbjct  220  VLEDESH--TSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKDGDN  277

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            Q+G N+SCVICRLDYED + L +L CKHSYHSECINNWL+INKVCPVCSAEVSTS
Sbjct  278  QNGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTS  332



>ref|XP_009111410.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brassica 
rapa]
Length=333

 Score =   190 bits (483),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 140/179 (78%), Gaps = 3/179 (2%)
 Frame = -2

Query  676  DEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGI-  500
            D+  EDA DV+A+ +  ED     E + + +  DEA+ARA+QEAE REMA RL AL G+ 
Sbjct  152  DDPQEDAPDVNANGDDQEDGGRNAETEEAGYSDDEAFARAIQEAEAREMADRLSALTGLA  211

Query  499  NEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK  320
            N  + L ++DH   S+DAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK
Sbjct  212  NRVEVLEDDDH--TSEDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYK  269

Query  319  SQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
                Q+G N+SCVICRLDYED + L +L CKHSYHSECINNWL+INK+CPVCSAEVSTS
Sbjct  270  DGENQNGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKICPVCSAEVSTS  328



>ref|XP_002883210.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59469.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=337

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  673  EEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE  494
            +ED    DVHA+++  ED+    +++  A+  DEAYARALQEAEER+MAARL AL+G+  
Sbjct  157  QEDAPVVDVHANEDDQEDDG-NSDIEEVAYSDDEAYARALQEAEERDMAARLSALSGLAN  215

Query  493  GQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ  314
                  ED    SQDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  
Sbjct  216  RVVEDLEDDSHTSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKEG  275

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            + Q+G N+SCVICRLDYED E L +L CKHSYHSECINNWL+INKVCPVCSAEVSTS
Sbjct  276  DNQNGTNESCVICRLDYEDDEDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTS  332



>emb|CDY42218.1| BnaA01g25770D [Brassica napus]
Length=334

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 138/175 (79%), Gaps = 3/175 (2%)
 Frame = -2

Query  664  EDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGI-NEGQ  488
            EDA DV+A+ +  ED     E + + +  DEA+ARA+QEAE REMA RL AL G+ N  +
Sbjct  157  EDAPDVNANGDDQEDGGRNAETEEAGYSDDEAFARAIQEAEAREMADRLSALTGLANRVE  216

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
             L ++DH   S+DAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK    
Sbjct  217  VLEDDDH--TSEDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKDGEN  274

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            Q+G N+SCVICRLDYED + L +L CKHSYHSECINNWL+INK+CPVCSAEVSTS
Sbjct  275  QNGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKICPVCSAEVSTS  329



>ref|XP_009145730.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brassica 
rapa]
Length=324

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 139/174 (80%), Gaps = 3/174 (2%)
 Frame = -2

Query  661  DAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGI-NEGQA  485
            DA +V+AH++  EDE    + +   +  DEA+ARA+QEAEEREMA RL AL G+ N  + 
Sbjct  148  DAPNVNAHEDDQEDEGRNADEEEVGYSDDEAFARAIQEAEEREMADRLSALTGLANRVED  207

Query  484  LSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQ  305
            L E+DH   SQDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  + Q
Sbjct  208  LEEDDH--TSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKDGDNQ  265

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            +G N+SCVICRLDYED + L +L CKHSYHSECINNWL+INK CPVCSAEVSTS
Sbjct  266  NGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKSCPVCSAEVSTS  319



>ref|XP_010466157.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Camelina 
sativa]
Length=336

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 145/180 (81%), Gaps = 6/180 (3%)
 Frame = -2

Query  664  EDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGI-NEGQ  488
            EDA DVHA++   ED+    +++  A+  DEAYARALQ+AEER+MAARL AL+G+ N  +
Sbjct  160  EDAPDVHANENDQEDDG-NSDIEEVAYSDDEAYARALQDAEERDMAARLSALSGLANRVE  218

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
             L +E H   SQDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  + 
Sbjct  219  VLEDESH--TSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKDGDN  276

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV--STSGNS  134
            Q+G N+SCVICRLDYED + L +L CKHSYHSECINNWL+INKVCPVCSAEV  STSG S
Sbjct  277  QNGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSASTSGQS  336



>ref|XP_010487949.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Camelina sativa]
Length=338

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 145/180 (81%), Gaps = 6/180 (3%)
 Frame = -2

Query  664  EDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGI-NEGQ  488
            EDA DVHA++   ED+    +++  A+  DEAYARALQ+AEER+MAARL AL+G+ N  +
Sbjct  162  EDAPDVHANENDQEDDG-NSDIEEVAYSDDEAYARALQDAEERDMAARLSALSGLANRVE  220

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
             L +E H   SQDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  + 
Sbjct  221  VLEDESH--TSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKDGDN  278

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV--STSGNS  134
            Q+G N+SCVICRLDYED + L +L CKHSYHSECINNWL+INKVCPVCSAEV  STSG S
Sbjct  279  QNGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSASTSGQS  338



>ref|NP_566651.1| E3 ubiquitin ligase BIG BROTHER-like protein [Arabidopsis thaliana]
 sp|Q9LT17.1|BBR_ARATH RecName: Full=E3 ubiquitin ligase BIG BROTHER-related; Short=AtBBR 
[Arabidopsis thaliana]
 dbj|BAB01306.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK73948.1| AT3g19910/MPN9_15 [Arabidopsis thaliana]
 gb|AAK76658.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85084.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76307.1| E3 ubiquitin ligase BIG BROTHER-like protein [Arabidopsis thaliana]
Length=340

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  475  EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGA  296
            ED    SQDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  + Q+G 
Sbjct  225  EDESHTSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKEGDNQNGT  284

Query  295  NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            N+SCVICRLDYED E L +L CKHSYHSECINNWL+INKVCPVCSAEVSTS
Sbjct  285  NESCVICRLDYEDDEDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTS  335



>ref|XP_010487948.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Camelina sativa]
Length=339

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 145/180 (81%), Gaps = 5/180 (3%)
 Frame = -2

Query  664  EDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGI-NEGQ  488
            EDA DVHA++   ED+    +++  A+  DEAYARALQ+AEER+MAARL AL+G+ N  +
Sbjct  162  EDAPDVHANENDQEDDG-NSDIEEVAYSDDEAYARALQDAEERDMAARLSALSGLANRVE  220

Query  487  ALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT  308
             L +E H  + QDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  + 
Sbjct  221  VLEDESH-TSQQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKDGDN  279

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV--STSGNS  134
            Q+G N+SCVICRLDYED + L +L CKHSYHSECINNWL+INKVCPVCSAEV  STSG S
Sbjct  280  QNGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSASTSGQS  339



>gb|EPS72594.1| hypothetical protein M569_02164, partial [Genlisea aurea]
Length=108

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -2

Query  454  QDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQ-DGANDSCVI  278
            QDAW+EVDPDELSYEELLALG+VVGTESRGLSADT+ASLP   +KSQ T  +G+ DSCVI
Sbjct  1    QDAWDEVDPDELSYEELLALGDVVGTESRGLSADTLASLPFTEFKSQGTAAEGSCDSCVI  60

Query  277  CRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            CRLDYEDG+TLTVLSCKH YH ECI +WL+INKVCPVCSAEVST G S
Sbjct  61   CRLDYEDGDTLTVLSCKHLYHPECIKSWLKINKVCPVCSAEVSTFGGS  108



>emb|CDY33429.1| BnaC01g32960D [Brassica napus]
Length=330

 Score =   185 bits (470),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 5/177 (3%)
 Frame = -2

Query  664  EDAFDVHAHDEASED--ENLGIELDPSAFPSDeayaralqeaeeremaarllalAGI-NE  494
            EDA DV+A+ +  ED   N   E   + +  DEA+ARA+QEAE REMA RL AL G+ N 
Sbjct  151  EDAPDVNANGDDQEDGGRNADTEEAEAGYSDDEAFARAIQEAEAREMADRLSALTGLANR  210

Query  493  GQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ  314
             + L ++DH   S+DAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  
Sbjct  211  VEVLEDDDH--TSEDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKDG  268

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
              Q+G N+SCVICRLDYED + L +L CKHSYHSECINNWL+INK+CPVCSAEVSTS
Sbjct  269  ENQNGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKICPVCSAEVSTS  325



>ref|XP_009392890.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=292

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -2

Query  505  GINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMN  326
            G+NE       DH  NS D W+++DPDE  YEEL+ALGEVVGTESRGLSAD IASLPS+N
Sbjct  167  GLNEWVPDDHRDHRGNSNDVWQDIDPDEYVYEELVALGEVVGTESRGLSADMIASLPSVN  226

Query  325  YKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            YK++N QD  ++ CV+CRL+YEDG++L +LSCKH YHSECIN WL+INKVCPVC+AEVST
Sbjct  227  YKAENIQDDNSEQCVVCRLEYEDGDSLVLLSCKHKYHSECINKWLQINKVCPVCNAEVST  286

Query  145  SG  140
            SG
Sbjct  287  SG  288



>emb|CDY25357.1| BnaA05g19270D [Brassica napus]
Length=320

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -2

Query  475  EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGA  296
            ED    SQDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  + Q+G 
Sbjct  205  EDDDHTSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKDGDNQNGT  264

Query  295  NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            N+SCVICRLDYED + L +L CKHSYHSECINNWL+INK CPVCSAEVSTS
Sbjct  265  NESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKSCPVCSAEVSTS  315



>gb|AAM61025.1| unknown [Arabidopsis thaliana]
Length=340

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -2

Query  475  EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGA  296
            ED    SQDA +E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  + Q+G 
Sbjct  225  EDESHTSQDARDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKEGDNQNGT  284

Query  295  NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            N+SCVICRLDYED E L +L CKHSYHSECINNWL+INKVCPVCSAEVSTS
Sbjct  285  NESCVICRLDYEDDEDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTS  335



>ref|XP_010541856.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Tarenaya 
hassleriana]
Length=352

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -2

Query  667  DEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQ  488
            DEDA DVHAH++  E+     E D  A+  DEAYARALQEAEEREMAAR+ +LAG+N+ Q
Sbjct  175  DEDASDVHAHEDGQENYGENSEFDMGAYSDDEAYARALQEAEEREMAARMFSLAGLND-Q  233

Query  487  ALSEEDHGQNSQD-AWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN  311
                ED   N QD AWEEVDPDEL YEELLALGEVVGTESRGLSAD IASLPS+ YK+ +
Sbjct  234  VEHAEDQDHNPQDDAWEEVDPDELLYEELLALGEVVGTESRGLSADAIASLPSVRYKAGS  293

Query  310  TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
             ++G+N+SCVICRLDYEDG+ L +LSCKHSYH ECINNWL+INKVCPVCSAEVSTSG S
Sbjct  294  NENGSNESCVICRLDYEDGDDLILLSCKHSYHPECINNWLKINKVCPVCSAEVSTSGQS  352



>ref|XP_002460573.1| hypothetical protein SORBIDRAFT_02g031050 [Sorghum bicolor]
 gb|EER97094.1| hypothetical protein SORBIDRAFT_02g031050 [Sorghum bicolor]
Length=324

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -2

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
            EEDH  + Q+AW+EVDPDE SYEEL+ALGEVVGTE+RGLSADT+ASLPS+ YK Q+ QDG
Sbjct  208  EEDHVNDPQEAWQEVDPDEYSYEELVALGEVVGTENRGLSADTLASLPSVTYKMQDVQDG  267

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
              + CVICR++ E+GE+L  L CKH YH ECIN WL+INKVCP+CSAEVSTSGN 
Sbjct  268  NTEQCVICRVELEEGESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSGNK  322



>emb|CDY24595.1| BnaC05g32790D [Brassica napus]
Length=315

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = -2

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
            E+DH   SQDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASLPS  YK  + Q+G
Sbjct  201  EDDH--TSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKDGDNQNG  258

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
             N+SCVICRLDYED + L +L CKHSYHS CINNWL+INK CPVCSAEVSTS
Sbjct  259  TNESCVICRLDYEDDDDLILLPCKHSYHSGCINNWLKINKSCPVCSAEVSTS  310



>ref|XP_006661480.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like, partial 
[Oryza brachyantha]
Length=269

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = -2

Query  613  LGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQAL-SEEDHGQNSQDAWEE  437
            +G ELDP+ +  DEAYARALQ+AEERE+A+RL+ALAGI++ + +  +E+H  + QDAW+E
Sbjct  107  VGPELDPAEYEDDEAYARALQDAEEREVASRLMALAGISDWRGVEPDEEHVNDPQDAWQE  166

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYED  257
            VDPDE SYEEL+ALGEVVGT++RGLSAD +ASLPS+ +K++  QDG ++ CVICR+++ED
Sbjct  167  VDPDEYSYEELVALGEVVGTQNRGLSADILASLPSLTFKAKGAQDGNSEQCVICRVEFED  226

Query  256  GETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            GE+L  L CKHSYH ECIN WL+INKVCP+CS+EVSTS N
Sbjct  227  GESLIALPCKHSYHPECINQWLQINKVCPMCSSEVSTSDN  266



>ref|XP_006298094.1| hypothetical protein CARUB_v10014137mg [Capsella rubella]
 gb|EOA30992.1| hypothetical protein CARUB_v10014137mg [Capsella rubella]
Length=335

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -2

Query  475  EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGA  296
            ED    SQDAW+E+DPDELSYEELLALG++VGTESRGLSADTIASL S  YK  + Q+G 
Sbjct  220  EDESHTSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLTSKRYKDGDNQNGT  279

Query  295  NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            N+SCVICRLDYE  + L +L CKHSYHSECINNWL+INKVCPVCSAEVSTS
Sbjct  280  NESCVICRLDYEVDDDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTS  330



>ref|NP_001150748.1| protein binding protein [Zea mays]
 gb|ACG40201.1| protein binding protein [Zea mays]
Length=322

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -2

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
            EEDH  + Q+AW+EVDPDE SYEEL+ALGEVVGTE+RGLSADT+ SLPS+ YK Q+ QDG
Sbjct  206  EEDHANDPQEAWQEVDPDEYSYEELVALGEVVGTENRGLSADTLGSLPSVTYKLQHVQDG  265

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
              + CVICR++ E+GE+L  L CKH YH ECIN WL+INKVCP+CSAEVSTSGN 
Sbjct  266  NTEQCVICRVELEEGESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSGNK  320



>tpg|DAA62493.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=322

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -2

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
            EEDH  + Q+AW+EVDPDE SYEEL+ALGEVVGTE+RGLSADT+ SLPS+ YK Q+ QDG
Sbjct  206  EEDHANDPQEAWQEVDPDEYSYEELVALGEVVGTENRGLSADTLGSLPSVTYKLQHVQDG  265

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
              + CVICR++ E+GE+L  L CKH YH ECIN WL+INKVCP+CSAEVSTSGN 
Sbjct  266  NTEQCVICRVELEEGESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSGNK  320



>ref|NP_001149296.1| LOC100282919 [Zea mays]
 gb|ACG34901.1| protein binding protein [Zea mays]
Length=323

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 132/161 (82%), Gaps = 3/161 (2%)
 Frame = -2

Query  610  GIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALS---EEDHGQNSQDAWE  440
            G E+DP+ F +DEAYARALQ+AEE E+AARL+ALAG+++ + +    EEDH  + Q+AW+
Sbjct  160  GPEVDPAEFENDEAYARALQDAEELEVAARLMALAGLSDWRTVDVEHEEDHVNDPQEAWQ  219

Query  439  EVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYE  260
            EVDPDE SYEEL+ALGEVVGTE+RGLSAD +ASLPS+ YK Q+ QDG  + CVICR++ E
Sbjct  220  EVDPDEYSYEELVALGEVVGTENRGLSADALASLPSVTYKMQSVQDGNTEQCVICRVELE  279

Query  259  DGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            DGE+L  L CKH YH ECIN WL+INKVCP+CSAEVSTS N
Sbjct  280  DGESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSSN  320



>ref|XP_003574899.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Brachypodium distachyon]
Length=302

 Score =   179 bits (454),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  472  DHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAN  293
            + G ++QDAWE+VDPDE SYEEL+ALGEVVGTESRGLSADT+ASLPS+ Y++++ QD   
Sbjct  188  EEGDSAQDAWEDVDPDEYSYEELVALGEVVGTESRGLSADTLASLPSVTYEAKDKQDSNT  247

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            + CVICR+++E+GE+L  L CKHSYHSECIN WL++NKVCP+CSAEVST GNS
Sbjct  248  EQCVICRVEFEEGESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVSTPGNS  300



>ref|XP_010235389.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Brachypodium distachyon]
Length=301

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 135/165 (82%), Gaps = 8/165 (5%)
 Frame = -2

Query  604  ELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEE--------DHGQNSQD  449
            E+DP+ +  DEAYARALQ+AEERE+A RL+ALAGI++ Q +  +        + G ++QD
Sbjct  135  EVDPAQYEDDEAYARALQDAEEREIAGRLMALAGISDWQGMEHDGEYDGAYAEEGDSAQD  194

Query  448  AWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRL  269
            AWE+VDPDE SYEEL+ALGEVVGTESRGLSADT+ASLPS+ Y++++ QD   + CVICR+
Sbjct  195  AWEDVDPDEYSYEELVALGEVVGTESRGLSADTLASLPSVTYEAKDKQDSNTEQCVICRV  254

Query  268  DYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            ++E+GE+L  L CKHSYHSECIN WL++NKVCP+CSAEVST GNS
Sbjct  255  EFEEGESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVSTPGNS  299



>ref|XP_002445744.1| hypothetical protein SORBIDRAFT_07g024950 [Sorghum bicolor]
 gb|EES15239.1| hypothetical protein SORBIDRAFT_07g024950 [Sorghum bicolor]
Length=314

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 135/167 (81%), Gaps = 9/167 (5%)
 Frame = -2

Query  607  IELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSE---------EDHGQNS  455
            ++LDP+ +  DEA+ARALQ+AEER++A RL+AL GI + +A+ +         ED G ++
Sbjct  143  LDLDPAQYEDDEAFARALQDAEERDVADRLMALVGIGDWRAMEQDDAGDHEEDEDDGVHT  202

Query  454  QDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVIC  275
            QDAWE+VDPDE SYEEL+ALGEVVGTES+GL+ADTIASLPS+ Y +Q+ QDG  + CVIC
Sbjct  203  QDAWEDVDPDEYSYEELIALGEVVGTESKGLAADTIASLPSVTYHAQDKQDGNMEQCVIC  262

Query  274  RLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            R+++++GE+L  L CKH YHSECIN WL++NKVCP+CSAEVSTS N+
Sbjct  263  RVEFDEGESLVALPCKHPYHSECINQWLQLNKVCPMCSAEVSTSANN  309



>ref|XP_003578515.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Brachypodium 
distachyon]
Length=337

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -2

Query  505  GINEGQALSE-EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSM  329
            GI++ +A+   E+H  ++QD+W+EVDPDE SYEEL+ALGEVVGTESRGLSADT+ASLPS+
Sbjct  211  GISDWRAVEHVEEHVNDAQDSWQEVDPDEYSYEELVALGEVVGTESRGLSADTLASLPSV  270

Query  328  NYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVS  149
             YK+++ QDG  + CVICR+++E+GE+L  L CKHSYH +CIN WL+INKVCP+CSAEVS
Sbjct  271  TYKTKDVQDGNTEQCVICRVEFEEGESLVALPCKHSYHPDCINQWLQINKVCPMCSAEVS  330

Query  148  TSGN  137
            TS N
Sbjct  331  TSEN  334



>ref|XP_009395284.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -2

Query  505  GINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMN  326
            G+NE  +   +D+G NSQDAW+EVDPDE SYEEL+ALGEVVGTE+RGLS D I++LP ++
Sbjct  159  GLNEWVSDDHDDYGNNSQDAWQEVDPDEYSYEELIALGEVVGTENRGLSVDKISALPLVS  218

Query  325  YKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            Y + N QD   + CVICRL+YEDG++L +LSCKH YH ECIN WL+INKVCP C+AEVST
Sbjct  219  YTANNVQDSNAEQCVICRLEYEDGDSLMLLSCKHRYHFECINKWLQINKVCPACNAEVST  278

Query  145  SGN  137
            S N
Sbjct  279  SEN  281



>dbj|BAJ88925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=346

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = -2

Query  505  GINEGQALSE-EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSM  329
            GI++ +A+   EDH  ++QD+W+EVDPDE SYEEL+ALG+VVGTESRGLSADT+ASLPS+
Sbjct  220  GISDWRAVEHVEDHINDAQDSWQEVDPDEYSYEELVALGDVVGTESRGLSADTLASLPSV  279

Query  328  NYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVS  149
             YK+++ QDG  + CVICR+++E+GE+L  L C HSYH +CIN WL+INKVCP+CSAEVS
Sbjct  280  TYKTKDMQDGNTEQCVICRVEFEEGESLVALPCNHSYHPDCINQWLQINKVCPMCSAEVS  339

Query  148  TSGNS  134
            TS N 
Sbjct  340  TSANK  344



>gb|KFK39312.1| hypothetical protein AALP_AA3G228600 [Arabis alpina]
Length=316

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -2

Query  457  SQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVI  278
            S+D W+E+DPDELSYEELLALGE VGTESRGLSAD IASLPS  YK  + Q+G N+SCVI
Sbjct  207  SRDTWDEMDPDELSYEELLALGEFVGTESRGLSADKIASLPSKRYKEGDNQNGTNESCVI  266

Query  277  CRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            CRLDYED + L +L CKHSYHSECINNWL+INKVCPVCSAEVS S
Sbjct  267  CRLDYEDEDDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSAS  311



>tpg|DAA40634.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=323

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -2

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
            EEDH  + Q+AW+EVDPDE SYEEL+ALGEVVGTE+RGLSAD +ASLPS+ YK Q+ QDG
Sbjct  207  EEDHVNDPQEAWQEVDPDEYSYEELVALGEVVGTENRGLSADALASLPSVTYKMQSVQDG  266

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
              + CVICR++ E+GE+L  L CKH YH ECIN WL+INKVCP+CSAEVSTS N
Sbjct  267  NTEQCVICRVELEEGESLIALPCKHLYHPECINQWLQINKVCPMCSAEVSTSSN  320



>gb|EAZ07897.1| hypothetical protein OsI_30152 [Oryza sativa Indica Group]
Length=300

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  454  QDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVIC  275
            QDAWE+VDPDE SYEEL+ALGEVVGTESRGLSADT+ASLPS+ Y++Q+ QDG  + CVIC
Sbjct  192  QDAWEDVDPDEYSYEELVALGEVVGTESRGLSADTLASLPSITYRAQDKQDGNMEQCVIC  251

Query  274  RLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            R+++E+GE+L  L CKHSYHSECIN WL++NKVCP+CSAEV TS ++
Sbjct  252  RVEFEEGESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVPTSQDT  298



>ref|NP_001062434.1| Os08g0548300 [Oryza sativa Japonica Group]
 dbj|BAD10755.1| putative RING-H2 finger protein RHG1a [Oryza sativa Japonica 
Group]
 dbj|BAD09949.1| putative RING-H2 finger protein RHG1a [Oryza sativa Japonica 
Group]
 dbj|BAF24348.1| Os08g0548300 [Oryza sativa Japonica Group]
 gb|EAZ43565.1| hypothetical protein OsJ_28186 [Oryza sativa Japonica Group]
 dbj|BAG93370.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  454  QDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVIC  275
            QDAWE+VDPDE SYEEL+ALGEVVGTESRGLSADT+ASLPS+ Y++Q+ QDG  + CVIC
Sbjct  197  QDAWEDVDPDEYSYEELVALGEVVGTESRGLSADTLASLPSITYRAQDKQDGNMEQCVIC  256

Query  274  RLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            R+++E+GE+L  L CKHSYHSECIN WL++NKVCP+CSAEV TS ++
Sbjct  257  RVEFEEGESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVPTSQDT  303



>gb|EEC84951.1| hypothetical protein OsI_32172 [Oryza sativa Indica Group]
Length=325

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  475  EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGA  296
            E+H  + QDAW+EVDPDE SYEEL+ALGE VGT  RGLSA T+ASLPS+ YK++  QDG 
Sbjct  210  EEHANDPQDAWQEVDPDEYSYEELVALGEAVGTGHRGLSAATLASLPSVTYKAEGVQDGN  269

Query  295  NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
             + CVICR+++EDGE+L  L CKHSYH ECIN WL+INKVCP+CSAEVSTS
Sbjct  270  TEQCVICRVEFEDGESLIALPCKHSYHPECINQWLQINKVCPMCSAEVSTS  320



>ref|XP_006659662.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Oryza 
brachyantha]
Length=301

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  454  QDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVIC  275
            QDAWE+VDPDE SYEEL+ALGEVVGTESRGLSADT+ASLPS+ Y++Q+ QD   + CVIC
Sbjct  193  QDAWEDVDPDEYSYEELVALGEVVGTESRGLSADTLASLPSITYRAQDKQDSNMEQCVIC  252

Query  274  RLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            R+++E+GE+L  L CKHSYHSECIN WL++NKVCP+CSAEV TS ++
Sbjct  253  RVEFEEGESLVALPCKHSYHSECINQWLQLNKVCPMCSAEVPTSQDT  299



>ref|NP_001063778.1| Os09g0535100 [Oryza sativa Japonica Group]
 dbj|BAD34213.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25692.1| Os09g0535100 [Oryza sativa Japonica Group]
 dbj|BAG91659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=325

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -2

Query  475  EDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGA  296
            E+H  + QDAW+EVDPDE SYEEL+ALGE VGT  RGLSA T+ASLPS+ YK++  QDG 
Sbjct  210  EEHANDPQDAWQEVDPDEYSYEELVALGEAVGTGHRGLSAATLASLPSVTYKAEGVQDGN  269

Query  295  NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
             + CVICR+++EDGE+L  L CKHSYH ECIN WL+INKVCP+CSAEVSTS
Sbjct  270  TEQCVICRVEFEDGESLIALPCKHSYHPECINQWLQINKVCPMCSAEVSTS  320



>ref|XP_008789252.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Phoenix dactylifera]
Length=300

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 128/162 (79%), Gaps = 11/162 (7%)
 Frame = -2

Query  664  EDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQA  485
            EDAFD  A+D +         +DP+ F SDEA+ARALQ AEE E+A RL+AL+G+N+   
Sbjct  118  EDAFD--ANDRS---------VDPAEFESDEAFARALQNAEEAEVAVRLMALSGLNDWAV  166

Query  484  LSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQ  305
               EDH  +SQDAWEEVDPD+ SYEEL+ALGEVVGTE+RGLSADTIASLPS+NYK+ + Q
Sbjct  167  EDHEDHDSHSQDAWEEVDPDDYSYEELVALGEVVGTENRGLSADTIASLPSVNYKAGSAQ  226

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINK  179
            DG  D CVICRL+YEDGE+L +LSCKH+YHSECIN WL INK
Sbjct  227  DGNTDQCVICRLEYEDGESLVMLSCKHTYHSECINKWLLINK  268



>dbj|BAK04753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  460  NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCV  281
            ++QDAWE+VDPDE SYEEL+ALGEVVGTESRG+SADT+ASLPS+ Y++Q+ Q+   + CV
Sbjct  182  SAQDAWEDVDPDEYSYEELVALGEVVGTESRGVSADTLASLPSVTYQAQDKQESNMEQCV  241

Query  280  ICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            ICR+++E+GE+L  L CKHSYHS+CIN WL++NKVCP+CSAEVSTS N
Sbjct  242  ICRVEFEEGESLVALPCKHSYHSDCINQWLQLNKVCPMCSAEVSTSDN  289



>gb|KCW65071.1| hypothetical protein EUGRSUZ_G02582 [Eucalyptus grandis]
Length=310

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 143/193 (74%), Gaps = 11/193 (6%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+ +D  D  AFDVHA ++A    N  +EL+P  F SDEAYARALQ+AEEREMAAR+LA
Sbjct  122  DGTDLDAGD--AFDVHAAEDAHGGSNQAVELEPENFSSDEAYARALQDAEEREMAARMLA  179

Query  511  lAGINE-------GQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSAD  353
            LAG+N+        +   EEDH  N Q  WE+VD         L   EVVGTESRGLSAD
Sbjct  180  LAGLNDRLGEEEEEEDDEEEDHHDNHQGVWEDVDELLYEELLALG--EVVGTESRGLSAD  237

Query  352  TIASLPSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVC  173
            TIASL S++YK+ ++Q G NDSCVICRLDYEDGE LTVLSCKHSYHS+CINNWL+INKVC
Sbjct  238  TIASLSSVSYKTGSSQHGTNDSCVICRLDYEDGEKLTVLSCKHSYHSDCINNWLQINKVC  297

Query  172  PVCSAEVSTSGNS  134
            PVCSAEVS S NS
Sbjct  298  PVCSAEVSGSPNS  310



>gb|EMS64698.1| E3 ubiquitin ligase BIG BROTHER-related protein [Triticum urartu]
Length=241

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -2

Query  460  NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCV  281
            ++QDAWE+VDPDE SYEEL+ALGEVVGTESRG+SADT+ASLPS+ Y++++ QD   + CV
Sbjct  131  SAQDAWEDVDPDEYSYEELVALGEVVGTESRGVSADTLASLPSVTYQAEDNQDSNMEQCV  190

Query  280  ICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            ICR+++E+ E+L  L CKHSYHS+CI  WL++NKVCP+CSAEVST GN
Sbjct  191  ICRVEFEESESLVALPCKHSYHSDCIKQWLQLNKVCPMCSAEVSTPGN  238



>ref|XP_010067008.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Eucalyptus 
grandis]
Length=357

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 143/193 (74%), Gaps = 11/193 (6%)
 Frame = -2

Query  691  DGSHVDEEDEDAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarlla  512
            DG+ +D  D  AFDVHA ++A    N  +EL+P  F SDEAYARALQ+AEEREMAAR+LA
Sbjct  169  DGTDLDAGD--AFDVHAAEDAHGGSNQAVELEPENFSSDEAYARALQDAEEREMAARMLA  226

Query  511  lAGINE-------GQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSAD  353
            LAG+N+        +   EEDH  N Q  WE+VD         L   EVVGTESRGLSAD
Sbjct  227  LAGLNDRLGEEEEEEDDEEEDHHDNHQGVWEDVDELLYEELLALG--EVVGTESRGLSAD  284

Query  352  TIASLPSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVC  173
            TIASL S++YK+ ++Q G NDSCVICRLDYEDGE LTVLSCKHSYHS+CINNWL+INKVC
Sbjct  285  TIASLSSVSYKTGSSQHGTNDSCVICRLDYEDGEKLTVLSCKHSYHSDCINNWLQINKVC  344

Query  172  PVCSAEVSTSGNS  134
            PVCSAEVS S NS
Sbjct  345  PVCSAEVSGSPNS  357



>ref|XP_004974139.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Setaria 
italica]
Length=301

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 148/197 (75%), Gaps = 12/197 (6%)
 Frame = -2

Query  697  EEDGSHVDEEDE--DAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaa  524
            E++GS  + ED   DA DV   +E ++ E    +LDP+ +  DEA+ARALQ+AEER++A 
Sbjct  104  EDEGSDYEVEDGEGDALDVD--EEVADAEGDAADLDPARYEDDEAFARALQDAEERDVAG  161

Query  523  rllalAGINEGQALSEEDHGQNSQD--------AWEEVDPDELSYEELLALGEVVGTESR  368
            RL+ALAGI + +A+ ++D  +   +        AWE+VDPDE SYEEL+ALGEVVGTES+
Sbjct  162  RLMALAGIGDWRAMEQDDDEEVEDEEDGEDPQDAWEDVDPDEYSYEELIALGEVVGTESK  221

Query  367  GLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLR  188
            GLSADTI SLPS+ Y++Q+ Q+G  + CVICR+++++GE+L  L CKH YHSECIN WL+
Sbjct  222  GLSADTIGSLPSVTYQAQDKQEGNMEQCVICRVEFDEGESLVALPCKHLYHSECINQWLQ  281

Query  187  INKVCPVCSAEVSTSGN  137
            +NKVCP+CSAEVSTS N
Sbjct  282  LNKVCPMCSAEVSTSVN  298



>gb|ACG31571.1| hypothetical protein [Zea mays]
Length=288

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -2

Query  460  NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCV  281
            ++Q AWE+VDPDE SYEEL+ALGEVVGTES+GL+ADTIASLP + Y++Q+ QDG  + CV
Sbjct  178  HTQGAWEDVDPDEYSYEELIALGEVVGTESKGLAADTIASLPWVTYQAQDKQDGNMEQCV  237

Query  280  ICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            ICR+++++GE+L  L CKH YHSECIN WL++NKVCP+CSAEV TS N 
Sbjct  238  ICRVEFDEGESLVALPCKHPYHSECINQWLQLNKVCPMCSAEVPTSVNK  286



>ref|NP_001131853.1| uncharacterized LOC100193231 [Zea mays]
 gb|ACF80448.1| unknown [Zea mays]
 gb|AFW65658.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=287

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -2

Query  460  NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCV  281
            ++Q AWE+VDPDE SYEEL+ALGEVVGTES+GL+ADTIASLP + Y++Q+ QDG  + CV
Sbjct  177  HTQGAWEDVDPDEYSYEELIALGEVVGTESKGLAADTIASLPWVTYQAQDKQDGNMEQCV  236

Query  280  ICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            ICR+++++GE+L  L CKH YHSECIN WL++NKVCP+CSAEV TS N 
Sbjct  237  ICRVEFDEGESLVALPCKHPYHSECINQWLQLNKVCPMCSAEVPTSVNK  285



>ref|XP_009418697.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Musa 
acuminata subsp. malaccensis]
Length=264

 Score =   160 bits (404),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = -2

Query  604  ELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEEDHGQNSQDAWEEVDPD  425
            E+D + F +DEAY+RALQ+AEER +A RL+ALAG+N+       DH    QDAW+  DPD
Sbjct  108  EVDAAYFENDEAYSRALQDAEERVLAVRLMALAGLNDWVPDDHGDHDSGFQDAWQ--DPD  165

Query  424  ELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYEDGETL  245
            E  YEEL+ALGE+VGTESRGLSADTI++LPS++YK+++ QD   + C+ICRL++EDG++L
Sbjct  166  EFMYEELVALGELVGTESRGLSADTISALPSVSYKAESVQDDNAEQCIICRLEFEDGDSL  225

Query  244  TVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
             +LSCKH YH +CIN WL+INK CP+C+ EVSTS N
Sbjct  226  VLLSCKHKYHPDCINKWLQINKACPMCNTEVSTSEN  261



>ref|XP_002445741.1| hypothetical protein SORBIDRAFT_07g024936 [Sorghum bicolor]
 gb|EES15236.1| hypothetical protein SORBIDRAFT_07g024936 [Sorghum bicolor]
Length=106

 Score =   155 bits (391),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = -2

Query  451  DAWEEVDPDELSYEELLALGEVVGTESRGLSADT-IASLPSMNYKSQNTQDGANDSCVIC  275
            D WE+VDPDE SYEEL+ALGEVVG ES+GL+ADT IASLPS+ Y++Q+ QDG  + CVIC
Sbjct  1    DGWEDVDPDEYSYEELIALGEVVGMESKGLAADTTIASLPSVTYQAQDKQDGNMEQCVIC  60

Query  274  RLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            R+++++G +L  L CKH YHSECIN WL++ KVCP+CSAEVSTS N
Sbjct  61   RVEFDEGGSLVALPCKHPYHSECINQWLQLKKVCPMCSAEVSTSVN  106



>ref|XP_006859208.1| hypothetical protein AMTR_s00070p00189230 [Amborella trichopoda]
 gb|ERN20675.1| hypothetical protein AMTR_s00070p00189230 [Amborella trichopoda]
Length=261

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  505  GINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMN  326
            GIN+ +  + E+   N +D  E+VDPDELSYEEL+ALGEVVGT+S+GLS++ I+SLPS+ 
Sbjct  139  GINDWEIENLEELSTNYEDTSEDVDPDELSYEELIALGEVVGTQSKGLSSNIISSLPSIV  198

Query  325  YKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            ++  +  DG  D C IC++DYE+GE L  L CKH+YH ECINNW +INKVCPVC+ EVST
Sbjct  199  FRPASANDGNLDQCAICQVDYEEGEALVNLPCKHAYHLECINNWFQINKVCPVCNKEVST  258



>ref|XP_008651502.1| PREDICTED: protein binding protein isoform X2 [Zea mays]
Length=307

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -2

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
            EEDH  + Q+AW+EVDPDE SYEEL+ALGEVVGTE+RGLSADT+ SLPS+ YK Q+ QDG
Sbjct  206  EEDHANDPQEAWQEVDPDEYSYEELVALGEVVGTENRGLSADTLGSLPSVTYKLQHVQDG  265

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINK  179
              + CVICR++ E+GE+L  L CKH YH ECIN WL+INK
Sbjct  266  NTEQCVICRVELEEGESLIALPCKHLYHPECINQWLQINK  305



>ref|XP_008651501.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 tpg|DAA62491.1| TPA: putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA62492.1| TPA: putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
Length=322

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -2

Query  478  EEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDG  299
            EEDH  + Q+AW+EVDPDE SYEEL+ALGEVVGTE+RGLSADT+ SLPS+ YK Q+ QDG
Sbjct  206  EEDHANDPQEAWQEVDPDEYSYEELVALGEVVGTENRGLSADTLGSLPSVTYKLQHVQDG  265

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINK  179
              + CVICR++ E+GE+L  L CKH YH ECIN WL+INK
Sbjct  266  NTEQCVICRVELEEGESLIALPCKHLYHPECINQWLQINK  305



>gb|ADE77661.1| unknown [Picea sitchensis]
Length=282

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 130/188 (69%), Gaps = 4/188 (2%)
 Frame = -2

Query  688  GSHVDE--EDEDAFDVHAHDEASE--DENLGIELDPSAFPSDeayaralqeaeeremaar  521
            G ++D+  E+ED  D +A D   E  D+    E+D S F SDEAYARALQEAE+R + A+
Sbjct  94   GYYIDDSGENEDEVDANADDFEREALDDGDHEEVDASLFESDEAYARALQEAEDRLLTAQ  153

Query  520  llalAGINEGQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIAS  341
            ++ALAGIN+ +    ED+   S+DAW++VDPD + YEEL+AL EVVGTESRGL+ D I+S
Sbjct  154  MMALAGINDREEDDNEDNDSTSRDAWQDVDPDNMLYEELVALSEVVGTESRGLAPDLISS  213

Query  340  LPSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCS  161
            LP   +  +      ++ CVICRL+YE G+ +  L CKH YHS+CI NWL+I KVCPVC+
Sbjct  214  LPLSKFVPETPSSSNSERCVICRLEYEGGDIILTLPCKHQYHSDCIKNWLQIKKVCPVCN  273

Query  160  AEVSTSGN  137
             EVS   N
Sbjct  274  VEVSDRTN  281



>gb|EMT04037.1| RING-H2 finger protein ATL3F [Aegilops tauschii]
Length=285

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 121/148 (82%), Gaps = 4/148 (3%)
 Frame = -2

Query  610  GIELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALS----EEDHGQNSQDAW  443
            G ELDP+ +  DEAYARALQ+AEERE+A RL+ALAGI + + +     +E+ G ++QDAW
Sbjct  122  GPELDPARYEDDEAYARALQDAEEREVAQRLMALAGITDWEEMEHDVEDEEDGDSAQDAW  181

Query  442  EEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDY  263
            E+VDPDE SYEEL+ALGEVVGTESRG+SA+T+ASLP + Y++++ QD   + CVICR+++
Sbjct  182  EDVDPDEYSYEELVALGEVVGTESRGVSANTLASLPLVTYQAEDNQDSNMEQCVICRVEF  241

Query  262  EDGETLTVLSCKHSYHSECINNWLRINK  179
            E+GE+L  L CKHSYHS+CIN WL++NK
Sbjct  242  EEGESLVALPCKHSYHSDCINQWLQLNK  269



>gb|KCW65072.1| hypothetical protein EUGRSUZ_G02582 [Eucalyptus grandis]
Length=296

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 126/169 (75%), Gaps = 9/169 (5%)
 Frame = -2

Query  661  DAFDVHAHDEASEDENLGIELDPSAFPSDeayaralqeaeeremaarllalAGINE----  494
            DAFDVHA ++A    N  +EL+P  F SDEAYARALQ+AEEREMAAR+LALAG+N+    
Sbjct  130  DAFDVHAAEDAHGGSNQAVELEPENFSSDEAYARALQDAEEREMAARMLALAGLNDRLGE  189

Query  493  ---GQALSEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNY  323
                +   EEDH  N Q  WE+VD         L   EVVGTESRGLSADTIASL S++Y
Sbjct  190  EEEEEDDEEEDHHDNHQGVWEDVDELLYEELLALG--EVVGTESRGLSADTIASLSSVSY  247

Query  322  KSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKV  176
            K+ ++Q G NDSCVICRLDYEDGE LTVLSCKHSYHS+CINNWL+INKV
Sbjct  248  KTGSSQHGTNDSCVICRLDYEDGEKLTVLSCKHSYHSDCINNWLQINKV  296



>gb|AFW65659.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=271

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  460  NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCV  281
            ++Q AWE+VDPDE SYEEL+ALGEVVGTES+GL+ADTIASLP + Y++Q+ QDG  + CV
Sbjct  177  HTQGAWEDVDPDEYSYEELIALGEVVGTESKGLAADTIASLPWVTYQAQDKQDGNMEQCV  236

Query  280  ICRLDYEDGETLTVLSCKHSYHSECINNWLRINKV  176
            ICR+++++GE+L  L CKH YHSECIN WL++NK 
Sbjct  237  ICRVEFDEGESLVALPCKHPYHSECINQWLQLNKA  271



>gb|ABK26080.1| unknown [Picea sitchensis]
Length=282

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 113/156 (72%), Gaps = 0/156 (0%)
 Frame = -2

Query  604  ELDPSAFPSDeayaralqeaeeremaarllalAGINEGQALSEEDHGQNSQDAWEEVDPD  425
            E+D S F SDEAYARALQEAE+R + A+++ALAGIN+ +    ED+   S+DAW++VDPD
Sbjct  126  EVDASLFESDEAYARALQEAEDRLLTAQMMALAGINDREEDDNEDNDSTSRDAWQDVDPD  185

Query  424  ELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYEDGETL  245
             + YEEL+AL EVVG +SRGL+ D I+SLP   Y  ++     ++ CVIC L+YE G+ +
Sbjct  186  NMLYEELVALSEVVGIQSRGLAPDLISSLPLSKYVPESPSSSNSERCVICHLEYEGGDMI  245

Query  244  TVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
              L CKH YHS+CI  WL+INKVCPVCS EVS   N
Sbjct  246  LTLPCKHQYHSDCIKKWLQINKVCPVCSVEVSDKTN  281



>gb|EEE70120.1| hypothetical protein OsJ_30137 [Oryza sativa Japonica Group]
Length=300

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = -2

Query  445  WEEVDPDELSY---EELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVIC  275
            W  V+P E      +EL+ALGE VGT  RGLSA T+ASLPS+ YK++  QDG  + CVIC
Sbjct  192  WRPVEPVEEHANDPQELVALGEAVGTGHRGLSAATLASLPSVTYKAEGVQDGNTEQCVIC  251

Query  274  RLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            R+++EDGE+L  L CKHSYH ECIN WL+INKVCP+CSAEVSTS
Sbjct  252  RVEFEDGESLIALPCKHSYHPECINQWLQINKVCPMCSAEVSTS  295



>ref|XP_001769627.1| predicted protein [Physcomitrella patens]
 gb|EDQ65620.1| predicted protein [Physcomitrella patens]
Length=306

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 84/118 (71%), Gaps = 3/118 (3%)
 Frame = -2

Query  481  SEEDHGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQD  302
            S + H  N  D WE+VDPD +SYEEL+ALGE VGTES+GL+A ++ASL    Y   +++D
Sbjct  182  SNDSHVSNFDDMWEDVDPDNMSYEELIALGEAVGTESKGLNAQSVASLQQFTYVP-DSKD  240

Query  301  GANDS--CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
             + D   CV+CRL+YE G+ +  L CKH YHSECI  WL+ NKVCPVCSAEV+   +S
Sbjct  241  ISTDQEQCVVCRLEYEKGDKMLRLPCKHHYHSECIQQWLQHNKVCPVCSAEVTIESSS  298



>gb|AFA26144.1| E3 ubiquitin ligase big-brother-like protein, partial [Lolium 
perenne]
Length=84

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  379  TESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECIN  200
            TESRGLSADT+ASLPS+ YK+++ QDG  + CVICR+++EDGE+L  L CKHSYH ECIN
Sbjct  1    TESRGLSADTLASLPSVTYKTKDVQDGNTEQCVICRVEFEDGESLVALPCKHSYHPECIN  60

Query  199  NWLRINKVCPVCSAEVSTS  143
             W +INKVCP+CSAEVSTS
Sbjct  61   QWPQINKVCPMCSAEVSTS  79



>gb|KJB12380.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
 gb|KJB12381.1| hypothetical protein B456_002G015500 [Gossypium raimondii]
Length=240

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 107/134 (80%), Gaps = 3/134 (2%)
 Frame = -2

Query  679  VDEEDEDAFDVHAHDEASEDEN-LGIELDPSAFPSDeayaralqeaeeremaarllalAG  503
             D  D DAFD H H E  ED+N   +ELDP+ F SDEAYARALQ+AEERE+AARLLALAG
Sbjct  107  TDAGDVDAFDFHDHSEDGEDDNDASVELDPADFSSDEAYARALQDAEEREVAARLLALAG  166

Query  502  INEGQALSEEDHGQ--NSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSM  329
            IN+G  ++ EDHG   NSQD WEEVDPDELSYEELLAL EV GTESRGLSAD+IASLPS+
Sbjct  167  INDGGTVTLEDHGHGGNSQDTWEEVDPDELSYEELLALAEVAGTESRGLSADSIASLPSL  226

Query  328  NYKSQNTQDGANDS  287
             +K+ N+Q G NDS
Sbjct  227  IFKAGNSQTGTNDS  240



>ref|XP_010413127.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Camelina sativa]
 ref|XP_010413129.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Camelina sativa]
 ref|XP_010413130.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Camelina sativa]
Length=245

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -2

Query  481  SEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQN  311
            +E DH  + Q +W++ +DPD ++YEEL+ LGE VGTESRGLS + I +LP+  YK  S  
Sbjct  126  NEHDHPDSPQVSWQDDIDPDTMTYEELVELGEAVGTESRGLSQELIETLPTRKYKFGSIF  185

Query  310  TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++  A + CVIC+L Y+ GE    L CKH YHSECI+ WL INKVCPVC+ EV
Sbjct  186  SRKRAGERCVICQLKYKIGERQMDLPCKHVYHSECISKWLSINKVCPVCNTEV  238



>ref|XP_008349923.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Malus 
domestica]
Length=246

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 85/127 (67%), Gaps = 9/127 (7%)
 Frame = -2

Query  505  GINEGQALSEE--DHGQNS----QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTI  347
             + E QA+ EE   + QN+    Q AW+E +DPD ++YEELL LGE VGT+SRGLS + I
Sbjct  113  AVMEAQAVPEECIQNQQNTNTSEQVAWQEDIDPDNMTYEELLDLGEAVGTQSRGLSDELI  172

Query  346  ASLPSMNYKSQN--TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVC  173
            + LPS  YK  N   +  + + CVIC++ Y+ G+    L CKH YHSECI+ WL INKVC
Sbjct  173  SLLPSSKYKCGNFFLRKKSGERCVICQMQYKRGDRQITLPCKHVYHSECISKWLGINKVC  232

Query  172  PVCSAEV  152
            PVC+ EV
Sbjct  233  PVCNLEV  239



>ref|XP_009364991.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Pyrus x bretschneideri]
Length=245

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 8/125 (6%)
 Frame = -2

Query  502  INEGQALSEE-----DHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIAS  341
            + E QA+ EE      +   S+ AW+E +DPD ++YEELL LGE VGT+SRGLS + I+ 
Sbjct  114  VMEAQAVPEECIQNQQNTNTSEVAWQEDIDPDTMTYEELLDLGEAVGTQSRGLSEELISL  173

Query  340  LPSMNYKSQN--TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPV  167
            LPS  YK  N   +  + + CVIC++ Y+ G+    L CKH YHSECI+ WL INKVCPV
Sbjct  174  LPSSKYKCGNFFLRKKSGERCVICQMQYKRGDRQITLPCKHVYHSECISKWLGINKVCPV  233

Query  166  CSAEV  152
            C+ EV
Sbjct  234  CNLEV  238



>ref|XP_010512780.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Camelina sativa]
 ref|XP_010512781.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Camelina sativa]
 ref|XP_010512782.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Camelina sativa]
Length=245

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -2

Query  481  SEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQN  311
            +E DH  + Q +W++ +DPD ++YEEL+ LGE VG+ESRGLS + I +LP+  YK  S  
Sbjct  126  NEHDHPDSPQVSWQDDIDPDTMTYEELVELGEAVGSESRGLSQELIETLPTRKYKFGSIF  185

Query  310  TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++  A + CVIC+L Y+ GE    L CKH YHSECI+ WL INKVCPVC+ EV
Sbjct  186  SRKRAGERCVICQLKYKIGERQMDLPCKHVYHSECISKWLSINKVCPVCNTEV  238



>ref|XP_008349929.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Malus 
domestica]
Length=245

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 83/126 (66%), Gaps = 8/126 (6%)
 Frame = -2

Query  505  GINEGQALSEE-----DHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIA  344
             + E QA+ EE      +   S+ AW+E +DPD ++YEELL LGE VGT+SRGLS + I+
Sbjct  113  AVMEAQAVPEECIQNQQNTNTSEVAWQEDIDPDNMTYEELLDLGEAVGTQSRGLSDELIS  172

Query  343  SLPSMNYKSQN--TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCP  170
             LPS  YK  N   +  + + CVIC++ Y+ G+    L CKH YHSECI+ WL INKVCP
Sbjct  173  LLPSSKYKCGNFFLRKKSGERCVICQMQYKRGDRQITLPCKHVYHSECISKWLGINKVCP  232

Query  169  VCSAEV  152
            VC+ EV
Sbjct  233  VCNLEV  238



>ref|XP_010065007.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Eucalyptus 
grandis]
 gb|KCW70633.1| hypothetical protein EUGRSUZ_F03807 [Eucalyptus grandis]
Length=233

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 82/124 (66%), Gaps = 7/124 (6%)
 Frame = -2

Query  484  LSEEDHGQNSQDA--WEEVDPDELSYEELLALGEVVGTESRGLSADTIAS-LPSMNYKSQ  314
            L  ED  QN  D   ++++DPDELSYEEL+ LGE++G E RGLS + I        ++SQ
Sbjct  108  LEGEDSSQNDIDMAEFDDIDPDELSYEELIELGEIIGEERRGLSLEQIGKCFGPFTFQSQ  167

Query  313  NT---QDGANDSCVICRLDYEDGETLTVL-SCKHSYHSECINNWLRINKVCPVCSAEVST  146
            +    + GA D CVIC+++YE+GE L +L SC HSYHSECI  WL++ K CP+CS EVS 
Sbjct  168  SAVERKMGAIDRCVICQIEYEEGEKLVILDSCDHSYHSECITQWLQVKKTCPICSTEVSA  227

Query  145  SGNS  134
               S
Sbjct  228  PKKS  231



>ref|XP_009138675.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X3 [Brassica 
rapa]
Length=204

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = -2

Query  463  QNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGAN  293
            ++ Q +W++ +DPD ++YEEL+ LGE VG+ESRGLS + I +LP+  YK  S  ++  A 
Sbjct  91   ESPQVSWQDDIDPDTMTYEELIELGEAVGSESRGLSQELIETLPTRKYKFGSFFSRKRAG  150

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            D CVIC+L Y+ GE    L CKH YHSECI+ WL INK+CPVC++EV
Sbjct  151  DRCVICQLKYKIGEKQMNLPCKHVYHSECISKWLSINKICPVCNSEV  197



>emb|CDX93901.1| BnaC04g20600D [Brassica napus]
Length=240

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = -2

Query  463  QNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGAN  293
            ++ Q +W++ +DPD ++YEEL+ LGE VG+ESRGLS + I +LP+  YK  S  ++  A 
Sbjct  127  ESPQVSWQDDIDPDTMTYEELIELGEAVGSESRGLSQELIETLPTRKYKFGSFFSRKRAG  186

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            D CVIC+L Y+ GE    L CKH YHSECI+ WL INK+CPVC++EV
Sbjct  187  DRCVICQLKYKIGEKQMNLPCKHVYHSECISKWLNINKICPVCNSEV  233



>ref|XP_009354734.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Pyrus x bretschneideri]
Length=241

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 84/125 (67%), Gaps = 8/125 (6%)
 Frame = -2

Query  502  INEGQALSEE--DHGQN---SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIAS  341
            + E QA  EE   + QN   S+ AW+E +DPD ++YEELL LGE VGT+SRGLS + I+ 
Sbjct  110  VMEAQATPEECIQYQQNTSSSEVAWQEDIDPDNMTYEELLDLGEAVGTQSRGLSDELISL  169

Query  340  LPSMNYKSQN--TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPV  167
            LPS  YK  N   +  + + CVIC++ Y+ G+    L CKH YH+ECI+ WL INKVCPV
Sbjct  170  LPSSKYKCGNFFLRKKSGERCVICQMRYKRGDRQITLPCKHVYHNECISKWLGINKVCPV  229

Query  166  CSAEV  152
            C+ EV
Sbjct  230  CNLEV  234



>ref|XP_009138670.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brassica 
rapa]
 ref|XP_009138671.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brassica 
rapa]
 ref|XP_009138672.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brassica 
rapa]
 ref|XP_009138674.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brassica 
rapa]
 emb|CDY53710.1| BnaAnng12510D [Brassica napus]
Length=242

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = -2

Query  463  QNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGAN  293
            ++ Q +W++ +DPD ++YEEL+ LGE VG+ESRGLS + I +LP+  YK  S  ++  A 
Sbjct  129  ESPQVSWQDDIDPDTMTYEELIELGEAVGSESRGLSQELIETLPTRKYKFGSFFSRKRAG  188

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            D CVIC+L Y+ GE    L CKH YHSECI+ WL INK+CPVC++EV
Sbjct  189  DRCVICQLKYKIGEKQMNLPCKHVYHSECISKWLSINKICPVCNSEV  235



>ref|XP_008231277.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Prunus mume]
Length=245

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 81/118 (69%), Gaps = 3/118 (3%)
 Frame = -2

Query  490  QALSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--  320
            + L  + +   SQ  W+E +DPD ++YEELL LGE VGT+SRGLS + I+ LP+  YK  
Sbjct  123  ECLQNQQNTNTSQVVWQEDIDPDNMTYEELLDLGEAVGTQSRGLSDELISLLPTSKYKCG  182

Query  319  SQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            S  ++  + + CVIC++ Y+ G+    L CKH YHSECI+ WL INKVCPVC+ EVS+
Sbjct  183  SFFSRKKSGERCVICQMRYKRGDRQINLPCKHVYHSECISKWLGINKVCPVCNLEVSS  240



>ref|XP_009138669.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X1 [Brassica 
rapa]
Length=303

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = -2

Query  463  QNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGAN  293
            ++ Q +W++ +DPD ++YEEL+ LGE VG+ESRGLS + I +LP+  YK  S  ++  A 
Sbjct  190  ESPQVSWQDDIDPDTMTYEELIELGEAVGSESRGLSQELIETLPTRKYKFGSFFSRKRAG  249

Query  292  DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            D CVIC+L Y+ GE    L CKH YHSECI+ WL INK+CPVC++EV
Sbjct  250  DRCVICQLKYKIGEKQMNLPCKHVYHSECISKWLSINKICPVCNSEV  296



>ref|XP_010667359.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Beta 
vulgaris subsp. vulgaris]
Length=222

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = -2

Query  439  EVDPDELSYEELLALGEVVGTESRGLSADTI-ASLPSMNYKSQNTQDGANDSCVICRLDY  263
            E+DPDE+SYEEL+ALGE+VG E RGLS + I +S+   N+K   ++    D CVIC+++Y
Sbjct  117  EIDPDEMSYEELMALGEIVGEECRGLSIEEINSSISPYNHKFVQSK-TIIDRCVICQIEY  175

Query  262  EDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            E+GE L  L+C+H +H++CIN WL+I KVCP+CS E++  G
Sbjct  176  EEGEQLVALNCQHPFHTDCINQWLQIKKVCPICSIEITPPG  216



>ref|NP_680148.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana]
 ref|NP_001030922.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana]
 sp|Q8L649.1|BB_ARATH RecName: Full=E3 ubiquitin ligase BIG BROTHER; AltName: Full=Protein 
ENHANCER OF DA1-1 [Arabidopsis thaliana]
 emb|CAD32249.1| putative protein [Arabidopsis thaliana]
 gb|AAQ22666.1| At3g63530 [Arabidopsis thaliana]
 dbj|BAE99660.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80499.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana]
 gb|AEE80500.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana]
Length=248

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGANDSC  284
            Q +W++ +DPD ++YEEL+ LGE VGTESRGLS + I +LP+  YK  S  ++  A + C
Sbjct  138  QVSWQDDIDPDTMTYEELVELGEAVGTESRGLSQELIETLPTKKYKFGSIFSRKRAGERC  197

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+L Y+ GE    L CKH YHSECI+ WL INKVCPVC++EV
Sbjct  198  VICQLKYKIGERQMNLPCKHVYHSECISKWLSINKVCPVCNSEV  241



>ref|XP_009354730.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009354731.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Pyrus 
x bretschneideri]
Length=246

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 83/127 (65%), Gaps = 9/127 (7%)
 Frame = -2

Query  505  GINEGQALSEE--DHGQNS----QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTI  347
             + E QA  EE   + QN+    Q AW+E +DPD ++YEELL LGE VGT+SRGLS + I
Sbjct  113  AVMEAQATPEECIQNQQNTSTSEQVAWQEDIDPDNMTYEELLDLGEAVGTQSRGLSDELI  172

Query  346  ASLPSMNYKSQN--TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVC  173
            + LP   YK  N   +  + + CVIC++ Y+ G+    L CKH YHSECI+ WL INKVC
Sbjct  173  SLLPLSKYKCGNFFLRKKSGERCVICQMQYKRGDRQITLPCKHVYHSECISKWLGINKVC  232

Query  172  PVCSAEV  152
            PVC+ EV
Sbjct  233  PVCNLEV  239



>ref|XP_009354732.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Pyrus 
x bretschneideri]
Length=245

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 83/126 (66%), Gaps = 8/126 (6%)
 Frame = -2

Query  505  GINEGQALSEE--DHGQN---SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIA  344
             + E QA  EE   + QN   S+ AW+E +DPD ++YEELL LGE VGT+SRGLS + I+
Sbjct  113  AVMEAQATPEECIQNQQNTSTSEVAWQEDIDPDNMTYEELLDLGEAVGTQSRGLSDELIS  172

Query  343  SLPSMNYKSQN--TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCP  170
             LP   YK  N   +  + + CVIC++ Y+ G+    L CKH YHSECI+ WL INKVCP
Sbjct  173  LLPLSKYKCGNFFLRKKSGERCVICQMQYKRGDRQITLPCKHVYHSECISKWLGINKVCP  232

Query  169  VCSAEV  152
            VC+ EV
Sbjct  233  VCNLEV  238



>ref|XP_006482888.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X3 [Citrus 
sinensis]
Length=239

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = -2

Query  496  EGQALSEEDHGQNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSM  329
            EG+A+    H Q+S   Q  W++ VDPD ++YEELL LGE VGT+SRGLS + I  LP+ 
Sbjct  112  EGEAVMGSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTS  171

Query  328  NYKSQNT--QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAE  155
             YK  N   +  + + CVIC++ Y+ G+    L C+H YHSECI  WL INK+CP+C+ E
Sbjct  172  KYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKICPICNNE  231

Query  154  V  152
            V
Sbjct  232  V  232



>ref|XP_002878521.1| hypothetical protein ARALYDRAFT_324777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54780.1| hypothetical protein ARALYDRAFT_324777 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGANDSC  284
            Q +W++ +DPD ++YEEL+ LGE VGTESRGLS + I +LP+  YK  S  ++  A + C
Sbjct  137  QVSWQDDIDPDTMTYEELVELGEAVGTESRGLSQELIETLPTRKYKFGSIFSRKRAGERC  196

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+L Y+ G+    L CKH YHSECI+ WL INKVCPVC++EV
Sbjct  197  VICQLKYKIGDRQMNLPCKHVYHSECISKWLSINKVCPVCNSEV  240



>ref|XP_006292296.1| hypothetical protein CARUB_v10018505mg [Capsella rubella]
 gb|EOA25194.1| hypothetical protein CARUB_v10018505mg [Capsella rubella]
Length=243

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGANDSC  284
            Q +W++ +DPD ++YEEL+ LGE VGTESRGLS + I +LP+  +K  S  ++  A + C
Sbjct  133  QVSWQDDIDPDTMTYEELVELGEAVGTESRGLSQELIETLPTRKFKFGSIFSRKRAGERC  192

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+L Y+ GE    L CKH YHSECI+ WL INKVCPVC+ EV
Sbjct  193  VICQLKYKIGERQMNLPCKHVYHSECISKWLSINKVCPVCNTEV  236



>ref|XP_007218202.1| hypothetical protein PRUPE_ppa010554mg [Prunus persica]
 gb|EMJ19401.1| hypothetical protein PRUPE_ppa010554mg [Prunus persica]
Length=245

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 79/115 (69%), Gaps = 3/115 (3%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQ  314
            +  + +   SQ  W+E +DPD ++YEELL LGE VGT+SRGLS + I+ LP+  YK  S 
Sbjct  125  IQNQQNTNTSQVVWQEDIDPDNMTYEELLDLGEAVGTQSRGLSDELISLLPTSKYKCGSF  184

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVS  149
             ++  + + CVIC++ Y+ G+    L CKH YHSECI+ WL INKVCPVC+ EVS
Sbjct  185  FSRKKSGERCVICQMRYKRGDRQINLPCKHVYHSECISKWLGINKVCPVCNLEVS  239



>ref|XP_002983644.1| hypothetical protein SELMODRAFT_19194, partial [Selaginella moellendorffii]
 ref|XP_002990568.1| hypothetical protein SELMODRAFT_19193, partial [Selaginella moellendorffii]
 gb|EFJ08445.1| hypothetical protein SELMODRAFT_19193, partial [Selaginella moellendorffii]
 gb|EFJ15140.1| hypothetical protein SELMODRAFT_19194, partial [Selaginella moellendorffii]
Length=92

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 66/92 (72%), Gaps = 3/92 (3%)
 Frame = -2

Query  445  WEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGA---NDSCVIC  275
            W++VDPD +SYEEL+ALG+ VG ESRGLS+D IA LP  +YK  +T       ++ CVIC
Sbjct  1    WQDVDPDHMSYEELVALGDAVGVESRGLSSDAIAELPVTSYKRGHTGGSTSSDSEQCVIC  60

Query  274  RLDYEDGETLTVLSCKHSYHSECINNWLRINK  179
            R DYE+ E L  L CKH YHSECI  WL+INK
Sbjct  61   RHDYEEDEMLLTLPCKHKYHSECIQQWLQINK  92



>ref|XP_008375171.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Malus domestica]
 ref|XP_008375172.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Malus domestica]
Length=247

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = -2

Query  460  NSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--TQDGAND  290
             S+ AW+E +DPD ++YEELL LGE VGT+SRGLS + I+ LP   YK  N   +  + +
Sbjct  135  TSEVAWQEDIDPDNMTYEELLDLGEAVGTQSRGLSDELISLLPLSKYKCGNFFLRKKSGE  194

Query  289  SCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
             CVIC++ Y+ G+    L CKH YHSECI+ WL INKVCPVC+ EV
Sbjct  195  RCVICQMQYKRGDRQITLPCKHVYHSECISKWLGINKVCPVCNLEV  240



>ref|XP_002531910.1| protein binding protein, putative [Ricinus communis]
 gb|EEF30483.1| protein binding protein, putative [Ricinus communis]
Length=240

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 75/108 (69%), Gaps = 3/108 (3%)
 Frame = -2

Query  466  GQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPS--MNYKSQNTQDGA  296
            G + Q  W++ VDPD ++YEELL LGE VGT+SRGLS + I+ LP+    ++S   +  A
Sbjct  126  GDSPQGVWQDDVDPDNMTYEELLDLGETVGTQSRGLSQELISLLPTSKCKFRSFFLRKKA  185

Query  295  NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
             + CVIC++ Y+ G+    L CKH YHSECI+ WL INKVCPVC+ EV
Sbjct  186  GERCVICQMRYKRGDKQMKLPCKHVYHSECISKWLGINKVCPVCNNEV  233



>gb|ABR17882.1| unknown [Picea sitchensis]
Length=249

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 71/105 (68%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEEV-DPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDS  287
            SQ  W+++ DPD ++YEEL+ LGE VGT +RGL  D I+SLP   YK++  + +   +D 
Sbjct  143  SQGTWQDIIDPDNMTYEELVELGEAVGTHNRGLCPDLISSLPVSKYKTKLFSRRKNRDDQ  202

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC ++Y+ G+ +  L CKH YH+ CI  WL INK CPVC  EV
Sbjct  203  CVICHMNYKRGDRMITLPCKHPYHAVCITRWLHINKACPVCYVEV  247



>ref|XP_003558702.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Brachypodium 
distachyon]
Length=251

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = -2

Query  463  QNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQD  302
            QNS   Q  W++ VDPD ++YEELL LGE VGT+SRGLS + I+SLP   YK    + + 
Sbjct  134  QNSSSPQVVWQDNVDPDNMTYEELLDLGEAVGTQSRGLSQERISSLPVTKYKCGFFSRKK  193

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
               + CVIC+++Y  G+    L CKH YH+ C+  WL INKVCPVC AEV +
Sbjct  194  TRRERCVICQMEYRRGDLQMALPCKHVYHASCVTRWLSINKVCPVCFAEVPS  245



>ref|XP_010536033.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Tarenaya 
hassleriana]
Length=255

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 74/125 (59%), Gaps = 3/125 (2%)
 Frame = -2

Query  499  NEGQALSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNY  323
            N  + L    +G + Q  W++ +DPD ++YEELL LGE VGT+SRGLS D I+ LP   Y
Sbjct  129  NSVECLRRHPNGDDFQMVWQDTLDPDNMTYEELLELGETVGTQSRGLSQDIISRLPVSKY  188

Query  322  KSQ--NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVS  149
            K      +    D CVIC+++Y+  E +  L C H+YH +C   WL INK CP+C  EVS
Sbjct  189  KCSLFTRKKSGKDRCVICQMEYKRRERMITLPCTHAYHVDCGTKWLSINKACPICYTEVS  248

Query  148  TSGNS  134
                S
Sbjct  249  VGAKS  253



>emb|CBI18994.3| unnamed protein product [Vitis vinifera]
Length=188

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 4/113 (4%)
 Frame = -2

Query  475  EDHGQNSQDAWEE--VDPDELSYEELLALGEVVGTESRGLSADTI-ASLPSMNYKSQNTQ  305
            E  G NS    EE  +DPD+LSYEEL+ALGE+VG ESRGLS + I ASL      S  ++
Sbjct  75   EGEGSNSDQDMEEDDIDPDQLSYEELIALGEIVGEESRGLSMEEISASLRPYTCHSLRSK  134

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
              A D CVIC+++YE+ E L  L C+H YH++CI  WL+I K CP+CS EVS+
Sbjct  135  -TAVDRCVICQVEYEEEEKLVALPCEHPYHADCITKWLQIKKTCPICSTEVSS  186



>ref|XP_008778611.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Phoenix dactylifera]
Length=153

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSC  284
            Q  W++ +DPD ++YEELL LGE VGT+SRGLS + I+SLP   YK    + +    + C
Sbjct  42   QVIWQDNIDPDIMTYEELLDLGEAVGTQSRGLSEEHISSLPVTKYKCSFFSRKKKRGERC  101

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC++DY+ G+   +L CKH YH+ C+  WL INK CP+C AEV
Sbjct  102  VICQMDYKRGDRQMILPCKHVYHAGCVTRWLGINKACPICFAEV  145



>ref|XP_010664190.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Vitis vinifera]
Length=189

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 4/113 (4%)
 Frame = -2

Query  475  EDHGQNSQDAWEE--VDPDELSYEELLALGEVVGTESRGLSADTI-ASLPSMNYKSQNTQ  305
            E  G NS    EE  +DPD+LSYEEL+ALGE+VG ESRGLS + I ASL      S  ++
Sbjct  76   EGEGSNSDQDMEEDDIDPDQLSYEELIALGEIVGEESRGLSMEEISASLRPYTCHSLRSK  135

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
              A D CVIC+++YE+ E L  L C+H YH++CI  WL+I K CP+CS EVS+
Sbjct  136  -TAVDRCVICQVEYEEEEKLVALPCEHPYHADCITKWLQIKKTCPICSTEVSS  187



>ref|XP_006439127.1| hypothetical protein CICLE_v10032570mg [Citrus clementina]
 gb|ESR52367.1| hypothetical protein CICLE_v10032570mg [Citrus clementina]
Length=245

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT--QDGANDS  287
            SQ  W++ VDPD ++YEELL LGE VGT+SRGLS + I  LP+  YK  N   +  + + 
Sbjct  134  SQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFGNLFLRKRSGER  193

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC++ Y+ G+    L C+H YHSECI  WL INK+CP+C+ EV
Sbjct  194  CVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKICPICNNEV  238



>ref|XP_009394740.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009394741.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X3 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009394742.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=249

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDS  287
            SQ  W + +DPD ++YEELL LGE +GT SRGL+ + IASLP   YK    + +   ++ 
Sbjct  138  SQVIWHDNIDPDNMTYEELLELGEAIGTHSRGLTQERIASLPVKKYKCSLFSKKKTRHER  197

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC++ Y  G+   +L CKHSYHS C+  WL INK CP+C  EV
Sbjct  198  CVICQMKYRRGDRQMILPCKHSYHSVCVTRWLNINKACPICFVEV  242



>emb|CDP07764.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 4/116 (3%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN-  311
            ++++D G  +Q  WE+ +DPD ++YEELL LGE VGTE+RGLS + I  LP+  YKS   
Sbjct  143  INQQDSG-GTQAVWEDNIDPDNMTYEELLELGEAVGTENRGLSQELIDLLPTSKYKSGGI  201

Query  310  -TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
             ++  + + CVIC++ Y+ G+    L CKH YH+ C + WLRINK CP+C+ EVS+
Sbjct  202  FSKKRSTERCVICQMRYKRGDRQINLPCKHVYHAHCGSKWLRINKTCPICNTEVSS  257



>ref|XP_006482886.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Citrus 
sinensis]
 ref|XP_006482887.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Citrus 
sinensis]
Length=247

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNT--QDGANDS  287
            SQ  W++ VDPD ++YEELL LGE VGT+SRGLS + I  LP+  YK  N   +  + + 
Sbjct  136  SQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFGNLFLRKRSGER  195

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC++ Y+ G+    L C+H YHSECI  WL INK+CP+C+ EV
Sbjct  196  CVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKICPICNNEV  240



>gb|KGN45134.1| hypothetical protein Csa_7G428220 [Cucumis sativus]
Length=248

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWE-EVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQ  314
            LS  +    SQ  W+ E+DPD ++YEELL LGE VGTESRGLS + I+ LP+   K  S 
Sbjct  122  LSHREETSTSQVTWQDEIDPDHMTYEELLDLGESVGTESRGLSEEQISLLPTARCKLTSF  181

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
             ++   ++ CVIC++ Y+ G+    L CKH YH++CI  WL INK+CP+C+ EV   G++
Sbjct  182  FSRKKLDERCVICQMRYKRGDKQIKLPCKHFYHNKCITKWLTINKICPICNIEVFGDGST  241



>ref|XP_008461284.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X2 [Cucumis 
melo]
Length=248

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWE-EVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQ  314
            LS  +    SQ  W+ E+DPD ++YEELL LGE VGTESRGLS + I+ LP+   K  S 
Sbjct  122  LSHREETSTSQVTWQDEIDPDHMTYEELLDLGESVGTESRGLSEEQISLLPTARCKLTSF  181

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
             ++   ++ CVIC++ Y+ G+    L CKH YH++CI  WL INK+CP+C+ EV   G++
Sbjct  182  FSRKKLDERCVICQMRYKRGDKQIKLPCKHFYHNKCITKWLTINKICPICNIEVFGDGST  241



>ref|XP_008461282.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X1 [Cucumis 
melo]
 ref|XP_008461283.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X1 [Cucumis 
melo]
Length=254

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 79/120 (66%), Gaps = 3/120 (3%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWE-EVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQ  314
            LS  +    SQ  W+ E+DPD ++YEELL LGE VGTESRGLS + I+ LP+   K  S 
Sbjct  128  LSHREETSTSQVTWQDEIDPDHMTYEELLDLGESVGTESRGLSEEQISLLPTARCKLTSF  187

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
             ++   ++ CVIC++ Y+ G+    L CKH YH++CI  WL INK+CP+C+ EV   G++
Sbjct  188  FSRKKLDERCVICQMRYKRGDKQIKLPCKHFYHNKCITKWLTINKICPICNIEVFGDGST  247



>ref|XP_002468417.1| hypothetical protein SORBIDRAFT_01g045580 [Sorghum bicolor]
 gb|EER95415.1| hypothetical protein SORBIDRAFT_01g045580 [Sorghum bicolor]
Length=249

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = -2

Query  448  AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSCVI  278
             W++ +DPD ++YEELL LGEVVGT+SRGLS + I+SLP   YK    + +    + CVI
Sbjct  140  VWQDNIDPDNMTYEELLDLGEVVGTQSRGLSQERISSLPVTKYKCGFFSRKKTRRERCVI  199

Query  277  CRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            C+++Y  G     L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  200  CQMEYRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEV  241



>ref|XP_010229112.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER isoform X1 [Brachypodium 
distachyon]
Length=252

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = -2

Query  463  QNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK---SQNTQ  305
            QNS   Q  W++ VDPD ++YEELL LGE VGT+SRGLS + I+SLP   YK       +
Sbjct  134  QNSSSPQVVWQDNVDPDNMTYEELLDLGEAVGTQSRGLSQERISSLPVTKYKCGFFSRKK  193

Query  304  DGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
                  CVIC+++Y  G+    L CKH YH+ C+  WL INKVCPVC AEV +
Sbjct  194  TRRESRCVICQMEYRRGDLQMALPCKHVYHASCVTRWLSINKVCPVCFAEVPS  246



>ref|XP_009396390.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDS  287
            SQ  W++ VDPD ++YEELL LGE VGT+SRGL+ + IASLP   YK    + +    + 
Sbjct  136  SQVIWQDNVDPDNMTYEELLELGETVGTQSRGLTQECIASLPVTKYKCSFFSRKKSQRER  195

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC+ +Y+ G+   +L CKH YHS C+  WL I KVCP+C AEV
Sbjct  196  CVICQKEYKRGDRQIILPCKHVYHSTCVTRWLGIKKVCPICLAEV  240



>ref|XP_009394739.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=263

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDS  287
            SQ  W + +DPD ++YEELL LGE +GT SRGL+ + IASLP   YK    + +   ++ 
Sbjct  152  SQVIWHDNIDPDNMTYEELLELGEAIGTHSRGLTQERIASLPVKKYKCSLFSKKKTRHER  211

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC++ Y  G+   +L CKHSYHS C+  WL INK CP+C  EV
Sbjct  212  CVICQMKYRRGDRQMILPCKHSYHSVCVTRWLNINKACPICFVEV  256



>ref|XP_009394737.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009394738.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=265

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDS  287
            SQ  W + +DPD ++YEELL LGE +GT SRGL+ + IASLP   YK    + +   ++ 
Sbjct  154  SQVIWHDNIDPDNMTYEELLELGEAIGTHSRGLTQERIASLPVKKYKCSLFSKKKTRHER  213

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC++ Y  G+   +L CKHSYHS C+  WL INK CP+C  EV
Sbjct  214  CVICQMKYRRGDRQMILPCKHSYHSVCVTRWLNINKACPICFVEV  258



>ref|XP_004251782.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Solanum 
lycopersicum]
Length=179

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = -2

Query  430  PDELSYEELLALGEVVGTESRGLSADTI-ASLPSMNYKSQNTQDGANDSCVICRLDYEDG  254
            PDELSYEEL+ALGE VG E+RGL+ + I  SL S  ++S N++   N  CV+C+L+YE+G
Sbjct  78   PDELSYEELIALGEFVGVENRGLTEEEINKSLHSSTFQSNNSKTLVN-KCVVCQLEYEEG  136

Query  253  ETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            E L  L C H YH +CI  WL+I KVCP+CS EVS++ 
Sbjct  137  EKLVALPCDHPYHLDCIKKWLQIKKVCPICSDEVSSTN  174



>ref|XP_011027491.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Populus 
euphratica]
Length=210

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = -2

Query  421  LSYEELLALGEVVGTESRGLSADTI-ASLPSMNYKSQNTQDGANDSCVICRLDYEDGETL  245
            LSYE+L+ALGE +G E RGLS + I A L   NY+S  ++ G  D CVIC+++YE+ E+L
Sbjct  114  LSYEDLIALGEFIGQEKRGLSRNEISACLRPCNYESSASKTGT-DRCVICQMEYEEDESL  172

Query  244  TVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
              LSC H YHSECI NWL+INK+CP+C+ EVS+
Sbjct  173  VALSCDHPYHSECITNWLQINKICPICTTEVSS  205



>ref|XP_006350142.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Solanum 
tuberosum]
Length=177

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = -2

Query  430  PDELSYEELLALGEVVGTESRGLSADTI-ASLPSMNYKSQNTQDGANDSCVICRLDYEDG  254
            PDELSYEEL+ALGE VG E+RGL+ + I  SL S  ++S N++    D CV+C+L+YE+G
Sbjct  76   PDELSYEELIALGEFVGVENRGLTEEEINKSLHSSTFQSNNSKTLV-DKCVVCQLEYEEG  134

Query  253  ETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSG  140
            E L  L C H YH +CI  WL+I KVCP+CS EVS++ 
Sbjct  135  EKLVALPCDHPYHLDCIKKWLQIKKVCPICSDEVSSTN  172



>gb|KHG02120.1| E3 ubiquitin ligase BIG BROTHER -like protein [Gossypium arboreum]
Length=249

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QN+QD    W++ VDPD ++YEELL LGE VGT+SRGLS + I+ LP   YK    + + 
Sbjct  133  QNAQDYQVIWQDGVDPDNMTYEELLELGETVGTQSRGLSQELISLLPVSKYKCSLFSRKK  192

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
              N+ CVIC+++Y+ GE    L CKH YH+ C N WL INK CP+C  EV
Sbjct  193  SRNERCVICQMEYKRGERQITLPCKHVYHAGCGNRWLSINKACPICYTEV  242



>ref|XP_010032421.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Eucalyptus grandis]
 ref|XP_010032422.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Eucalyptus grandis]
 ref|XP_010032423.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Eucalyptus grandis]
 gb|KCW51819.1| hypothetical protein EUGRSUZ_J01268 [Eucalyptus grandis]
Length=243

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--TQDGANDS  287
            SQ  W++ +DPD ++YEELL LGE +GT+++GLS + I+ LP+  YK     T+  + + 
Sbjct  135  SQAVWQDNIDPDNMTYEELLDLGEAIGTQNKGLSQELISMLPTSKYKLGGFFTRKKSGER  194

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC++ Y+ G+    L CKH+YH ECI  WL INK+CPVC+ EV
Sbjct  195  CVICQMRYKIGDRRIKLPCKHAYHGECITKWLGINKICPVCNVEV  239



>gb|KJB21876.1| hypothetical protein B456_004G019200 [Gossypium raimondii]
 gb|KJB21877.1| hypothetical protein B456_004G019200 [Gossypium raimondii]
 gb|KJB21878.1| hypothetical protein B456_004G019200 [Gossypium raimondii]
Length=249

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QN+QD    W++ VDPD ++YEELL LGE VGT+SRGLS + I+ LP   YK    + + 
Sbjct  133  QNAQDYQVIWQDGVDPDNMTYEELLELGETVGTQSRGLSQELISLLPVSKYKCSLFSRKK  192

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
              N+ CVIC+++Y+ GE    L CKH YH+ C N WL INK CP+C  EV
Sbjct  193  SRNERCVICQMEYKRGERQITLPCKHVYHAGCGNRWLSINKACPICYTEV  242



>ref|XP_007137421.1| hypothetical protein PHAVU_009G125700g [Phaseolus vulgaris]
 gb|ESW09415.1| hypothetical protein PHAVU_009G125700g [Phaseolus vulgaris]
Length=202

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -2

Query  430  PDELSYEELLALGEVVGTESRGLSADTIA-SLPSMNYKSQNTQDGANDSCVICRLDYEDG  254
            PDELSYEEL+ LGE +G E+RGLSA+ I+  L    Y   + + G  D CVIC+++YEDG
Sbjct  101  PDELSYEELMELGEFIGEETRGLSANEISLCLNPYTYYCADRKIGI-DRCVICQVEYEDG  159

Query  253  ETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            E L  L C+H YH++CI+ WL+I KVCP+CS EVST
Sbjct  160  EALVALQCEHPYHADCISKWLQIKKVCPICSNEVST  195



>ref|XP_010936603.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Elaeis guineensis]
 ref|XP_010936604.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Elaeis guineensis]
Length=251

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 7/106 (7%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK----SQNTQDGAND  290
            Q  W++ +DPD ++YEELL LGE VGT+SRGLS + I+SLP   YK    S+  + G  +
Sbjct  140  QVIWQDNIDPDIMTYEELLDLGEAVGTQSRGLSEERISSLPVTKYKCSFFSRKKKRG--E  197

Query  289  SCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
             CVIC++DY+ G+   +L CKH YH+ C+  WL INK CP+C AEV
Sbjct  198  RCVICQMDYKRGDRQMILPCKHVYHAGCVTRWLGINKACPICFAEV  243



>ref|XP_007052540.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007052541.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96697.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96698.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=242

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 1/104 (1%)
 Frame = -2

Query  460  NSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSC  284
            NSQ  W++ +DPD ++YEELL LGE +G++SRGLS + I  LP+   K  +      + C
Sbjct  132  NSQVVWQDNIDPDNMTYEELLDLGETIGSQSRGLSQELIDLLPTSKCKFGSFFSTKRERC  191

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC++ Y+ GE    L CKH YHS+CI  WL INK+CPVC+ EV
Sbjct  192  VICQMRYKRGEQQMKLPCKHVYHSQCITKWLSINKICPVCNNEV  235



>ref|XP_010255520.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Nelumbo nucifera]
 ref|XP_010255521.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Nelumbo nucifera]
Length=243

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = -2

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSCVICRLDY  263
            VDPD ++YEEL +LGE +GTESRGLS + I  LPS+ YK+    ++   ++ CVIC ++Y
Sbjct  145  VDPDNMAYEELQSLGEAIGTESRGLSEELIDYLPSIKYKTGCFFSRKDKHEQCVICYMEY  204

Query  262  EDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++ E LT+L C+H YHS+CI  WL++ K CPVC  EV
Sbjct  205  KNREKLTILPCQHQYHSKCITVWLKLKKACPVCGEEV  241



>gb|EMT12530.1| RING finger protein 44 [Aegilops tauschii]
Length=295

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNS   Q  W++ +DPD ++YEELL LGE VGT+SRGLS ++I++LP   +K    + + 
Sbjct  178  QNSSSPQVVWQDSIDPDNMTYEELLDLGEAVGTQSRGLSQESISALPVTKFKCGLFSRKK  237

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
               + CVIC+++Y  G+    L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  238  KRRERCVICQMEYRRGDLQMALPCKHVYHASCVTKWLTINKVCPVCFAEV  287



>ref|XP_011003433.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Populus 
euphratica]
Length=206

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -2

Query  421  LSYEELLALGEVVGTESRGLSADTIAS-LPSMNYKSQNTQDGANDSCVICRLDYEDGETL  245
            LSYEEL+ALGE +G E RGLS + I++ L    Y+S  T+ G  D CVIC+++YE+ E+L
Sbjct  107  LSYEELIALGEFIGQEKRGLSVNEISTCLHPWKYRSLATKTGT-DLCVICQMEYEEDESL  165

Query  244  TVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
              LSC H YHSEC+  WL+IN++CP+CS EVS+  N
Sbjct  166  VALSCDHPYHSECLTKWLQINRICPICSTEVSSPRN  201



>ref|XP_004306531.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Fragaria vesca subsp. 
vesca]
 ref|XP_011468817.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Fragaria vesca subsp. 
vesca]
 ref|XP_011468818.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Fragaria vesca subsp. 
vesca]
 ref|XP_011468819.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Fragaria vesca subsp. 
vesca]
Length=245

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 77/116 (66%), Gaps = 3/116 (3%)
 Frame = -2

Query  490  QALSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--  320
            +++  + +   SQ  WEE +DPD ++YEELL LGE VGT+SRGLS + I+ LP+  YK  
Sbjct  123  ESIPNDQNTTTSQVEWEENIDPDNMTYEELLDLGEAVGTQSRGLSDELISMLPTTKYKCG  182

Query  319  SQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            S  ++  + + CVIC+  Y+ G     L C H YHS+CI+ WL INK+CPVC+ EV
Sbjct  183  SFFSRKKSGERCVICQARYKRGARQIKLPCNHLYHSKCISKWLGINKICPVCNLEV  238



>ref|XP_010664189.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X1 
[Vitis vinifera]
Length=207

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = -2

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTI-ASLPSMNYKSQNTQDGANDSCVICRLDYE  260
            +DPD+LSYEEL+ALGE+VG ESRGLS + I ASL      S  ++  A D CVIC+++YE
Sbjct  109  IDPDQLSYEELIALGEIVGEESRGLSMEEISASLRPYTCHSLRSK-TAVDRCVICQVEYE  167

Query  259  DGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            + E L  L C+H YH++CI  WL+I K CP+CS EVS+
Sbjct  168  EEEKLVALPCEHPYHADCITKWLQIKKTCPICSTEVSS  205



>gb|AIZ68183.1| E3 ubiquitin ligase BIG BROTHER-like protein [Ornithogalum saundersiae]
Length=251

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSC  284
            Q  W++ +DPD ++YEELL LGE VGT+SRGLS D I+ LP   +K    + +    + C
Sbjct  140  QVIWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQDKISLLPVKKFKCSLFSRKKSRRERC  199

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC++DY+ G+    L CKH YHS C++ WL INK CPVC  EV
Sbjct  200  VICQMDYKRGDRQMTLPCKHVYHSSCVSRWLSINKACPVCFTEV  243



>dbj|BAK04699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNS   Q  W++ +DPD ++YEELL LGE VGT+SRGLS ++I++LP   +K    + + 
Sbjct  133  QNSSSPQVVWQDSIDPDNMTYEELLDLGEAVGTQSRGLSQESISALPVTKFKCGFFSRKK  192

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
               + CV+C+++Y  G+    L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  193  KRRERCVVCQMEYRRGDLQMALPCKHVYHASCVTKWLTINKVCPVCFAEV  242



>ref|XP_011101177.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Sesamum 
indicum]
Length=246

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -2

Query  499  NEGQALSEED-HGQNSQDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNY  323
            N G A +E    G++     +E+DPD ++YEEL  LGE VG+ESRGL AD I+ LP+  Y
Sbjct  124  NTGSASTESPIRGESQNIRQDEIDPDNMTYEELQLLGESVGSESRGLPADLISRLPTFKY  183

Query  322  KS---QNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            KS      +    + CVIC  +Y+ G  LT L C H YHS CIN WL++NK CP+C  EV
Sbjct  184  KSGLFSKKKKKEKEECVICCAEYKHGAKLTALPCAHQYHSHCINPWLQLNKQCPICQKEV  243



>ref|XP_010695299.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Beta vulgaris subsp. 
vulgaris]
Length=250

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = -2

Query  448  AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--TQDGANDSCVI  278
            AW++ +DPD ++YEELL LGE VGT+SRGLS + I SLP+  YK+    ++  + D CVI
Sbjct  142  AWQDDIDPDNMTYEELLDLGEAVGTQSRGLSQELIKSLPTSRYKAGGFFSRKKSRDRCVI  201

Query  277  CRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            C + Y+ G+    L CKH YHS+C   WL INK CPVC+ EV
Sbjct  202  CLVTYKIGDQQMTLPCKHVYHSKCSRKWLSINKTCPVCNCEV  243



>dbj|BAG92476.1| unnamed protein product [Oryza sativa Japonica Group]
Length=254

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -2

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ-NTQDGANDSCVICRLDYE  260
            +DPD ++YEEL  LGE +GTES+GL  D IA LP+  YK +  ++   +D CVIC + Y+
Sbjct  154  IDPDNMTYEELQQLGEAIGTESKGLPEDVIALLPTSTYKIRIFSRKEKHDECVICCMTYK  213

Query  259  DGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            + + LT L C+H YH  C+  WL+INKVCPVC+ EV  SG 
Sbjct  214  NRDRLTKLPCEHQYHQTCVTKWLKINKVCPVCNKEVYGSGK  254



>ref|XP_008800799.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Phoenix dactylifera]
Length=254

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = -2

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN-TQDGANDSCVICRLDYE  260
            VDPD ++YEEL +LGE +G+E RGLS + I+ LPS  YK+   ++ G ++ CVIC+  Y+
Sbjct  157  VDPDNMTYEELQSLGEAIGSEGRGLSDELISYLPSSRYKTGFFSRKGKHEECVICQSTYK  216

Query  259  DGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            + + L  L CKH YHS+CI++WL+INK CPVC+ EV
Sbjct  217  NRDKLITLPCKHYYHSKCISHWLKINKACPVCNEEV  252



>gb|EMS63320.1| E3 ubiquitin ligase BIG BROTHER [Triticum urartu]
Length=305

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNS   Q  W++ +DPD ++YEELL LGE VGT+SRGLS ++I++LP   +K    + + 
Sbjct  188  QNSSSPQVVWQDSIDPDNMTYEELLDLGEAVGTQSRGLSQESISALPITKFKCGLFSRKK  247

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
               + CVIC+++Y  G+    L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  248  KRRERCVICQMEYRRGDLQMALPCKHVYHASCVTKWLTINKVCPVCFAEV  297



>emb|CAH67282.1| OSIGBa0111L12.9 [Oryza sativa Indica Group]
Length=254

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -2

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ-NTQDGANDSCVICRLDYE  260
            +DPD ++YEEL  LGE +GTES+GL  D IA LP+  YK +  ++   +D CVIC + Y+
Sbjct  154  IDPDNMTYEELQQLGEAIGTESKGLPEDVIALLPTSTYKIRIFSRKEKHDECVICCMTYK  213

Query  259  DGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            + + LT L C+H YH  C+  WL+INKVCPVC+ EV  SG 
Sbjct  214  NRDRLTKLPCEHQYHQTCVTKWLKINKVCPVCNKEVYGSGK  254



>ref|XP_007014997.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007014998.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY32616.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY32617.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=248

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 3/112 (3%)
 Frame = -2

Query  478  EEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NT  308
             + +G + Q  W++ VDPD ++YEELL LGE VGT+SRGLS + I+ LP   YK    + 
Sbjct  130  RQHNGLDYQVVWQDSVDPDNMTYEELLELGETVGTQSRGLSQELISLLPVSKYKCSLFSR  189

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            +   N+ CVIC+++Y+ GE    L CKH YH+ C + WL INK CP+C  EV
Sbjct  190  KKSRNERCVICQMEYKRGERRITLPCKHVYHAGCGSRWLSINKACPICYTEV  241



>ref|XP_004985526.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Setaria italica]
Length=249

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSC  284
            Q  W++ +DPD ++YEELL LGE VGT+SRGLS + I+ LP   YK    + +    + C
Sbjct  138  QVVWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQERISLLPVTKYKCGFFSRKKTRRERC  197

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y  G     L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  198  VICQMEYRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEV  241



>ref|XP_008651491.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Zea mays]
 gb|ACN31149.1| unknown [Zea mays]
 tpg|DAA43637.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=253

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSC  284
            Q  W++ ++PD ++YEELL LGE VGT+SRGLS + I+SLP   YK    + +    + C
Sbjct  138  QVVWQDNIEPDNMTYEELLDLGEAVGTQSRGLSQERISSLPVTKYKCGFFSRKKTRRERC  197

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y  G     L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  198  VICQMEYRRGNLQMTLPCKHVYHASCVTRWLGINKVCPVCFAEV  241



>ref|NP_001148727.1| LOC100282343 [Zea mays]
 gb|ACG32668.1| protein binding protein [Zea mays]
Length=253

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 69/104 (66%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSC  284
            Q  W++ ++PD ++YEELL LGE VGT+SRGLS + I+SLP   YK    + +    + C
Sbjct  138  QVVWQDNIEPDNMTYEELLDLGEAVGTQSRGLSQERISSLPVTKYKCGFFSRKKTCRERC  197

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y  G     L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  198  VICQMEYRRGNLQMTLPCKHVYHASCVTRWLGINKVCPVCFAEV  241



>ref|XP_008227150.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Prunus mume]
Length=252

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNSQD    W++ +DPD ++YEELL LGE VGT+SRGLS D I+ LP   YK    + + 
Sbjct  134  QNSQDYQVIWQDNIDPDSMTYEELLELGEAVGTQSRGLSQDQISLLPISKYKCSFFSRKK  193

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
              +D CVIC+++Y+ G+    L CKH YH+ C   WL INK CP+C  EV
Sbjct  194  SRDDGCVICQMEYKRGDRRITLPCKHLYHAGCGTRWLSINKACPICYTEV  243



>ref|XP_004290892.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Fragaria 
vesca subsp. vesca]
Length=216

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 76/120 (63%), Gaps = 9/120 (8%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWEE-----VDPDELSYEELLALGEVVGTESRGLSADTIAS-LPSMNY  323
            L E+++G  S    EE     +D DEL+YEELLALGE +G E RGL ++ I++ L    Y
Sbjct  84   LLEDENGSGSDQEMEEDDFGDLDVDELTYEELLALGEFIGVEKRGLPSNEISTCLHPHTY  143

Query  322  KSQNTQDGAN---DSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            +        N   D CV+C+ +YEDGE L  L C+HSYH ECI+NWL+I K CP+CS EV
Sbjct  144  RLSPVHQSKNSVIDKCVVCQYEYEDGEALAALPCEHSYHLECISNWLQIKKCCPICSTEV  203



>ref|NP_001049123.1| Os03g0173900 [Oryza sativa Japonica Group]
 gb|ABF94247.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11037.1| Os03g0173900 [Oryza sativa Japonica Group]
 dbj|BAG88942.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNS   Q  W++ +DPD ++YEELL LGE VGT+SRGLS + I+ LP   YK    + + 
Sbjct  133  QNSSSPQVIWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQERISLLPVTKYKCGFFSRKK  192

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
               + CVIC+++Y  G     L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  193  TRRERCVICQMEYRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEV  242



>ref|XP_004502478.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X8 [Cicer arietinum]
Length=260

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -2

Query  430  PDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAN-DSCVICRLDYEDG  254
            PDELSYEEL+ LGE++G E RGLSA+ I+S  + +Y SQ  +  +  D CVIC+++YE G
Sbjct  159  PDELSYEELIELGELIGDEKRGLSANEISSCLN-SYTSQTAESKSGIDRCVICQIEYEKG  217

Query  253  ETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            E L  L C H YH +CI+ WL+I KVCP+CS EVST
Sbjct  218  EALVALQCDHPYHKDCISKWLQIKKVCPICSNEVST  253



>ref|XP_007133839.1| hypothetical protein PHAVU_011G213300g [Phaseolus vulgaris]
 gb|ESW05833.1| hypothetical protein PHAVU_011G213300g [Phaseolus vulgaris]
Length=246

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 76/127 (60%), Gaps = 9/127 (7%)
 Frame = -2

Query  505  GINEGQALSEE------DHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTI  347
            G+   Q + EE      +   +SQ  W++ +DPD ++YEELL LGE VGT+SRGLS + I
Sbjct  113  GVTSIQTIPEECSPNHLESNSSSQVIWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQELI  172

Query  346  ASLPSMNYK--SQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVC  173
              LP+  YK  S   +  +   CVIC++ Y  G+    L C H YHSECI  WL INK C
Sbjct  173  DMLPTSKYKFGSLFKRKNSGKRCVICQMTYRRGDQQMKLPCSHVYHSECITKWLSINKKC  232

Query  172  PVCSAEV  152
            PVC+ EV
Sbjct  233  PVCNTEV  239



>gb|KDP43466.1| hypothetical protein JCGZ_16753 [Jatropha curcas]
Length=238

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPS--MNYKSQNTQDGANDSC  284
            Q  W++ VDPD ++YEELL LGE VGT+SRGLS + I+ LP+    +    ++  A + C
Sbjct  128  QGVWQDDVDPDNMTYEELLDLGETVGTQSRGLSEELISLLPTSKCKFGGFFSRKKAGERC  187

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC++ Y+ G+    L CKH YHSECI  WL INK+CPVC+ EV
Sbjct  188  VICQMRYKRGDKQMKLPCKHVYHSECITKWLGINKICPVCNNEV  231



>ref|NP_001053604.1| Os04g0571200 [Oryza sativa Japonica Group]
 dbj|BAF15518.1| Os04g0571200, partial [Oryza sativa Japonica Group]
Length=290

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -2

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ-NTQDGANDSCVICRLDYE  260
            +DPD ++YEEL  LGE +GTES+GL  D IA LP+  YK +  ++   +D CVIC + Y+
Sbjct  190  IDPDNMTYEELQQLGEAIGTESKGLPEDVIALLPTSTYKIRIFSRKEKHDECVICCMTYK  249

Query  259  DGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            + + LT L C+H YH  C+  WL+INKVCPVC+ EV  SG 
Sbjct  250  NRDRLTKLPCEHQYHQTCVTKWLKINKVCPVCNKEVYGSGK  290



>ref|XP_004502471.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502472.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502473.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X3 [Cicer arietinum]
 ref|XP_004502474.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X4 [Cicer arietinum]
 ref|XP_004502475.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X5 [Cicer arietinum]
 ref|XP_004502476.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X6 [Cicer arietinum]
 ref|XP_004502477.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X7 [Cicer arietinum]
Length=287

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 70/96 (73%), Gaps = 2/96 (2%)
 Frame = -2

Query  430  PDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAN-DSCVICRLDYEDG  254
            PDELSYEEL+ LGE++G E RGLSA+ I+S  + +Y SQ  +  +  D CVIC+++YE G
Sbjct  186  PDELSYEELIELGELIGDEKRGLSANEISSCLN-SYTSQTAESKSGIDRCVICQIEYEKG  244

Query  253  ETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            E L  L C H YH +CI+ WL+I KVCP+CS EVST
Sbjct  245  EALVALQCDHPYHKDCISKWLQIKKVCPICSNEVST  280



>ref|XP_003540530.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X1 [Glycine 
max]
 ref|XP_006592970.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X2 [Glycine 
max]
 ref|XP_006592971.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like isoform X3 [Glycine 
max]
Length=247

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = -2

Query  505  GINEGQALSEE------DHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTI  347
            G+   Q + EE      +   +SQ  W++ +DPD ++YEELL LGE VGT+SRGLS + I
Sbjct  114  GVTNMQTIPEECSPNHHESNSSSQVIWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQELI  173

Query  346  ASLPSMNYKSQN--TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVC  173
              LP+  YK  N   +  +   CVIC++ Y  G+    L C H YH ECI  WL INK C
Sbjct  174  DMLPTSKYKFGNLFKRKNSGKRCVICQMTYRRGDQQMKLPCSHVYHGECITKWLSINKKC  233

Query  172  PVCSAEV  152
            PVC+ EV
Sbjct  234  PVCNTEV  240



>emb|CAD41576.3| OSJNBa0088I22.8 [Oryza sativa Japonica Group]
 gb|EAZ31688.1| hypothetical protein OsJ_15836 [Oryza sativa Japonica Group]
Length=298

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -2

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ-NTQDGANDSCVICRLDYE  260
            +DPD ++YEEL  LGE +GTES+GL  D IA LP+  YK +  ++   +D CVIC + Y+
Sbjct  198  IDPDNMTYEELQQLGEAIGTESKGLPEDVIALLPTSTYKIRIFSRKEKHDECVICCMTYK  257

Query  259  DGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            + + LT L C+H YH  C+  WL+INKVCPVC+ EV  SG 
Sbjct  258  NRDRLTKLPCEHQYHQTCVTKWLKINKVCPVCNKEVYGSGK  298



>gb|EEE58414.1| hypothetical protein OsJ_09608 [Oryza sativa Japonica Group]
Length=272

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNS   Q  W++ +DPD ++YEELL LGE VGT+SRGLS + I+ LP   YK    + + 
Sbjct  155  QNSSSPQVIWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQERISLLPVTKYKCGFFSRKK  214

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
               + CVIC+++Y  G     L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  215  TRRERCVICQMEYRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEV  264



>ref|XP_006649482.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Oryza brachyantha]
Length=250

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNS   Q  W++ +DPD ++YEELL LGE VGT+SRGLS + I+ LP   YK    + + 
Sbjct  133  QNSSSPQVIWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQEHISLLPVTKYKCGFFSRRK  192

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
               + CVIC+++Y  G     L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  193  TRRERCVICQMEYRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEV  242



>gb|EAY95219.1| hypothetical protein OsI_17037 [Oryza sativa Indica Group]
Length=298

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -2

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ-NTQDGANDSCVICRLDYE  260
            +DPD ++YEEL  LGE +GTES+GL  D IA LP+  YK +  ++   +D CVIC + Y+
Sbjct  198  IDPDNMTYEELQQLGEAIGTESKGLPEDVIALLPTSTYKIRIFSRKEKHDECVICCMTYK  257

Query  259  DGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGN  137
            + + LT L C+H YH  C+  WL+INKVCPVC+ EV  SG 
Sbjct  258  NRDRLTKLPCEHQYHQTCVTKWLKINKVCPVCNKEVYGSGK  298



>ref|XP_010527674.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin ligase BIG BROTHER-like 
[Tarenaya hassleriana]
Length=260

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 70/115 (61%), Gaps = 5/115 (4%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--  314
            L    +G + Q  W++ +DPD ++YEELL LGE VGT+SRGLS D I+ LP   YK    
Sbjct  138  LRRHANGNDFQVVWQDTLDPDNMTYEELLELGETVGTQSRGLSQDLISLLPVTKYKCSVS  197

Query  313  --NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAE  155
                +    + CVIC+++Y+  E L  L CKH+YH  C   WL INK CP+C AE
Sbjct  198  LFTRKKSGKERCVICQMEYKRRERLITLPCKHAYHVSCGTKWLSINKACPICYAE  252



>ref|NP_001140719.1| uncharacterized LOC100272794 [Zea mays]
 gb|ACF84454.1| unknown [Zea mays]
 gb|AFW89514.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=249

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSC  284
            Q  W++ +DPD ++YEELL LGE VGT+SRGLS + I+ LP   YK    + +    + C
Sbjct  138  QVVWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQECISLLPITKYKCGFFSRKKTRRERC  197

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y  G     L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  198  VICQMEYRRGNLQITLPCKHVYHASCVTRWLSINKVCPVCFAEV  241



>gb|EAY88740.1| hypothetical protein OsI_10215 [Oryza sativa Indica Group]
Length=316

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNS---QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNS   Q  W++ +DPD ++YEELL LGE VGT+SRGLS + I+ LP   YK    + + 
Sbjct  199  QNSSSPQVIWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQERISLLPVTKYKCGFFSRKK  258

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
               + CVIC+++Y  G     L CKH YH+ C+  WL INKVCPVC AEV
Sbjct  259  TRRERCVICQMEYRRGNLQMTLPCKHVYHASCVTRWLSINKVCPVCFAEV  308



>gb|EPS58031.1| hypothetical protein M569_16786, partial [Genlisea aurea]
Length=103

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = -2

Query  445  WEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--TQDGANDSCVIC  275
            W++ +DPD ++YEELL LGEVVG ESRGLS + I  LP+  +KS    ++  + D C+IC
Sbjct  2    WQDGIDPDNMTYEELLDLGEVVGRESRGLSQELIDLLPTSKHKSSGIFSRRKSEDRCIIC  61

Query  274  RLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++ Y+ G+ L  L CKH+YH+ C + WL INK CPVC+ EV
Sbjct  62   QMRYKRGDRLINLPCKHAYHAHCGSKWLSINKTCPVCNIEV  102



>ref|XP_002279794.2| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Vitis vinifera]
 ref|XP_010659339.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Vitis vinifera]
 ref|XP_010659340.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Vitis vinifera]
 emb|CBI24877.3| unnamed protein product [Vitis vinifera]
Length=247

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--TQDGANDS  287
            SQ  W++ VDPD ++YEELL LGE VGT+SRGLS + I  LP+  YKS    ++  + + 
Sbjct  136  SQAIWQDNVDPDNMTYEELLDLGEAVGTQSRGLSQEHINLLPTCRYKSGRLFSRKRSAER  195

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC++ Y+ G+    L CKH YH++C   WL INKVCPVC+ EV
Sbjct  196  CVICQMGYKRGDRQIKLPCKHVYHTDCGTKWLTINKVCPVCNIEV  240



>ref|XP_004165039.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like, partial [Cucumis 
sativus]
Length=138

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 71/117 (61%), Gaps = 6/117 (5%)
 Frame = -2

Query  484  LSEEDHGQNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKS  317
            LS      NS D    W++ VDPD ++YEELL LGE VGT+SRGLS + IA LP   YK 
Sbjct  15   LSGPRRHHNSHDFQVVWQDNVDPDNMTYEELLELGETVGTQSRGLSQELIALLPISKYKY  74

Query  316  Q--NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
               + +    + CVIC+++Y+ G+    L CKH YH+ C   WL INK CP+C  EV
Sbjct  75   SFFSRKKSRGERCVICQMEYKRGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEV  131



>emb|CDP05240.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = -2

Query  436  VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGANDSCVICRLDYED  257
            +DPD ++YEEL +LGE VG ES+GLS   IA LP+  YK+          CVIC  +Y+ 
Sbjct  141  IDPDNMTYEELQSLGEAVGHESKGLSEVLIARLPTFKYKTGLFSKKRKKECVICCSEYKS  200

Query  256  GETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            G  LT L C H YHSECI  WL++NK CPVC  EV
Sbjct  201  GARLTTLPCAHQYHSECITRWLKLNKNCPVCQEEV  235



>gb|AFK40026.1| unknown [Lotus japonicus]
Length=149

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  469  HGQNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--T  308
            H  NS D    W++ +DPD+++YEELL LGE VGT+SRGL+ + I+ LP   YK      
Sbjct  30   HHSNSSDYQVIWQDNIDPDDMTYEELLELGEAVGTQSRGLTPEQISLLPVSKYKCGFFLR  89

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            +   ++ CVIC+++Y+ G+    L CKH YH+ C N WL INK CP+C  EV
Sbjct  90   KKSRDERCVICQMEYKRGDKRITLPCKHVYHASCGNRWLSINKACPICYTEV  141



>ref|XP_011025427.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011025428.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
Length=246

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 79/121 (65%), Gaps = 3/121 (2%)
 Frame = -2

Query  505  GINEGQALSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSM  329
             ++E +++  +    + Q  W++ VDPD ++YEELL LG+ VGT+S+GLS + I  LP+ 
Sbjct  119  AMHEERSIPNQPSANSPQAVWQDDVDPDNMTYEELLDLGDTVGTQSKGLSPELIRLLPTS  178

Query  328  N--YKSQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAE  155
               + S  ++  + + CVIC++ Y+ G+    L CKH YHSECI  WL INKVCPVC+ E
Sbjct  179  KCKFGSFFSRKKSGERCVICQMKYKRGDKQIKLLCKHVYHSECIAKWLGINKVCPVCNNE  238

Query  154  V  152
            V
Sbjct  239  V  239



>ref|NP_001242183.1| uncharacterized protein LOC100805963 [Glycine max]
 gb|ACU17830.1| unknown [Glycine max]
Length=192

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 72/114 (63%), Gaps = 6/114 (5%)
 Frame = -2

Query  475  EDHGQNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN-  311
              H  NS D    W++ +DPD ++YEELL LGE VGT+SRGL+ + I+SLP   YK    
Sbjct  71   RRHHSNSNDYQVIWQDNIDPDNMTYEELLELGEAVGTQSRGLTQEQISSLPVSKYKCGFF  130

Query  310  -TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
              +   ++ CVIC+++Y+ G+    L CKH YH+ C N WL INK CP+C  EV
Sbjct  131  LRKKSRDERCVICQMEYKRGDERITLPCKHVYHASCGNKWLSINKACPICYTEV  184



>ref|XP_010277675.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related isoform X2 
[Nelumbo nucifera]
Length=203

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -2

Query  421  LSYEELLALGEVVGTESRGLSADTI-ASLPSMNYKSQNTQDGANDSCVICRLDYEDGETL  245
            LSYEEL+ALGE+VG  ++GL AD + A L    +K Q+      D CVIC+++YE+GE+L
Sbjct  99   LSYEELIALGEIVGKVNKGLPADAVTALLHPYEFKCQSECKNGLDRCVICQVEYEEGESL  158

Query  244  TVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
              L C+H YHS+CI+ WL+I +VCP+CS EVS S +S
Sbjct  159  VALPCEHPYHSDCISKWLQIKRVCPICSTEVSPSEHS  195



>ref|XP_006383587.1| hypothetical protein POPTR_0005s20250g, partial [Populus trichocarpa]
 gb|ERP61384.1| hypothetical protein POPTR_0005s20250g, partial [Populus trichocarpa]
Length=125

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = -2

Query  418  SYEELLALGEVVGTESRGLSADTIAS-LPSMNYKSQNTQDGANDSCVICRLDYEDGETLT  242
            SYEEL+ALGE +G E RGLS + I++ L    Y+S   + G  D CVIC+++YE+ E+L 
Sbjct  29   SYEELIALGEFIGQEKRGLSVNEISTCLHPWKYRSLANKTG-TDRCVICQMEYEEDESLV  87

Query  241  VLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
             LSC H YHSEC+  WL+INK+CP+CS EVS++
Sbjct  88   ALSCDHPYHSECLTKWLQINKICPICSTEVSSA  120



>ref|XP_006345461.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Solanum tuberosum]
Length=237

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = -2

Query  487  ALSEEDHGQNSQDAWE-EVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN  311
             LS +D   N QD  E E+DPD ++YEELL LGE VGTESRGL  + I  LP+  YKS  
Sbjct  120  VLSNQD-DSNHQDILEDEIDPDNMTYEELLDLGETVGTESRGLPEELINLLPTTKYKSNG  178

Query  310  --TQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
              ++  + + CVIC++ Y+ G+      CKH YH+EC + WL INK CP+C+ EV
Sbjct  179  IFSRKKSEERCVICQMRYKRGDRQINFPCKHIYHTECGSKWLSINKTCPICNTEV  233



>ref|XP_006591894.1| PREDICTED: uncharacterized protein LOC100805963 isoform X1 [Glycine 
max]
 ref|XP_006591895.1| PREDICTED: uncharacterized protein LOC100805963 isoform X2 [Glycine 
max]
 ref|XP_006591896.1| PREDICTED: uncharacterized protein LOC100805963 isoform X3 [Glycine 
max]
 ref|XP_006591897.1| PREDICTED: uncharacterized protein LOC100805963 isoform X4 [Glycine 
max]
 ref|XP_006591898.1| PREDICTED: uncharacterized protein LOC100805963 isoform X5 [Glycine 
max]
 gb|KHN25248.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja]
Length=248

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  469  HGQNSQDA---WEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--T  308
            H  NS D    W++ +DPD ++YEELL LGE VGT+SRGL+ + I+SLP   YK      
Sbjct  129  HHSNSNDYQVIWQDNIDPDNMTYEELLELGEAVGTQSRGLTQEQISSLPVSKYKCGFFLR  188

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            +   ++ CVIC+++Y+ G+    L CKH YH+ C N WL INK CP+C  EV
Sbjct  189  KKSRDERCVICQMEYKRGDKRITLPCKHVYHASCGNKWLSINKACPICYTEV  240



>ref|XP_004151219.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis sativus]
Length=187

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 71/117 (61%), Gaps = 6/117 (5%)
 Frame = -2

Query  484  LSEEDHGQNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKS  317
            LS      NS D    W++ VDPD ++YEELL LGE VGT+SRGLS + IA LP   YK 
Sbjct  64   LSGPRRHHNSHDFQVVWQDNVDPDNMTYEELLELGETVGTQSRGLSQELIALLPISKYKY  123

Query  316  Q--NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
               + +    + CVIC+++Y+ G+    L CKH YH+ C   WL INK CP+C  EV
Sbjct  124  SFFSRKKSRGERCVICQMEYKRGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEV  180



>ref|XP_006850185.1| hypothetical protein AMTR_s00022p00246320 [Amborella trichopoda]
 gb|ERN11766.1| hypothetical protein AMTR_s00022p00246320 [Amborella trichopoda]
Length=301

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 71/108 (66%), Gaps = 3/108 (3%)
 Frame = -2

Query  466  GQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKS--QNTQDGA  296
              +SQ  W++ +DPD ++YEEL+ LGE VGT SRGL  + IASLP   YK    + +   
Sbjct  186  ASSSQLIWQDNIDPDNMTYEELVELGETVGTHSRGLPQELIASLPVSKYKCCFFSRRKTR  245

Query  295  NDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            ++ CVIC+++Y+ G+   +L CKH YH+ C+  WL INK CPVC  EV
Sbjct  246  DERCVICQMEYKRGDRRMMLPCKHLYHASCVTRWLSINKACPVCYVEV  293



>ref|XP_006590306.1| PREDICTED: uncharacterized protein LOC100793907 isoform X1 [Glycine 
max]
 ref|XP_006590307.1| PREDICTED: uncharacterized protein LOC100793907 isoform X2 [Glycine 
max]
 ref|XP_006590308.1| PREDICTED: uncharacterized protein LOC100793907 isoform X3 [Glycine 
max]
 ref|XP_006590309.1| PREDICTED: uncharacterized protein LOC100793907 isoform X4 [Glycine 
max]
 gb|KHN21899.1| E3 ubiquitin ligase BIG BROTHER [Glycine soja]
Length=248

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  469  HGQNSQDA---WEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--T  308
            H  NS D    W++ +DPD ++YEELL LGE VGT+SRGL+ + I+SLP   YK      
Sbjct  129  HHSNSNDYQVIWQDNIDPDNMTYEELLELGEAVGTQSRGLTQEQISSLPVSKYKCGFFLR  188

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            +   ++ CVIC+++Y  G+    L CKH YH+ C N WL INK CP+C  EV
Sbjct  189  KKSRDERCVICQMEYRRGDKRITLPCKHVYHASCGNKWLSINKACPICYTEV  240



>ref|XP_002313299.2| hypothetical protein POPTR_0009s06680g [Populus trichocarpa]
 gb|EEE87254.2| hypothetical protein POPTR_0009s06680g [Populus trichocarpa]
Length=236

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = -2

Query  469  HGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPS--MNYKSQNTQDG  299
            H +     W++ VDPD ++YEELL LG+ VGT+S+GLS + I  LP+    + S  ++  
Sbjct  121  HEERISAVWQDDVDPDNMTYEELLDLGDTVGTQSKGLSPELIRLLPTSKCKFGSFFSRKK  180

Query  298  ANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            + + CVIC++ Y+ G+  T L CKH YHSECI  WL INKVCPVC+ EV
Sbjct  181  SGERCVICQMKYKRGDKQTKLMCKHVYHSECIAKWLGINKVCPVCNNEV  229



>ref|NP_001242079.1| uncharacterized protein LOC100793907 [Glycine max]
 gb|ACU17934.1| unknown [Glycine max]
Length=248

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  469  HGQNSQDA---WEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--T  308
            H  NS D    W++ +DPD ++YEELL LGE VGT+SRGL+ + I+SLP   YK      
Sbjct  129  HHSNSNDYQVIWQDNIDPDNMTYEELLELGEAVGTQSRGLTQEQISSLPVSKYKCGFFLR  188

Query  307  QDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            +   ++ CVIC+++Y  G+    L CKH YH+ C N WL INK CP+C  EV
Sbjct  189  KKSRDERCVICQMEYRRGDKRITLPCKHVYHASCGNKWLSINKACPICYTEV  240



>ref|XP_004510966.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cicer arietinum]
Length=246

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 67/105 (64%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGANDS  287
            SQ  W++ +DPD ++YEELL LGE VGT+SRGLS + I  LP+  YK  S   +  +   
Sbjct  135  SQVIWQDNIDPDNMTYEELLDLGEAVGTQSRGLSQELIDMLPTSKYKFGSLFKRKNSGKR  194

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC++ Y  G+    L C H YH ECI  WL INK CPVC+ EV
Sbjct  195  CVICQMTYRRGDQQMKLPCSHVYHGECITKWLSINKKCPVCNTEV  239



>ref|XP_008450441.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis melo]
 ref|XP_008450442.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis melo]
Length=248

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSC  284
            Q  W++ VDPD ++YEELL LGE VGT+SRGLS + IA LP   YK    + +    D C
Sbjct  138  QVVWQDNVDPDNMTYEELLELGETVGTQSRGLSQELIALLPISKYKYGFFSRKKSRGDRC  197

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y+ G+    L CKH YH+ C   WL INK CP+C  EV
Sbjct  198  VICQMEYKRGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEV  241



>ref|XP_009414750.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Musa acuminata 
subsp. malaccensis]
Length=262

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 69/112 (62%), Gaps = 3/112 (3%)
 Frame = -2

Query  472  DHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            D     Q  W++ +DPD ++YEELL LGE VGT+S GLS + I SLP   YK    + + 
Sbjct  145  DGANGGQAVWQDNIDPDNMTYEELLDLGEAVGTQSHGLSQEQIYSLPVSKYKCGFFSRKK  204

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
               + C+IC+++Y+ G+    L CKH YH+ C+  WL INK CPVC  EVS 
Sbjct  205  SQGERCIICQMNYKRGDRQITLPCKHVYHANCVTQWLSINKACPVCLVEVSV  256



>ref|XP_002300971.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE80244.2| zinc finger family protein [Populus trichocarpa]
Length=210

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 2/97 (2%)
 Frame = -2

Query  421  LSYEELLALGEVVGTESRGLSADTIAS-LPSMNYKSQNTQDGANDSCVICRLDYEDGETL  245
            LSYE+L+ALGE VG E RGLS + I++ L    Y+S  ++ G  D CVIC+++YE+ E+L
Sbjct  114  LSYEDLIALGEFVGQEKRGLSRNEISTCLRPCKYESLASKTG-TDRCVICQMEYEEDESL  172

Query  244  TVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
              LSC H YH ECI NWL+INK+CP+C+ EVS+   S
Sbjct  173  VALSCDHPYHPECIANWLQINKICPICTTEVSSPYKS  209



>ref|XP_011042092.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042093.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042094.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042096.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042097.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
 ref|XP_011042098.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Populus euphratica]
Length=249

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--  314
            L    + Q+ Q  W++ VDPD ++YEELL LGE VGT++RGLS + I+ LP+  YK    
Sbjct  129  LRRHHNVQDYQAIWQDHVDPDNMTYEELLELGETVGTQNRGLSQEQISLLPTSKYKRSFF  188

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            + +   ++ CVIC+++Y+ G+    L CKH YH+ C   WL INK CP+C +EV
Sbjct  189  SRRKSRSERCVICQMEYKRGDRQITLPCKHIYHAGCGTRWLSINKACPICYSEV  242



>ref|XP_003606783.1| E3 ubiquitin-protein ligase [Medicago truncatula]
Length=242

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--TQDGANDS  287
            SQ  W++ +DPD ++YEELL LGE VGT+SRGL+ + I+ LP   +K      +   N+ 
Sbjct  130  SQVIWQDNIDPDNMTYEELLELGEAVGTQSRGLTQEQISLLPVSKFKCGFFFRKKSRNER  189

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC+++Y+ G+    L CKH YH+ C N WL INK CP+C  EV
Sbjct  190  CVICQMEYKRGDKRITLPCKHLYHASCGNKWLTINKACPICYTEV  234



>ref|XP_007213834.1| hypothetical protein PRUPE_ppa010371mg [Prunus persica]
 gb|EMJ15033.1| hypothetical protein PRUPE_ppa010371mg [Prunus persica]
Length=252

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNSQD    W++ +DPD ++YEELL LGE VGT+SRGLS D ++ LP   YK    + + 
Sbjct  134  QNSQDYQVIWQDNIDPDSMTYEELLELGEAVGTQSRGLSQDQLSLLPISKYKCSFFSRKK  193

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
              ++ CVIC+++Y+ G+    L CKH YH+ C   WL INK CP+C  EV
Sbjct  194  SRDERCVICQMEYKRGDRRITLPCKHLYHAGCGTRWLSINKACPICYTEV  243



>ref|XP_002303894.2| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 ref|XP_006386020.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 ref|XP_006386021.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 ref|XP_006386022.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 gb|EEE78873.2| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 gb|ERP63817.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 gb|ERP63818.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
 gb|ERP63819.1| hypothetical protein POPTR_0003s20350g [Populus trichocarpa]
Length=249

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--  314
            L    + Q+ Q  W++ VDPD ++YEELL LGE VGT++RGLS + I+ LP+  YK    
Sbjct  129  LRRHHNVQDYQAIWQDHVDPDNMTYEELLELGETVGTQNRGLSQEQISLLPTSKYKRSFF  188

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            + +   ++ CVIC+++Y+ G+    L CKH YH+ C   WL INK CP+C +EV
Sbjct  189  SRRKSRSERCVICQMEYKRGDRQITLPCKHIYHAGCGTRWLSINKACPICYSEV  242



>gb|EMT14836.1| RING finger protein 44 [Aegilops tauschii]
Length=251

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = -2

Query  442  EEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK-SQNTQDGANDSCVICRLD  266
            +EVDPD ++YEEL  LGE +GTES+GL  D IA L S  YK    ++   +D CVIC + 
Sbjct  151  DEVDPDNMTYEELQQLGETIGTESKGLPEDVIALLKSSTYKVGIFSRKEKHDECVICCMA  210

Query  265  YEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
            Y++ + LT L C+H YH  C+  WL+INKVCPVC+ EV  S
Sbjct  211  YKNRDKLTTLPCQHQYHRTCVAKWLKINKVCPVCNKEVFGS  251



>ref|XP_004142225.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis sativus]
 ref|XP_004161701.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Cucumis sativus]
Length=241

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGANDSC  284
            Q  W+E VDPD ++YEEL+ LGE VGT+SRGL+ + IA LP   Y+    + +   N+ C
Sbjct  131  QTIWQEIVDPDNMTYEELVDLGETVGTQSRGLTQELIALLPVSRYRWGFFSRKKSRNERC  190

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y+ G+ +  L CKH YH+ C   WL I K CP+C  EV
Sbjct  191  VICQMEYKRGDKIITLPCKHKYHTSCGTKWLSIKKACPICYTEV  234



>ref|XP_003606782.1| E3 ubiquitin-protein ligase [Medicago truncatula]
Length=254

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGANDS  287
            SQ  W++ +DPD ++YEELL LGE VGT+SRGL+ + I+ LP   +K      +   N+ 
Sbjct  142  SQVIWQDNIDPDNMTYEELLELGEAVGTQSRGLTQEQISLLPVSKFKCGFFFRKKSRNER  201

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC+++Y+ G+    L CKH YH+ C N WL INK CP+C  EV
Sbjct  202  CVICQMEYKRGDKRITLPCKHLYHASCGNKWLTINKACPICYTEV  246



>ref|XP_011087589.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Sesamum indicum]
Length=248

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 3/106 (3%)
 Frame = -2

Query  460  NSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--TQDGAND  290
            ++Q  W++ +DPD ++YEELL LGE VGT+SRGLS + I  LP+  +KS    ++  + D
Sbjct  136  STQVLWQDDIDPDTMTYEELLDLGEAVGTQSRGLSQELINMLPTSKHKSGGIFSRRKSGD  195

Query  289  SCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
             CVIC++ Y+ G+    L CKH+YH++C + WL INK CPVC+ EV
Sbjct  196  RCVICQMRYKRGDRQINLPCKHAYHTDCGSKWLSINKTCPVCNTEV  241



>ref|XP_006470593.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Citrus sinensis]
 gb|KDO61293.1| hypothetical protein CISIN_1g025212mg [Citrus sinensis]
Length=256

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSC  284
            Q  W++ +DPD+++YEELL LGE VGT+SRGLS + I+ LP   YK      +   N+ C
Sbjct  138  QVVWQDNIDPDQMTYEELLELGETVGTQSRGLSQELISLLPISKYKCGFFTRKRSRNERC  197

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y+ G+    L CKH YH+ C   WL INK CP+C  EV
Sbjct  198  VICQMEYKRGDRRMTLPCKHVYHAGCGTRWLSINKACPICYTEV  241



>ref|XP_003602037.1| RING finger protein [Medicago truncatula]
 gb|AES72288.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=211

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = -2

Query  430  PDELSYEELLALGEVVGTESRGLSADTIAS-LPSMNYKSQNTQDGANDSCVICRLDYEDG  254
            PDELSYEEL+ LG  +G E RGL A+ I+S L     K   +  G  D CVIC+++YE+G
Sbjct  110  PDELSYEELIELGNFIGEEKRGLPANEISSCLHPYTSKIAESTSGI-DRCVICQIEYEEG  168

Query  253  ETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS  134
            E+L  L C H YH++CI+ WL+I KVCP+CS EVST+  +
Sbjct  169  ESLVALHCDHPYHTDCISKWLQIKKVCPICSNEVSTTNKA  208



>ref|XP_007150374.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 ref|XP_007150375.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 ref|XP_007150378.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 gb|ESW22368.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 gb|ESW22369.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
 gb|ESW22372.1| hypothetical protein PHAVU_005G148200g [Phaseolus vulgaris]
Length=246

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 5/104 (5%)
 Frame = -2

Query  448  AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK----SQNTQDGANDSC  284
            +WE+ +DPD ++YEELL LGE VGTESRGLS + I+S+P   YK        +    + C
Sbjct  135  SWEDNIDPDNMTYEELLELGETVGTESRGLSQEQISSIPISKYKCGRFFFFRRKSREERC  194

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y  G+    L CKH+YH+ C N WL INK CP+C  EV
Sbjct  195  VICQMEYRRGDKRMTLPCKHAYHASCGNKWLSINKACPMCYREV  238



>gb|KGN54171.1| hypothetical protein Csa_4G290860 [Cucumis sativus]
Length=249

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 68/104 (65%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGANDSC  284
            Q  W+E VDPD ++YEEL+ LGE VGT+SRGL+ + IA LP   Y+    + +   N+ C
Sbjct  139  QTIWQEIVDPDNMTYEELVDLGETVGTQSRGLTQELIALLPVSRYRWGFFSRKKSRNERC  198

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y+ G+ +  L CKH YH+ C   WL I K CP+C  EV
Sbjct  199  VICQMEYKRGDKIITLPCKHKYHTSCGTKWLSIKKACPICYTEV  242



>gb|AES88979.2| E3 ubiquitin ligase BIG brother-like protein [Medicago truncatula]
Length=248

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK--SQNTQDGANDS  287
            SQ  W++ +DPD ++YEELL LGE VGT+SRGL+ + I+ LP   +K      +   N+ 
Sbjct  136  SQVIWQDNIDPDNMTYEELLELGEAVGTQSRGLTQEQISLLPVSKFKCGFFFRKKSRNER  195

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC+++Y+ G+    L CKH YH+ C N WL INK CP+C  EV
Sbjct  196  CVICQMEYKRGDKRITLPCKHLYHASCGNKWLTINKACPICYTEV  240



>gb|EYU27063.1| hypothetical protein MIMGU_mgv1a012318mg [Erythranthe guttata]
Length=254

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 73/106 (69%), Gaps = 3/106 (3%)
 Frame = -2

Query  460  NSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--TQDGAND  290
            ++Q  WE+ +DPD ++YEELL LGE VGTESRGL  + I  LP+  +K     ++  + D
Sbjct  142  STQVLWEDDIDPDNMTYEELLDLGEAVGTESRGLPQELINLLPTSKHKFGGIFSRRKSGD  201

Query  289  SCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
             CVIC++ Y+ G+    L CKH+YH++C++ WL INK CPVC+ EV
Sbjct  202  RCVICQMRYKRGDRQINLPCKHAYHADCVSKWLSINKACPVCNTEV  247



>ref|XP_010933875.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like isoform 
X1 [Elaeis guineensis]
Length=250

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = -2

Query  454  QDAWEEVDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYK-SQNTQDGANDSCVI  278
            Q A ++VDPD ++YEEL  LGE +GTESRGLS + I+ LP+  YK    ++   ++ CVI
Sbjct  146  QVAPDDVDPDNMTYEELQRLGEAIGTESRGLSDEFISFLPTSTYKIGLFSKKEKHEECVI  205

Query  277  CRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            C + Y++ + L  L C+H YH  CI+ WL+INK CPVC+ EV
Sbjct  206  CYMAYKNRDKLITLPCQHHYHKTCISKWLKINKACPVCNVEV  247



>gb|AFK44486.1| unknown [Medicago truncatula]
Length=248

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  457  SQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQN--TQDGANDS  287
            SQ  W++ +DPD ++YEELL LGE VGT+SRGL+ + I+ LP   +K      +   N+ 
Sbjct  136  SQVIWQDNIDPDNMTYEELLELGEAVGTQSRGLTQEQISLLPVSKFKCGFFFRKKSRNER  195

Query  286  CVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            CVIC+++Y+ G+    L CKH YH+ C N WL INK CP+C  EV
Sbjct  196  CVICQMEYKRGDKRITLPCKHLYHASCGNKWLTINKACPICYTEV  240



>ref|XP_011080278.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Sesamum indicum]
 ref|XP_011080279.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Sesamum indicum]
 ref|XP_011080280.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Sesamum indicum]
Length=251

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 73/118 (62%), Gaps = 13/118 (11%)
 Frame = -2

Query  448  AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSCVI  278
             W++ +DPD ++YEELL LGE VGT+SRGLS D IA LP+  +K    + +    + CVI
Sbjct  143  VWQDNIDPDNMTYEELLELGEAVGTQSRGLSQDQIALLPTSKFKWGLFSRKKFRGERCVI  202

Query  277  CRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVSTSGNS*QI*IVNAPE  104
            C+++Y+ G+    L CKH YH+ C + WL INK CP+C  EV          IVN P+
Sbjct  203  CQMEYKRGDRRMTLPCKHVYHTGCGSRWLSINKACPICYKEV----------IVNVPK  250



>ref|XP_009607181.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Nicotiana 
tomentosiformis]
Length=179

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = -2

Query  421  LSYEELLALGEVVGTESRGLSADTIAS-LPSMNYKSQNTQDGANDSCVICRLDYEDGETL  245
            LSYEEL+ALGE VG E+RGLS   I+  L S  ++S N+     D CV+C+L+YE+GE L
Sbjct  81   LSYEELIALGEFVGVENRGLSEAEISKHLHSYTFQS-NSSKTLIDRCVVCQLEYEEGENL  139

Query  244  TVLSCKHSYHSECINNWLRINKVCPVCSAEVSTS  143
              LSC H YHS+CI  WL+I K+CP+CS EVS++
Sbjct  140  VALSCDHPYHSDCIQKWLQIKKICPICSDEVSST  173



>ref|NP_001235447.1| uncharacterized protein LOC100526881 [Glycine max]
 gb|ACU15889.1| unknown [Glycine max]
 gb|KHN47017.1| E3 ubiquitin ligase BIG BROTHER-related [Glycine soja]
Length=202

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = -2

Query  430  PDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQNTQDGAN-DSCVICRLDYEDG  254
            PDELSYEEL+ L E +G E+RGLSA+ I SL    Y  Q  +  +  D CVIC+++YE+G
Sbjct  101  PDELSYEELMELEEFIGEETRGLSANEI-SLCLYPYTCQCAESKSGIDRCVICQVEYEEG  159

Query  253  ETLTVLSCKHSYHSECINNWLRINKVCPVCSAEVST  146
            E L  L C+H YHS+CI  WL+I KVCP+C  EVST
Sbjct  160  EALVALQCEHPYHSDCIRKWLQIKKVCPICGNEVST  195



>ref|XP_002299947.2| hypothetical protein POPTR_0001s27470g [Populus trichocarpa]
 ref|XP_006369632.1| hypothetical protein POPTR_0001s27470g [Populus trichocarpa]
 gb|EEE84752.2| hypothetical protein POPTR_0001s27470g [Populus trichocarpa]
 gb|ERP66201.1| hypothetical protein POPTR_0001s27470g [Populus trichocarpa]
Length=245

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 79/116 (68%), Gaps = 3/116 (3%)
 Frame = -2

Query  490  QALSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMN--YK  320
            +++S +    + Q  W++ VDPD ++YEEL+ LGE VG++S+GLS + I+ LP+    + 
Sbjct  123  ESISNQVSTNSPQALWQDDVDPDTMTYEELVDLGETVGSQSKGLSPELISLLPTSKCKFG  182

Query  319  SQNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            S  ++  + + CVIC++ Y+ G+    L CKH+YHSECI  WL INKVCPVC+ EV
Sbjct  183  SFFSRKRSGERCVICQMKYKRGDKQIKLLCKHAYHSECITKWLGINKVCPVCNDEV  238



>ref|XP_010257293.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Nelumbo nucifera]
 ref|XP_010257295.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Nelumbo nucifera]
 ref|XP_010257296.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Nelumbo nucifera]
 ref|XP_010257297.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Nelumbo nucifera]
Length=244

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 71/114 (62%), Gaps = 3/114 (3%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--  314
            +  +++  +SQ  W++ +DPD ++YEELL LGE VGT SRGLS + I  LP   YK    
Sbjct  127  IRNQNNTSSSQMFWQDNIDPDNMTYEELLDLGEAVGTHSRGLSQEQILQLPISKYKCGFF  186

Query  313  NTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            + +    + CVIC+++Y+ G+    L CKH YH  CI  WL INK CPVC  EV
Sbjct  187  SRKRFRGERCVICQMEYKRGDRQMTLPCKHIYHGGCITRWLSINKACPVCYTEV  240



>gb|KGN66475.1| hypothetical protein Csa_1G613470 [Cucumis sativus]
Length=248

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 67/104 (64%), Gaps = 3/104 (3%)
 Frame = -2

Query  454  QDAWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQDGANDSC  284
            Q  W++ VDPD ++YEELL LGE VGT+SRGLS + IA LP   YK    + +    + C
Sbjct  138  QVVWQDNVDPDNMTYEELLELGETVGTQSRGLSQELIALLPISKYKYSFFSRKKSRGERC  197

Query  283  VICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
            VIC+++Y+ G+    L CKH YH+ C   WL INK CP+C  EV
Sbjct  198  VICQMEYKRGDRRITLPCKHIYHAGCGTKWLSINKACPICYTEV  241



>ref|XP_009376879.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Pyrus x bretschneideri]
Length=252

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNS D    W++ +DPD +SYEELL LGE VGT+SRGLS D I+ LP   YK    + + 
Sbjct  134  QNSHDHQVIWQDNIDPDSMSYEELLELGEAVGTQSRGLSQDQISLLPISKYKCSFFSRKK  193

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
              ++ CVIC+++Y+ G+    L CKH YH+ C   WL INK CP+C  EV
Sbjct  194  SRDERCVICQMEYKRGDRRIALPCKHLYHAGCGTRWLSINKACPMCYTEV  243



>ref|XP_008219608.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Prunus mume]
Length=211

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 72/116 (62%), Gaps = 5/116 (4%)
 Frame = -2

Query  484  LSEEDHGQNSQDAWEE--VDPDELSYEELLALGEVVGTESRGLSADTIAS-LPSMNYKS-  317
            L  ED G +S    +E   D DEL+YEEL+ALGE +G E RGL  + I++ L     KS 
Sbjct  85   LENEDRGNSSDQEMDEDDFDVDELTYEELIALGEFIGEEKRGLPTNEISTCLQPYTSKSP  144

Query  316  -QNTQDGANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
              N      D CVIC+++YEDGE L  LSC+H YH +CI+ WL I K CP+CS EV
Sbjct  145  SSNQSKTGIDRCVICQIEYEDGEALVALSCQHPYHWDCISKWLEIKKSCPICSTEV  200



>ref|XP_009355176.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Pyrus x bretschneideri]
Length=252

 Score =   110 bits (274),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (65%), Gaps = 6/110 (5%)
 Frame = -2

Query  463  QNSQD---AWEE-VDPDELSYEELLALGEVVGTESRGLSADTIASLPSMNYKSQ--NTQD  302
            QNS D    W++ +DPD +SYEELL LGE VGT+SRGLS D I+ LP   YK    + + 
Sbjct  134  QNSHDHQVIWQDNIDPDSMSYEELLELGEAVGTQSRGLSQDQISLLPISKYKCSFFSRKK  193

Query  301  GANDSCVICRLDYEDGETLTVLSCKHSYHSECINNWLRINKVCPVCSAEV  152
              ++ CVIC+++Y+ G+    L CKH YH+ C   WL INK CP+C  EV
Sbjct  194  SRDERCVICQMEYKRGDRRIALPCKHLYHAGCGTRWLSINKACPMCYTEV  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050