BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020M12

Length=737
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006356169.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...  54.7    3e-05   Solanum tuberosum [potatoes]
gb|KHM98779.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit  52.4    2e-04   Glycine soja [wild soybean]
ref|XP_003546283.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...  52.4    2e-04   Glycine max [soybeans]
ref|XP_004241722.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.6    3e-04   Solanum lycopersicum
ref|XP_009778993.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...  50.8    7e-04   Nicotiana sylvestris
ref|XP_009778994.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.4    8e-04   Nicotiana sylvestris



>ref|XP_006356169.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Solanum tuberosum]
Length=903

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -2

Query  736  TYFGGSRSSATIGLSHHLIRQTSENGVASLSTDQDNAASVSSNGRLQKLEGFKDLVI  566
            TYF G+RSS     + H  ++T ENGV +L+T + N+A +SSNGRL KL+  KDL I
Sbjct  848  TYFEGTRSSVATSSAIHQTQKTPENGVVNLNTGE-NSALLSSNGRLDKLDTLKDLHI  903



>gb|KHM98779.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -2

Query  736  TYFGGSRSSATIGLSHHLIRQTSENGVASLSTDQDNAASVSSNGRLQKLEGFKDLVI  566
            TYF GSRSSA+   + + IR++SENG ++ S    NA S +SNG   KLE FKDL I
Sbjct  848  TYFEGSRSSASPNSAFNQIRKSSENGSSNHSVGDHNAESGTSNG---KLEAFKDLTI  901



>ref|XP_003546283.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Glycine max]
Length=901

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -2

Query  736  TYFGGSRSSATIGLSHHLIRQTSENGVASLSTDQDNAASVSSNGRLQKLEGFKDLVI  566
            TYF GSRSSA+   + + IR++SENG ++ S    NA S +SNG   KLE FKDL I
Sbjct  848  TYFEGSRSSASPNSAFNQIRKSSENGSSNHSVGDHNAESGTSNG---KLEAFKDLTI  901



>ref|XP_004241722.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Solanum lycopersicum]
Length=903

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  736  TYFGGSRSSATIGLSHHLIRQTSENGVASLSTDQDNAASVSSNGRLQKLEGFKDLVI  566
            TYF G+RSS     ++H I++T  NGV +L+  + N A  SSNGRL KL+  KDL I
Sbjct  848  TYFEGTRSSVATSSAYHQIQKTPGNGVVNLNAGE-NCALPSSNGRLDKLDTLKDLHI  903



>ref|XP_009778993.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Nicotiana sylvestris]
Length=902

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -2

Query  733  YFGGSRSSATIGLSHHLIRQTSENGVASLSTDQDNAASVSSNGRLQKLEGFKDLVI  566
            YFGG +SSA    +++ I++++ NG   L+ D D  +S+SSNGRL+KL   KDL I
Sbjct  849  YFGGIQSSAATSSANNQIQKSAANGAVGLNADGD--SSLSSNGRLEKLNALKDLHI  902



>ref|XP_009778994.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Nicotiana sylvestris]
Length=876

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = -2

Query  733  YFGGSRSSATIGLSHHLIRQTSENGVASLSTDQDNAASVSSNGRLQKLEGFKDLVI  566
            YFGG +SSA    +++ I++++ NG   L+ D D  +S+SSNGRL+KL   KDL I
Sbjct  823  YFGGIQSSAATSSANNQIQKSAANGAVGLNADGD--SSLSSNGRLEKLNALKDLHI  876



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500