BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020M02

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609631.1|  PREDICTED: uncharacterized protein LOC104103435    132   8e-34   
ref|XP_009775161.1|  PREDICTED: uncharacterized protein LOC104225093    112   8e-25   Nicotiana sylvestris
ref|XP_006339420.1|  PREDICTED: uncharacterized protein LOC102603324    108   2e-23   Solanum tuberosum [potatoes]
ref|XP_010322788.1|  PREDICTED: uncharacterized protein LOC101262...    107   5e-23   Solanum lycopersicum
ref|XP_004229458.1|  PREDICTED: uncharacterized protein LOC101262...    107   6e-23   Solanum lycopersicum
emb|CDO98976.1|  unnamed protein product                              99.8    3e-20   Coffea canephora [robusta coffee]
gb|KJB72271.1|  hypothetical protein B456_011G168000                  84.7    7e-16   Gossypium raimondii
gb|KJB72270.1|  hypothetical protein B456_011G168000                  84.7    1e-15   Gossypium raimondii
gb|KJB72266.1|  hypothetical protein B456_011G168000                  84.7    4e-15   Gossypium raimondii
gb|KDO74882.1|  hypothetical protein CISIN_1g007812mg                 82.8    8e-15   Citrus sinensis [apfelsine]
gb|KDO74881.1|  hypothetical protein CISIN_1g007812mg                 82.4    1e-14   Citrus sinensis [apfelsine]
gb|KHG30285.1|  putative yqkD                                         82.0    2e-14   Gossypium arboreum [tree cotton]
gb|KDO74880.1|  hypothetical protein CISIN_1g007812mg                 82.0    3e-14   Citrus sinensis [apfelsine]
ref|XP_006419777.1|  hypothetical protein CICLE_v10004606mg           82.0    3e-14   Citrus clementina [clementine]
ref|XP_006489238.1|  PREDICTED: uncharacterized protein LOC102610023  82.0    3e-14   Citrus sinensis [apfelsine]
gb|KDO74878.1|  hypothetical protein CISIN_1g007812mg                 82.0    3e-14   Citrus sinensis [apfelsine]
gb|KDO74879.1|  hypothetical protein CISIN_1g007812mg                 81.6    4e-14   Citrus sinensis [apfelsine]
ref|XP_011071522.1|  PREDICTED: uncharacterized protein LOC105156947  80.5    1e-13   
ref|XP_010649852.1|  PREDICTED: uncharacterized protein LOC100257995  79.7    1e-13   Vitis vinifera
emb|CBI26166.3|  unnamed protein product                              79.7    1e-13   Vitis vinifera
ref|XP_010278885.1|  PREDICTED: uncharacterized protein LOC104612...  79.3    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010278880.1|  PREDICTED: uncharacterized protein LOC104612...  79.7    2e-13   Nelumbo nucifera [Indian lotus]
gb|EYU45603.1|  hypothetical protein MIMGU_mgv1a0037051mg             78.6    3e-13   Erythranthe guttata [common monkey flower]
ref|XP_004508352.1|  PREDICTED: uncharacterized protein LOC101492...  74.3    9e-12   Cicer arietinum [garbanzo]
ref|XP_004508353.1|  PREDICTED: uncharacterized protein LOC101492...  74.3    1e-11   Cicer arietinum [garbanzo]
ref|XP_004154381.1|  PREDICTED: uncharacterized protein LOC101218432  73.9    1e-11   
ref|XP_004145038.1|  PREDICTED: uncharacterized protein LOC101215845  73.9    1e-11   
ref|XP_003529600.1|  PREDICTED: uncharacterized protein LOC100798...  73.2    2e-11   
ref|XP_006584056.1|  PREDICTED: uncharacterized protein LOC100798...  73.2    2e-11   Glycine max [soybeans]
ref|XP_006584055.1|  PREDICTED: uncharacterized protein LOC100798...  73.2    2e-11   
gb|KHN03032.1|  Hypothetical protein glysoja_009898                   73.2    2e-11   Glycine soja [wild soybean]
ref|XP_004296971.1|  PREDICTED: uncharacterized protein LOC101299950  72.4    4e-11   Fragaria vesca subsp. vesca
gb|AFK48377.1|  unknown                                               67.0    2e-10   Lotus japonicus
ref|XP_002868296.1|  predicted protein                                69.3    3e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_010255853.1|  PREDICTED: uncharacterized protein LOC104596404  69.3    4e-10   Nelumbo nucifera [Indian lotus]
ref|XP_007034567.1|  Alpha/beta-Hydrolases superfamily protein        69.3    4e-10   
gb|KEH32227.1|  alpha/beta-hydrolase superfamily protein              68.9    5e-10   Medicago truncatula
ref|XP_011014506.1|  PREDICTED: uncharacterized protein LOC105118291  67.8    1e-09   Populus euphratica
ref|XP_008340898.1|  PREDICTED: uncharacterized protein LOC103403829  67.8    1e-09   
ref|XP_008390806.1|  PREDICTED: uncharacterized protein LOC103453051  67.4    2e-09   
ref|XP_006600321.1|  PREDICTED: uncharacterized protein LOC100807...  66.6    3e-09   Glycine max [soybeans]
gb|KHN03427.1|  Hypothetical protein glysoja_004453                   66.6    3e-09   Glycine soja [wild soybean]
ref|XP_009139529.1|  PREDICTED: uncharacterized protein LOC103863...  66.6    3e-09   Brassica rapa
ref|XP_009139528.1|  PREDICTED: uncharacterized protein LOC103863...  66.6    3e-09   Brassica rapa
ref|XP_006600322.1|  PREDICTED: uncharacterized protein LOC100807...  66.6    3e-09   Glycine max [soybeans]
ref|XP_009139530.1|  PREDICTED: uncharacterized protein LOC103863...  66.6    3e-09   Brassica rapa
ref|XP_010532690.1|  PREDICTED: uncharacterized protein LOC104808...  66.6    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_010532691.1|  PREDICTED: uncharacterized protein LOC104808...  66.2    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_006283452.1|  hypothetical protein CARUB_v10004497mg           65.9    5e-09   Capsella rubella
ref|XP_006283451.1|  hypothetical protein CARUB_v10004497mg           65.9    6e-09   Capsella rubella
ref|XP_009339931.1|  PREDICTED: uncharacterized protein LOC103932104  65.5    8e-09   Pyrus x bretschneideri [bai li]
ref|XP_008223032.1|  PREDICTED: uncharacterized protein LOC103322864  65.1    8e-09   Prunus mume [ume]
ref|XP_007222369.1|  hypothetical protein PRUPE_ppa003420mg           65.1    1e-08   
gb|KCW84318.1|  hypothetical protein EUGRSUZ_B01162                   64.7    1e-08   Eucalyptus grandis [rose gum]
gb|KDP40084.1|  hypothetical protein JCGZ_02082                       64.7    1e-08   Jatropha curcas
ref|XP_010035885.1|  PREDICTED: uncharacterized protein LOC104425...  64.7    1e-08   Eucalyptus grandis [rose gum]
ref|XP_008458538.1|  PREDICTED: uncharacterized protein LOC103497...  64.7    1e-08   
ref|XP_010035879.1|  PREDICTED: uncharacterized protein LOC104425...  64.7    1e-08   Eucalyptus grandis [rose gum]
ref|XP_009365782.1|  PREDICTED: uncharacterized protein LOC103955607  64.7    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_008458537.1|  PREDICTED: uncharacterized protein LOC103497...  64.7    1e-08   Cucumis melo [Oriental melon]
ref|XP_010450069.1|  PREDICTED: uncharacterized protein LOC104732228  64.3    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006414745.1|  hypothetical protein EUTSA_v10024836mg           64.3    2e-08   Eutrema salsugineum [saltwater cress]
ref|NP_193165.7|  alpha/beta-hydrolase family protein                 63.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154171.1|  hypothetical protein PHAVU_003G096200g           63.5    3e-08   Phaseolus vulgaris [French bean]
ref|XP_007154170.1|  hypothetical protein PHAVU_003G096200g           63.5    3e-08   Phaseolus vulgaris [French bean]
ref|XP_010488424.1|  PREDICTED: uncharacterized protein LOC104766...  62.8    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010440497.1|  PREDICTED: uncharacterized protein LOC104723788  62.8    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010435157.1|  PREDICTED: uncharacterized protein LOC104719...  62.4    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010435158.1|  PREDICTED: uncharacterized protein LOC104719...  62.4    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_007147794.1|  hypothetical protein PHAVU_006G155700g           62.4    8e-08   Phaseolus vulgaris [French bean]
ref|XP_007147795.1|  hypothetical protein PHAVU_006G155700g           62.4    8e-08   Phaseolus vulgaris [French bean]
ref|XP_008797057.1|  PREDICTED: uncharacterized protein LOC103712341  60.5    3e-07   Phoenix dactylifera
ref|XP_010488423.1|  PREDICTED: uncharacterized protein LOC104766268  57.4    4e-07   
gb|ABK94721.1|  unknown                                               55.8    4e-07   Populus trichocarpa [western balsam poplar]
ref|NP_001030748.1|  alpha/beta-Hydrolases superfamily protein        59.7    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299834.1|  hypothetical protein CARUB_v10016036mg           59.7    5e-07   Capsella rubella
dbj|BAB02772.1|  unnamed protein product                              59.7    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188996.2|  alpha/beta-Hydrolases superfamily protein           59.7    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311822.2|  hypothetical protein POPTR_0008s20480g           59.3    9e-07   
ref|XP_010669834.1|  PREDICTED: uncharacterized protein LOC104886965  58.9    1e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002883434.1|  hypothetical protein ARALYDRAFT_898866           58.5    1e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_002315536.2|  hypothetical protein POPTR_0010s03020g           58.5    2e-06   
ref|XP_011009031.1|  PREDICTED: uncharacterized protein LOC105114...  58.2    2e-06   Populus euphratica
ref|XP_011009032.1|  PREDICTED: uncharacterized protein LOC105114...  58.2    2e-06   Populus euphratica
ref|XP_011009029.1|  PREDICTED: uncharacterized protein LOC105114...  58.2    2e-06   Populus euphratica
ref|XP_010440498.1|  PREDICTED: uncharacterized protein LOC104723789  55.1    3e-06   
ref|XP_006597567.1|  PREDICTED: uncharacterized protein LOC100781...  57.4    3e-06   Glycine max [soybeans]
ref|XP_006597568.1|  PREDICTED: uncharacterized protein LOC100781...  57.4    3e-06   Glycine max [soybeans]
ref|XP_010512570.1|  PREDICTED: uncharacterized protein LOC104788495  57.4    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010466700.1|  PREDICTED: uncharacterized protein LOC104746856  57.0    4e-06   Camelina sativa [gold-of-pleasure]
emb|CDY49406.1|  BnaCnng17160D                                        55.1    2e-05   Brassica napus [oilseed rape]
emb|CDY12752.1|  BnaC04g28890D                                        54.7    3e-05   Brassica napus [oilseed rape]
ref|XP_010105703.1|  hypothetical protein L484_011315                 54.3    4e-05   
ref|XP_011090819.1|  PREDICTED: uncharacterized protein LOC105171...  54.3    5e-05   Sesamum indicum [beniseed]
ref|XP_011090820.1|  PREDICTED: uncharacterized protein LOC105171...  54.3    5e-05   Sesamum indicum [beniseed]
ref|XP_011090818.1|  PREDICTED: uncharacterized protein LOC105171...  54.3    5e-05   Sesamum indicum [beniseed]
ref|XP_011090817.1|  PREDICTED: uncharacterized protein LOC105171...  54.3    5e-05   Sesamum indicum [beniseed]
ref|XP_011090816.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    5e-05   Sesamum indicum [beniseed]
ref|XP_011090822.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    5e-05   Sesamum indicum [beniseed]
emb|CDX77500.1|  BnaA07g06380D                                        53.9    5e-05   
ref|XP_011090821.1|  PREDICTED: uncharacterized protein LOC105171...  53.9    5e-05   
emb|CDX85110.1|  BnaC07g07960D                                        53.9    5e-05   
ref|XP_003594093.1|  hypothetical protein MTR_2g021260                53.9    6e-05   
ref|XP_006406019.1|  hypothetical protein EUTSA_v10020399mg           53.5    8e-05   Eutrema salsugineum [saltwater cress]
gb|AES64344.2|  alpha/beta hydrolase family protein                   53.1    8e-05   Medicago truncatula
ref|XP_009102606.1|  PREDICTED: uncharacterized protein LOC103828728  51.2    5e-04   Brassica rapa
gb|KHN37552.1|  Hypothetical protein glysoja_007255                   50.1    0.001   Glycine soja [wild soybean]



>ref|XP_009609631.1| PREDICTED: uncharacterized protein LOC104103435 [Nicotiana tomentosiformis]
Length=194

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 113/162 (70%), Gaps = 8/162 (5%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDS----STSKQ  577
            LADFPS++EEEERM M+AVLESLKDLEV   P  + S+   +  P+ + DS    +++KQ
Sbjct  33   LADFPSNVEEEERMLMKAVLESLKDLEVKPPPAEQVSSKVVEELPQPLQDSKEESASTKQ  92

Query  576  CVPMNKLPAAGL-ANGHTPAKEPE---TKPRAAGIANGHNPAKEPESSKASPRRNTSVGN  409
            C P  ++ A+ + +NGH    + E   T   +A  AN    AKE +S+ AS  R+TS+ N
Sbjct  93   CTPSKEISASAIVSNGHDSDAKVEVQDTDKVSATPANSTLLAKEVKSNGASSHRDTSISN  152

Query  408  QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
            QSSS+ D+VD TKATVTVVKNP+ NIMDGL+RRWDL+FFKNR
Sbjct  153  QSSSNVDVVDGTKATVTVVKNPTSNIMDGLLRRWDLNFFKNR  194



>ref|XP_009775161.1| PREDICTED: uncharacterized protein LOC104225093 [Nicotiana sylvestris]
Length=569

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 112/163 (69%), Gaps = 8/163 (5%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDS----STSK  580
            +LADFPS++EEEERM M+AVLESLKDLEV   P  ++S+   +  P+ + DS    +++K
Sbjct  407  SLADFPSNVEEEERMLMKAVLESLKDLEVKPPPAEQASSKVVEELPQPLQDSKEESASTK  466

Query  579  QCVPMNKLPAAGL-ANGH---TPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVG  412
            QC P  ++ A+ + +NGH      +  +T   +   AN    AKE +S+  S  R+ SV 
Sbjct  467  QCTPSKEISASPIVSNGHDSDAKVQVQDTVKVSVTPANSTLSAKEVKSNGTSSHRDMSVS  526

Query  411  NQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
            +QSSSS DMVD TKATVTVVKNP+ NIMDGL+RRWDL+FFKNR
Sbjct  527  SQSSSSVDMVDGTKATVTVVKNPTSNIMDGLLRRWDLNFFKNR  569



>ref|XP_006339420.1| PREDICTED: uncharacterized protein LOC102603324 [Solanum tuberosum]
Length=568

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 109/163 (67%), Gaps = 9/163 (6%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDS----STSK  580
            N+ADFPS+++EEERM M+AVLESLKDLEV   P  ++S+      P+ + D+    ST+K
Sbjct  407  NMADFPSNVDEEERMLMKAVLESLKDLEVKPPPAEQASSDAVIELPQPLQDTREELSTAK  466

Query  579  QCVPMNKLPAAGLA-NGH---TPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVG  412
            QC P  ++ A+ +  N H      + P+TK  +   AN  +  KE E + AS  R  SV 
Sbjct  467  QCTPSKEISASAVVFNEHDSDAKVQVPDTKKVSGTPANSTSSVKEVECNGAS-HREKSVS  525

Query  411  NQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
            NQSSSS D VD TKATVTVVKNP+ N+MDGL+RRWDL+FFKN+
Sbjct  526  NQSSSSVDTVDGTKATVTVVKNPTSNVMDGLLRRWDLNFFKNK  568



>ref|XP_010322788.1| PREDICTED: uncharacterized protein LOC101262250 isoform X2 [Solanum 
lycopersicum]
Length=566

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 105/163 (64%), Gaps = 9/163 (6%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQ----PDPFPKNILDSSTSK  580
            N+ADFPS+++EEERM M+AVLESLKDLEV   P  ++S+      P P      + ST+K
Sbjct  405  NMADFPSNVDEEERMLMKAVLESLKDLEVKPPPAEQASSDDVIELPQPLQGAREELSTAK  464

Query  579  QCVPMNKLPAAGLA----NGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVG  412
            QC P  ++ A+ +     N     + P+TK  +   AN  + AKE E +  S  R  SV 
Sbjct  465  QCTPSKEISASAIVFNEQNSDAKVQVPDTKKVSVTPANSTSSAKEVECNGTS-HREKSVS  523

Query  411  NQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
            NQSSSS D VD TKATVTVVKNP+ N+MDGL RRWDL+FFKN+
Sbjct  524  NQSSSSVDTVDGTKATVTVVKNPTSNVMDGLWRRWDLNFFKNK  566



>ref|XP_004229458.1| PREDICTED: uncharacterized protein LOC101262250 isoform X1 [Solanum 
lycopersicum]
Length=568

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 105/163 (64%), Gaps = 9/163 (6%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQ----PDPFPKNILDSSTSK  580
            N+ADFPS+++EEERM M+AVLESLKDLEV   P  ++S+      P P      + ST+K
Sbjct  407  NMADFPSNVDEEERMLMKAVLESLKDLEVKPPPAEQASSDDVIELPQPLQGAREELSTAK  466

Query  579  QCVPMNKLPAAGLA----NGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVG  412
            QC P  ++ A+ +     N     + P+TK  +   AN  + AKE E +  S  R  SV 
Sbjct  467  QCTPSKEISASAIVFNEQNSDAKVQVPDTKKVSVTPANSTSSAKEVECNGTS-HREKSVS  525

Query  411  NQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
            NQSSSS D VD TKATVTVVKNP+ N+MDGL RRWDL+FFKN+
Sbjct  526  NQSSSSVDTVDGTKATVTVVKNPTSNVMDGLWRRWDLNFFKNK  568



>emb|CDO98976.1| unnamed protein product [Coffea canephora]
Length=572

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 104/167 (62%), Gaps = 14/167 (8%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVE--SSNGQ----PDPFPKNIL-DSS  589
            NLADFP+++EEEERM M AVLESLKDLEV K P VE  SSN      P+P  KN L D S
Sbjct  408  NLADFPNNIEEEERMLMVAVLESLKDLEV-KPPVVEEPSSNVGIRPPPEPSQKNDLQDPS  466

Query  588  TSKQCVPMNKLPAAGLANG--HTPAKEPETKPRAAGIANGHNPAKEPESSKA---SPRRN  424
            T+ +  P+ +  A  L     H   + P T  R             P+++++   SP  +
Sbjct  467  TAAKSEPLTEESATTLEANPPHVAPQIPLTDARNESSGTPATTVLGPQAAESNGPSPSSD  526

Query  423  TSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
              V NQSSS +D+V  TKATVTVVKNPS NIMDGL+RRWDL+FF+N+
Sbjct  527  ARVSNQSSSDSDVVG-TKATVTVVKNPSSNIMDGLLRRWDLNFFRNK  572



>gb|KJB72271.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=335

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 98/180 (54%), Gaps = 27/180 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVE---------SSNGQPDPFPKNILD  595
            +L  FP ++EEEERMFMEA++ESLKDL++ + P  E         S + + D        
Sbjct  155  DLTGFPCNVEEEERMFMEAIIESLKDLDM-RQPQTEEQAKACADSSESAKKDEINGRDTC  213

Query  594  SSTSKQC----------VPMNKLP----AAGLANGHTPAKE---PETKPRAAGIANGHNP  466
            S+T K            V  +++P    +  + NG     E   P+T   + G A   +P
Sbjct  214  STTEKSSSLPLESTSTQVVHDQVPFETQSTLVINGSNVGLEHASPDTSVSSLGRAFDRSP  273

Query  465  AKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
            + E   S +  + +TS   QSSS  DM   TKATVTVV+NPS NIMDGLMRRWDL+FF+N
Sbjct  274  STEETVSTSCAQTDTSASTQSSSDADMSGSTKATVTVVRNPSNNIMDGLMRRWDLNFFRN  333



>gb|KJB72270.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=387

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 98/180 (54%), Gaps = 27/180 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVE---------SSNGQPDPFPKNILD  595
            +L  FP ++EEEERMFMEA++ESLKDL++ + P  E         S + + D        
Sbjct  207  DLTGFPCNVEEEERMFMEAIIESLKDLDM-RQPQTEEQAKACADSSESAKKDEINGRDTC  265

Query  594  SSTSKQC----------VPMNKLP----AAGLANGHTPAKE---PETKPRAAGIANGHNP  466
            S+T K            V  +++P    +  + NG     E   P+T   + G A   +P
Sbjct  266  STTEKSSSLPLESTSTQVVHDQVPFETQSTLVINGSNVGLEHASPDTSVSSLGRAFDRSP  325

Query  465  AKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
            + E   S +  + +TS   QSSS  DM   TKATVTVV+NPS NIMDGLMRRWDL+FF+N
Sbjct  326  STEETVSTSCAQTDTSASTQSSSDADMSGSTKATVTVVRNPSNNIMDGLMRRWDLNFFRN  385



>gb|KJB72266.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72267.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72269.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=584

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 98/180 (54%), Gaps = 27/180 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVE---------SSNGQPDPFPKNILD  595
            +L  FP ++EEEERMFMEA++ESLKDL++ + P  E         S + + D        
Sbjct  404  DLTGFPCNVEEEERMFMEAIIESLKDLDM-RQPQTEEQAKACADSSESAKKDEINGRDTC  462

Query  594  SSTSKQC----------VPMNKLP----AAGLANGHTPAKE---PETKPRAAGIANGHNP  466
            S+T K            V  +++P    +  + NG     E   P+T   + G A   +P
Sbjct  463  STTEKSSSLPLESTSTQVVHDQVPFETQSTLVINGSNVGLEHASPDTSVSSLGRAFDRSP  522

Query  465  AKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
            + E   S +  + +TS   QSSS  DM   TKATVTVV+NPS NIMDGLMRRWDL+FF+N
Sbjct  523  STEETVSTSCAQTDTSASTQSSSDADMSGSTKATVTVVRNPSNNIMDGLMRRWDLNFFRN  582



>gb|KDO74882.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=399

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 28/182 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVES-SNGQPDPFPKN----ILDSSTS  583
            +LA FPS++EEEERMFMEAV+ SLKDLE+ + P VE  ++   D F  +      D ST+
Sbjct  219  DLAGFPSNVEEEERMFMEAVIMSLKDLEM-RHPEVEQPTSVAADSFKSSGQGATNDCSTT  277

Query  582  KQCVP----------------MNKLPAAGLANGHTPAKE---PETKPRAAGIANGHNPAK  460
              C P                  +  +  L N    A +   P+T   + G A    P+ 
Sbjct  278  DHCKPSESETSSSSIEQLRPIYTESTSTSLVNSRNLAPQHPSPDTSVSSVGDAFDTPPSS  337

Query  459  -EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
             E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP+G++M+GLMRRWDL+FF+
Sbjct  338  VESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNPAGHVMEGLMRRWDLNFFR  397

Query  288  NR  283
            NR
Sbjct  398  NR  399



>gb|KDO74881.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=450

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 28/182 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVES-SNGQPDPFPKN----ILDSSTS  583
            +LA FPS++EEEERMFMEAV+ SLKDLE+ + P VE  ++   D F  +      D ST+
Sbjct  270  DLAGFPSNVEEEERMFMEAVIMSLKDLEM-RHPEVEQPTSVAADSFKSSGQGATNDCSTT  328

Query  582  KQCVP----------------MNKLPAAGLANGHTPAKE---PETKPRAAGIANGHNPAK  460
              C P                  +  +  L N    A +   P+T   + G A    P+ 
Sbjct  329  DHCKPSESETSSSSIEQLRPIYTESTSTSLVNSRNLAPQHPSPDTSVSSVGDAFDTPPSS  388

Query  459  -EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
             E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP+G++M+GLMRRWDL+FF+
Sbjct  389  VESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNPAGHVMEGLMRRWDLNFFR  448

Query  288  NR  283
            NR
Sbjct  449  NR  450



>gb|KHG30285.1| putative yqkD [Gossypium arboreum]
Length=528

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 96/180 (53%), Gaps = 27/180 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVE---------SSNGQPDPFPKNILD  595
            +L  FP ++EEEERMFMEA++ESLKDL++ + P  E         S + + D        
Sbjct  348  DLTGFPCNVEEEERMFMEAIIESLKDLDM-RQPQTEEQAKACADSSESAKKDEINGRDTC  406

Query  594  SSTSKQC----------VPMNKLP----AAGLANGHTPAKE---PETKPRAAGIANGHNP  466
            S+T K            V  +++P    +  + NG     E   P+T   + G A    P
Sbjct  407  STTEKSSSLPLESTSTQVVHDQVPFETQSTLVINGSNVGLEHASPDTSVSSLGRAFDRPP  466

Query  465  AKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
            + E   S +  R ++S   QSS   DM   TKATVTVV+NPS NIMDGLMRRWDL+FF+N
Sbjct  467  STEETVSTSCARTDSSASTQSSYDADMSGSTKATVTVVRNPSNNIMDGLMRRWDLNFFRN  526



>gb|KDO74880.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 28/182 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVES-SNGQPDPFPKN----ILDSSTS  583
            +LA FPS++EEEERMFMEAV+ SLKDLE+ + P VE  ++   D F  +      D ST+
Sbjct  405  DLAGFPSNVEEEERMFMEAVIMSLKDLEM-RHPEVEQPTSVAADSFKSSGQGATNDCSTT  463

Query  582  KQCVP----------------MNKLPAAGLANGHTPAKE---PETKPRAAGIANGHNPAK  460
              C P                  +  +  L N    A +   P+T   + G A    P+ 
Sbjct  464  DHCKPSESETSSSSIEQLRPIYTESTSTSLVNSRNLAPQHPSPDTSVSSVGDAFDTPPSS  523

Query  459  -EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
             E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP+G++M+GLMRRWDL+FF+
Sbjct  524  VESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNPAGHVMEGLMRRWDLNFFR  583

Query  288  NR  283
            NR
Sbjct  584  NR  585



>ref|XP_006419777.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
 gb|ESR33017.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
Length=588

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 28/182 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVES-SNGQPDPFPKN----ILDSSTS  583
            +LA FPS++EEEERMFMEAV+ SLKDLE+ + P VE  ++   D F  +      D ST+
Sbjct  408  DLAGFPSNVEEEERMFMEAVIMSLKDLEM-RHPEVEQPTSVAADSFKSSGQGATNDCSTT  466

Query  582  KQCVP----------------MNKLPAAGLANGHTPAKE---PETKPRAAGIANGHNPAK  460
              C P                  +  +  L N    A +   P+T   + G A    P+ 
Sbjct  467  DHCKPSESETSSSSIEQLRPIYTESTSTSLVNSRNLAPQHPSPDTSVSSVGDAFDTPPSS  526

Query  459  -EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
             E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP+G++M+GLMRRWDL+FF+
Sbjct  527  VESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNPAGHVMEGLMRRWDLNFFR  586

Query  288  NR  283
            NR
Sbjct  587  NR  588



>ref|XP_006489238.1| PREDICTED: uncharacterized protein LOC102610023 [Citrus sinensis]
Length=588

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 28/182 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVES-SNGQPDPFPKN----ILDSSTS  583
            +LA FPS++EEEERMFMEAV+ SLKDLE+ + P VE  ++   D F  +      D ST+
Sbjct  408  DLAGFPSNVEEEERMFMEAVIMSLKDLEM-RHPEVEQPTSVAADSFKSSGQGATNDCSTT  466

Query  582  KQCVP----------------MNKLPAAGLANGHTPAKE---PETKPRAAGIANGHNPAK  460
              C P                  +  +  L N    A +   P+T   + G A    P+ 
Sbjct  467  DHCKPSESETSSSSIEQLRPIYTESTSTSLVNSRNLAPQHPSPDTSVSSVGDAFDTPPSS  526

Query  459  -EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
             E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP+G++M+GLMRRWDL+FF+
Sbjct  527  VESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNPAGHVMEGLMRRWDLNFFR  586

Query  288  NR  283
            NR
Sbjct  587  NR  588



>gb|KDO74878.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=588

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 28/182 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVES-SNGQPDPFPKN----ILDSSTS  583
            +LA FPS++EEEERMFMEAV+ SLKDLE+ + P VE  ++   D F  +      D ST+
Sbjct  408  DLAGFPSNVEEEERMFMEAVIMSLKDLEM-RHPEVEQPTSVAADSFKSSGQGATNDCSTT  466

Query  582  KQCVP----------------MNKLPAAGLANGHTPAKE---PETKPRAAGIANGHNPAK  460
              C P                  +  +  L N    A +   P+T   + G A    P+ 
Sbjct  467  DHCKPSESETSSSSIEQLRPIYTESTSTSLVNSRNLAPQHPSPDTSVSSVGDAFDTPPSS  526

Query  459  -EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
             E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP+G++M+GLMRRWDL+FF+
Sbjct  527  VESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNPAGHVMEGLMRRWDLNFFR  586

Query  288  NR  283
            NR
Sbjct  587  NR  588



>gb|KDO74879.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 28/182 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVES-SNGQPDPFPKN----ILDSSTS  583
            +LA FPS++EEEERMFMEAV+ SLKDLE+ + P VE  ++   D F  +      D ST+
Sbjct  405  DLAGFPSNVEEEERMFMEAVIMSLKDLEM-RHPEVEQPTSVAADSFKSSGQGATNDCSTT  463

Query  582  KQCVP----------------MNKLPAAGLANGHTPAKE---PETKPRAAGIANGHNPAK  460
              C P                  +  +  L N    A +   P+T   + G A    P+ 
Sbjct  464  DHCKPSESETSSSSIEQLRPIYTESTSTSLVNSRNLAPQHPSPDTSVSSVGDAFDTPPSS  523

Query  459  -EPESSKASPRRNTSV--GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
             E  S+  S R +TS     QSS+  D+  +TKATVTVVKNP+G++M+GLMRRWDL+FF+
Sbjct  524  VESASTGTSARTDTSATASTQSSADADVSSNTKATVTVVKNPAGHVMEGLMRRWDLNFFR  583

Query  288  NR  283
            NR
Sbjct  584  NR  585



>ref|XP_011071522.1| PREDICTED: uncharacterized protein LOC105156947 [Sesamum indicum]
Length=605

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 105/198 (53%), Gaps = 45/198 (23%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVE---------------SSNGQPDPFP  610
            LADFPS+ EEEERM MEAVLESLKDLEV + P VE               ++NGQ D F 
Sbjct  409  LADFPSNAEEEERMLMEAVLESLKDLEV-RQPRVEQPSSDGGNDVESKPEAANGQEDSFS  467

Query  609  ---KNILDSSTSKQCVPMNKLPAAGLANG------HTPAKEPETKPRAA---------GI  484
               K++     S      +KL +  L +        +P+ E ET+  +           +
Sbjct  468  TQNKSLKTELVSTSAADEHKLVSEMLPSDPNEVLKCSPSAEVETQETSFPCDLSTCNHIV  527

Query  483  ANGHNPAKEPESSKASPRRNTSV-----------GNQSSSSTDMVDHTKATVTVVKNPSG  337
            ++  N +KEP +   +P  N +V           G+QSSS  DM D TK TV VVK P+ 
Sbjct  528  SDADNHSKEPSTVVKNPTSNDAVSDGMSHNGTPSGDQSSSEVDMADRTKVTVKVVKTPTN  587

Query  336  NIMDGLMRRWDLSFFKNR  283
            NIMDGL+RRWDL+FF+NR
Sbjct  588  NIMDGLLRRWDLNFFRNR  605



>ref|XP_010649852.1| PREDICTED: uncharacterized protein LOC100257995 [Vitis vinifera]
Length=599

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 106/191 (55%), Gaps = 39/191 (20%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESS-----NGQPDPFPKNILD-SST  586
            NLADFPS++EEEERMFMEAV+ESLK+LE ++ PH E          P+   K+  D SST
Sbjct  409  NLADFPSNVEEEERMFMEAVIESLKELE-TRHPHAEDQPPNVGTALPESSKKDNQDASST  467

Query  585  SKQCVPMNK--LPAAGLANGHTPA-----KEPETKPRAAGIANGHNPAKE---PESSKAS  436
            ++Q  P+    +P +G  N H  A     +   +K +       HN A +   P++S +S
Sbjct  468  AEQNGPLRAALVPDSG-TNCHVDACSTTEQCGSSKSQPTSATTDHNLAVDQPSPDTSVSS  526

Query  435  PR---------------RNTSVGN------QSSSSTDMVDHTKATVTVVKNPSGNIMDGL  319
                             R TS  +      QSSS  D+  +TKATVTVVKNP+ +IMDGL
Sbjct  527  VEPAFDTPKSFIGSESTRTTSAQSDDSTSIQSSSDADVAGNTKATVTVVKNPASHIMDGL  586

Query  318  MRRWDLSFFKN  286
            MRRWD +FF+N
Sbjct  587  MRRWDFNFFRN  597



>emb|CBI26166.3| unnamed protein product [Vitis vinifera]
Length=601

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 106/191 (55%), Gaps = 39/191 (20%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESS-----NGQPDPFPKNILD-SST  586
            NLADFPS++EEEERMFMEAV+ESLK+LE ++ PH E          P+   K+  D SST
Sbjct  411  NLADFPSNVEEEERMFMEAVIESLKELE-TRHPHAEDQPPNVGTALPESSKKDNQDASST  469

Query  585  SKQCVPMNK--LPAAGLANGHTPA-----KEPETKPRAAGIANGHNPAKE---PESSKAS  436
            ++Q  P+    +P +G  N H  A     +   +K +       HN A +   P++S +S
Sbjct  470  AEQNGPLRAALVPDSG-TNCHVDACSTTEQCGSSKSQPTSATTDHNLAVDQPSPDTSVSS  528

Query  435  PR---------------RNTSVGN------QSSSSTDMVDHTKATVTVVKNPSGNIMDGL  319
                             R TS  +      QSSS  D+  +TKATVTVVKNP+ +IMDGL
Sbjct  529  VEPAFDTPKSFIGSESTRTTSAQSDDSTSIQSSSDADVAGNTKATVTVVKNPASHIMDGL  588

Query  318  MRRWDLSFFKN  286
            MRRWD +FF+N
Sbjct  589  MRRWDFNFFRN  599



>ref|XP_010278885.1| PREDICTED: uncharacterized protein LOC104612914 isoform X2 [Nelumbo 
nucifera]
Length=510

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 97/176 (55%), Gaps = 26/176 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV--------SKTPHVESSNGQPDPFPK-NILD  595
            NLA+FP S+E+EERM MEAV+ESLKDLEV         + P+V +S+  P+   K NI  
Sbjct  336  NLAEFPCSVEDEERMIMEAVIESLKDLEVRQPIPTEKEQIPNVSTSS--PECSRKDNIEA  393

Query  594  SSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEP------ESSKASP  433
            SSTSK C P+ K+  +  +   +   + E     A +++     K P      ES   S 
Sbjct  394  SSTSKNCRPL-KMDESSTSATDSHGSDYERHGPDASVSSSGTKYKTPPSSINIESIGTSA  452

Query  432  RRNTSVGNQSSS--------STDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
             R TS   Q  S        + DM D T+AT+TV KNP+ +IMDGLM RW L+FFK
Sbjct  453  CRETSASVQCPSEGDRSQQDAADMSDGTRATLTVQKNPNNHIMDGLMHRWGLNFFK  508



>ref|XP_010278880.1| PREDICTED: uncharacterized protein LOC104612914 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 97/176 (55%), Gaps = 26/176 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV--------SKTPHVESSNGQPDPFPK-NILD  595
            NLA+FP S+E+EERM MEAV+ESLKDLEV         + P+V +S+  P+   K NI  
Sbjct  410  NLAEFPCSVEDEERMIMEAVIESLKDLEVRQPIPTEKEQIPNVSTSS--PECSRKDNIEA  467

Query  594  SSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEP------ESSKASP  433
            SSTSK C P+ K+  +  +   +   + E     A +++     K P      ES   S 
Sbjct  468  SSTSKNCRPL-KMDESSTSATDSHGSDYERHGPDASVSSSGTKYKTPPSSINIESIGTSA  526

Query  432  RRNTSVGNQSSS--------STDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
             R TS   Q  S        + DM D T+AT+TV KNP+ +IMDGLM RW L+FFK
Sbjct  527  CRETSASVQCPSEGDRSQQDAADMSDGTRATLTVQKNPNNHIMDGLMHRWGLNFFK  582



>gb|EYU45603.1| hypothetical protein MIMGU_mgv1a0037051mg, partial [Erythranthe 
guttata]
Length=529

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 91/164 (55%), Gaps = 13/164 (8%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSN-----GQPDPFPKNILDSSTSK  580
            LADFP+++EEEERM M AVLESLKD++V   P VE S+      Q D      + S+++ 
Sbjct  369  LADFPTNVEEEERMLMVAVLESLKDMDVGP-PRVEESSKDSLSTQTDSIKTEQV-STSAT  426

Query  579  QCVPMNK---LPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSK--ASPRRNTSV  415
             C  +     LP   + + + P  EP  + +     +     KE E ++   S   +  +
Sbjct  427  DCDTLESQTPLPNPDILDKNHP-NEPLIEIKNITTKDTAPSRKEEEKAREVTSSYSDAPL  485

Query  414  GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
             N  SS  DM D TK T+ V K P+ NIMDGL+RRWDL+FF+NR
Sbjct  486  ANGGSSEADMADRTKVTLEVEKTPTNNIMDGLLRRWDLNFFRNR  529



>ref|XP_004508352.1| PREDICTED: uncharacterized protein LOC101492469 isoform X1 [Cicer 
arietinum]
Length=603

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 100/194 (52%), Gaps = 43/194 (22%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVS-----KTPHVESSNGQPDPFPKNILDSSTS  583
            +LA FPSS EEEERM MEAV+ESLKDL+V      + P    +N   +P  K+   +S+ 
Sbjct  409  DLAGFPSSAEEEERMLMEAVMESLKDLKVQNPKAEQPPASSVANVSVEPSDKDESHASSQ  468

Query  582  KQCVPMNKLPA-------------AGLANGHTPAK-EPET-----------KPRAAGIAN  478
              C PM K P+             +       P K EP T           KP   G   
Sbjct  469  VICRPMKKEPSPVKHSIDSKSKTISTAPQEFVPLKAEPHTISGNHPQSLTSKPSPVG---  525

Query  477  GHNP----------AKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIM  328
            G  P            E  ++  S R ++S   QSSS+TD+  +T+ATVTVV+NP+G++M
Sbjct  526  GMQPPLQDNTLSVTLTESSNTSGSARSDSSASLQSSSNTDISHNTRATVTVVRNPAGHVM  585

Query  327  DGLMRRWDLSFFKN  286
            DGLMRRWD +FFKN
Sbjct  586  DGLMRRWDFNFFKN  599



>ref|XP_004508353.1| PREDICTED: uncharacterized protein LOC101492469 isoform X2 [Cicer 
arietinum]
Length=601

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 100/194 (52%), Gaps = 43/194 (22%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVS-----KTPHVESSNGQPDPFPKNILDSSTS  583
            +LA FPSS EEEERM MEAV+ESLKDL+V      + P    +N   +P  K+   +S+ 
Sbjct  407  DLAGFPSSAEEEERMLMEAVMESLKDLKVQNPKAEQPPASSVANVSVEPSDKDESHASSQ  466

Query  582  KQCVPMNKLPA-------------AGLANGHTPAK-EPET-----------KPRAAGIAN  478
              C PM K P+             +       P K EP T           KP   G   
Sbjct  467  VICRPMKKEPSPVKHSIDSKSKTISTAPQEFVPLKAEPHTISGNHPQSLTSKPSPVG---  523

Query  477  GHNP----------AKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIM  328
            G  P            E  ++  S R ++S   QSSS+TD+  +T+ATVTVV+NP+G++M
Sbjct  524  GMQPPLQDNTLSVTLTESSNTSGSARSDSSASLQSSSNTDISHNTRATVTVVRNPAGHVM  583

Query  327  DGLMRRWDLSFFKN  286
            DGLMRRWD +FFKN
Sbjct  584  DGLMRRWDFNFFKN  597



>ref|XP_004154381.1| PREDICTED: uncharacterized protein LOC101218432 [Cucumis sativus]
 ref|XP_004166999.1| PREDICTED: uncharacterized protein LOC101225095 [Cucumis sativus]
 gb|KGN46163.1| hypothetical protein Csa_6G061740 [Cucumis sativus]
Length=595

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 95/190 (50%), Gaps = 41/190 (22%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVP  568
            +L+ FP S+EEEERM MEAV+ESLKDL++         + Q      N  D     +C  
Sbjct  407  DLSGFPCSVEEEERMLMEAVMESLKDLKMKNA----QDDNQASSVCTNNKDILQKDEC-G  461

Query  567  MNKLPAAGLA--------NGHTPAKEPET-----------KPRAAGIANGHNPAKE----  457
            ++++   G+         N H    + E+           KP +  +A   N   +    
Sbjct  462  VSRIDHCGVLHPQAPTTPNDHFSQFKAESASTSEEYSISIKPESTSVARDLNSVSDRSCF  521

Query  456  -------------PESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLM  316
                          ES+ AS   NT   +QSS+  D+  +TKATVTVV+NP+G+IMDGL+
Sbjct  522  DKSESFAVPSTAGTESAGASSCTNTPANSQSSTEADLSANTKATVTVVRNPAGHIMDGLI  581

Query  315  RRWDLSFFKN  286
            RRWDL+FF+N
Sbjct  582  RRWDLNFFRN  591



>ref|XP_004145038.1| PREDICTED: uncharacterized protein LOC101215845 [Cucumis sativus]
Length=586

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 95/190 (50%), Gaps = 41/190 (22%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVP  568
            +L+ FP S+EEEERM MEAV+ESLKDL++         + Q      N  D     +C  
Sbjct  398  DLSGFPCSVEEEERMLMEAVMESLKDLKMKNA----QDDNQASSVCTNNKDILQKDEC-G  452

Query  567  MNKLPAAGLA--------NGHTPAKEPET-----------KPRAAGIANGHNPAKE----  457
            ++++   G+         N H    + E+           KP +  +A   N   +    
Sbjct  453  VSRIDHCGVLHPQAPTTPNDHFSQFKAESASTSEEYSISIKPESTSVARDLNSVSDRSCF  512

Query  456  -------------PESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLM  316
                          ES+ AS   NT   +QSS+  D+  +TKATVTVV+NP+G+IMDGL+
Sbjct  513  DKSESFAVPSTAGTESAGASSCTNTPANSQSSTEADLSANTKATVTVVRNPAGHIMDGLI  572

Query  315  RRWDLSFFKN  286
            RRWDL+FF+N
Sbjct  573  RRWDLNFFRN  582



>ref|XP_003529600.1| PREDICTED: uncharacterized protein LOC100798920 isoform X1 [Glycine 
max]
Length=607

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 99/202 (49%), Gaps = 48/202 (24%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV-------------------------------  661
            +LA FPS+ EEEERMFMEAV+ESLKDLEV                               
Sbjct  407  DLAGFPSTAEEEERMFMEAVMESLKDLEVRNPNADQPTSSFSSLSVAAVEPSDKGASWQE  466

Query  660  -SKTPHVESSNGQPDPFPKNILDSSTSKQCVPMNKLPAAGLANGHTP--AKEPETKPRAA  490
             S+    ESS+ +     K+   SST+++C P+ K  +  ++  H+     EP   P  +
Sbjct  467  ISRPVETESSSLKHTTDSKSKTTSSTAEECEPL-KGESNSISVNHSQNVVSEPSPVPSVS  525

Query  489  GIANGHNPAKEPESSKASPRRNTSVGNQSSSS-------------TDMVDHTKATVTVVK  349
                 H   + P S+       T   N S S+             TD+  +TKATVTVV+
Sbjct  526  LEGPAHLQLQPPPSAPTDTLSVTESSNTSGSARSDSSASLQSSSETDVSHNTKATVTVVR  585

Query  348  NPSGNIMDGLMRRWDLSFFKNR  283
            NP+G++MDGLMRRWD +FFKN+
Sbjct  586  NPAGHVMDGLMRRWDFNFFKNK  607



>ref|XP_006584056.1| PREDICTED: uncharacterized protein LOC100798920 isoform X3 [Glycine 
max]
Length=608

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 99/202 (49%), Gaps = 48/202 (24%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV-------------------------------  661
            +LA FPS+ EEEERMFMEAV+ESLKDLEV                               
Sbjct  408  DLAGFPSTAEEEERMFMEAVMESLKDLEVRNPNADQPTSSFSSLSVAAVEPSDKGASWQE  467

Query  660  -SKTPHVESSNGQPDPFPKNILDSSTSKQCVPMNKLPAAGLANGHTP--AKEPETKPRAA  490
             S+    ESS+ +     K+   SST+++C P+ K  +  ++  H+     EP   P  +
Sbjct  468  ISRPVETESSSLKHTTDSKSKTTSSTAEECEPL-KGESNSISVNHSQNVVSEPSPVPSVS  526

Query  489  GIANGHNPAKEPESSKASPRRNTSVGNQSSSS-------------TDMVDHTKATVTVVK  349
                 H   + P S+       T   N S S+             TD+  +TKATVTVV+
Sbjct  527  LEGPAHLQLQPPPSAPTDTLSVTESSNTSGSARSDSSASLQSSSETDVSHNTKATVTVVR  586

Query  348  NPSGNIMDGLMRRWDLSFFKNR  283
            NP+G++MDGLMRRWD +FFKN+
Sbjct  587  NPAGHVMDGLMRRWDFNFFKNK  608



>ref|XP_006584055.1| PREDICTED: uncharacterized protein LOC100798920 isoform X2 [Glycine 
max]
Length=609

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 99/202 (49%), Gaps = 48/202 (24%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV-------------------------------  661
            +LA FPS+ EEEERMFMEAV+ESLKDLEV                               
Sbjct  409  DLAGFPSTAEEEERMFMEAVMESLKDLEVRNPNADQPTSSFSSLSVAAVEPSDKGASWQE  468

Query  660  -SKTPHVESSNGQPDPFPKNILDSSTSKQCVPMNKLPAAGLANGHTP--AKEPETKPRAA  490
             S+    ESS+ +     K+   SST+++C P+ K  +  ++  H+     EP   P  +
Sbjct  469  ISRPVETESSSLKHTTDSKSKTTSSTAEECEPL-KGESNSISVNHSQNVVSEPSPVPSVS  527

Query  489  GIANGHNPAKEPESSKASPRRNTSVGNQSSSS-------------TDMVDHTKATVTVVK  349
                 H   + P S+       T   N S S+             TD+  +TKATVTVV+
Sbjct  528  LEGPAHLQLQPPPSAPTDTLSVTESSNTSGSARSDSSASLQSSSETDVSHNTKATVTVVR  587

Query  348  NPSGNIMDGLMRRWDLSFFKNR  283
            NP+G++MDGLMRRWD +FFKN+
Sbjct  588  NPAGHVMDGLMRRWDFNFFKNK  609



>gb|KHN03032.1| Hypothetical protein glysoja_009898 [Glycine soja]
Length=584

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 99/202 (49%), Gaps = 48/202 (24%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV-------------------------------  661
            +LA FPS+ EEEERMFMEAV+ESLKDLEV                               
Sbjct  384  DLAGFPSTAEEEERMFMEAVMESLKDLEVRNPNADQPTSSFSSLSVAAVEPSDKGASWQE  443

Query  660  -SKTPHVESSNGQPDPFPKNILDSSTSKQCVPMNKLPAAGLANGHTP--AKEPETKPRAA  490
             S+    ESS+ +     K+   SST+++C P+ K  +  ++  H+     EP   P  +
Sbjct  444  ISRPVETESSSLKHTTDSKSKTTSSTAEECEPL-KGESNSISVNHSQNVVSEPSPVPSVS  502

Query  489  GIANGHNPAKEPESSKASPRRNTSVGNQSSSS-------------TDMVDHTKATVTVVK  349
                 H   + P S+       T   N S S+             TD+  +TKATVTVV+
Sbjct  503  LEGPAHLQLQPPPSAPTDTLSVTESSNTSGSARSDSSASLQSSSETDVSHNTKATVTVVR  562

Query  348  NPSGNIMDGLMRRWDLSFFKNR  283
            NP+G++MDGLMRRWD +FFKN+
Sbjct  563  NPAGHVMDGLMRRWDFNFFKNK  584



>ref|XP_004296971.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462782.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462783.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
Length=591

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 96/188 (51%), Gaps = 40/188 (21%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSK-TPHVESSNGQPDPFPKNILDSS------  589
            +LA FPS +EEEERMFMEAVL SLKDLE+    P  E    QP   P N  DSS      
Sbjct  406  DLAGFPSDVEEEERMFMEAVLLSLKDLEMRHPNPQAEE---QP---PGNTPDSSKLSDKD  459

Query  588  -TSKQCVPMNKLPAAGLA-----NGHTPAKEPETKPRAAGIANGHNPAKE----------  457
                   P+ +L +   A     N    + + E+   AA   N   P ++          
Sbjct  460  DYHDAVSPLEQLESVETASTSTSNAQCGSSKAESISSAAVKVNDSRPEQQIPDAAVPSMK  519

Query  456  PESSKASPRRNT-SVGN----------QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRR  310
            P    ++ RR++ S G+          QS+  TDM  +T ATVTVVKNPS ++MDGLMRR
Sbjct  520  PAFGTSTSRRDSGSAGSSTQKDAPDKIQSTLDTDMSANTTATVTVVKNPSSHVMDGLMRR  579

Query  309  WDLSFFKN  286
            WD +FF+N
Sbjct  580  WDFNFFRN  587



>gb|AFK48377.1| unknown [Lotus japonicus]
Length=170

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 77/172 (45%), Gaps = 44/172 (26%)
 Frame = -1

Query  687  LESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVPMNKLPAAGLANGHTPAKEPE  508
            +ESLKDLEV + P  ESS       P +  DS TS Q +      A+ L    T     +
Sbjct  1    MESLKDLEV-QNPKAESSVSTVSVEPSDKDDSHTSSQEISTTVKKASSLVKHCT-----D  54

Query  507  TKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMV------------------  382
            +K +    A+      + ES+  S  R+  +G+++SS  +++                  
Sbjct  55   SKSKTISTASEECAPLKTESNHVSVNRSQDLGSETSSDGEVLPPPPPLGTSSATESSHAS  114

Query  381  --------------------DHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
                                  TKATVTVVKNP+ N+MDGLMRRWD +FF+N
Sbjct  115  GSARCDSSGSLQSSSESDISHSTKATVTVVKNPASNVMDGLMRRWDFNFFRN  166



>ref|XP_002868296.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44555.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 85/166 (51%), Gaps = 26/166 (16%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVPM  565
            LADFPS+ EEEERM MEAV++SLKD+EV    + E SN   +    N   S+T ++    
Sbjct  406  LADFPSNAEEEERMLMEAVMKSLKDMEVETHQNKEPSNTNTENTEGNAASSTTEQELAHS  465

Query  564  NKLPAAG----------LANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSV  415
               PA G           +    P K  ++ P   G  N   P   P++S+         
Sbjct  466  ETAPAPGPTPCNHDARSSSEASVPFKTSDSLP---GPVNVFVPGASPKTSQ---------  513

Query  414  GNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
                +   D+   TKATVTVV   + SGN++DGL+RRWDL+FFK R
Sbjct  514  --NKNDVIDLSARTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKGR  557



>ref|XP_010255853.1| PREDICTED: uncharacterized protein LOC104596404 [Nelumbo nucifera]
Length=580

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 100/175 (57%), Gaps = 25/175 (14%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV-----SKTPHVESSNGQPDPFPKNILD-SST  586
            NLAD+P S E+EERMFMEA++ESLKD+EV      +TP++ +S+  P+   K+ L+ SST
Sbjct  409  NLADYPCSTEDEERMFMEAIVESLKDMEVKQPTEEQTPNMSTSS--PECSQKDDLEASST  466

Query  585  SKQC-------VPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRR  427
            S  C         ++   + G   GH+P    E+  R       H  + E  S+ AS  R
Sbjct  467  SNNCGLLRMDDSSISATDSRGTECGHSPPDASESSSRPT--FETHLSSIETGSAGASACR  524

Query  426  N--TSVGNQSSS------STDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
            +  +SV   S S      + DM   T+AT+TV K+ + ++MDGLM+RW L+FF++
Sbjct  525  DITSSVKGLSGSDRSAQDAADMEGGTRATLTVEKSQTNHVMDGLMQRWGLNFFRS  579



>ref|XP_007034567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY05493.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=587

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 93/187 (50%), Gaps = 41/187 (22%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVP  568
            +L  FP ++EEEERMFMEA++ESLKDLE  + P VE         PK   DSS S Q   
Sbjct  407  DLTGFPCNVEEEERMFMEAIIESLKDLETQR-PQVEDQ-------PKACADSSESLQKDD  458

Query  567  MN---------KLPAAGLANGHTPA-KEPETKPRAAGIANGHNPAKEPES-----SKASP  433
            +N         K  +    +  TP  ++   +  +  + NG N A E  S     S   P
Sbjct  459  INSRDTSSTTEKCSSLPPESTSTPVERQAPFETESKLVINGSNVAHEHTSPSTCVSSVGP  518

Query  432  RRNTSVGNQSSSST------------------DMVDHTKATVTVVKNPSGNIMDGLMRRW  307
              +T +    S ST                  DM   TKATVTV++NPS NIMDGLMRRW
Sbjct  519  AFDTPLSTIESGSTVTSARSDSSASIQSSSDADMSASTKATVTVIRNPSTNIMDGLMRRW  578

Query  306  DLSFFKN  286
            DL+FF+N
Sbjct  579  DLNFFRN  585



>gb|KEH32227.1| alpha/beta-hydrolase superfamily protein [Medicago truncatula]
Length=594

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 98/187 (52%), Gaps = 36/187 (19%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVES------SNGQPDPFPKNILDSST  586
            +LA FPSS EEEERM MEAV+ESLKDLEV + P  E       +N   +P  K+   SS+
Sbjct  407  DLAGFPSSAEEEERMLMEAVMESLKDLEV-QNPKAEQPPASSIANVSAEPSDKDDSHSSS  465

Query  585  SKQCVPMNKLPAAGLANGHTPAK----------EPETKPRAAGIA--------NGHNP--  466
             +   PM K   + L    T AK            + K  +  I+         G  P  
Sbjct  466  REISKPMQK--ESSLVKYSTDAKSITISIASEESVQLKAESNTISAVSESSPIGGTQPPL  523

Query  465  -------AKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRW  307
                     E  ++  S R ++S   QSSS TD+  +T ATVTVV+NP+G+IMDGLMRRW
Sbjct  524  PQDNTLSVTESSNTSGSARSDSSASLQSSSDTDISHNTTATVTVVRNPAGHIMDGLMRRW  583

Query  306  DLSFFKN  286
            D +FFKN
Sbjct  584  DFNFFKN  590



>ref|XP_011014506.1| PREDICTED: uncharacterized protein LOC105118291 [Populus euphratica]
Length=583

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 91/178 (51%), Gaps = 28/178 (16%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPF---------------  613
            +LA FP  +EEEERMFMEAV+ESLKDLE+ + P   +++GQP                  
Sbjct  408  DLAGFPCDIEEEERMFMEAVIESLKDLEM-RHP---NADGQPASVSPASVKYSQKDSGDA  463

Query  612  --------PKNILDSSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIA-NGHNPAK  460
                    P N   S + KQ        A    N  T    P T   + G   +  +   
Sbjct  464  SSIVEHGNPLNTPTSISVKQKTESTSSLAVNDQNLATEGPSPATSAASVGTTFDTPSSIM  523

Query  459  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
              ES+  S R +TS    SS+ +D+  +TKAT+TV +NP+G+IMDGL+RRWD + F+N
Sbjct  524  GSESTATSSRSDTSGSVHSSTDSDLSGNTKATLTVERNPAGHIMDGLLRRWDFNLFRN  581



>ref|XP_008340898.1| PREDICTED: uncharacterized protein LOC103403829 [Malus domestica]
Length=589

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 96/182 (53%), Gaps = 31/182 (17%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESS--NGQPDPFP----KNILDSST  586
            +LA FPS ++EEERMFMEAV+ SLKDLE+ + P  E       PD        +  D ++
Sbjct  407  DLAGFPSDVDEEERMFMEAVILSLKDLEM-RGPQAEEQPPGDTPDSLKSSQKDDQRDDAS  465

Query  585  SKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHN-----------PAKEP-----  454
              +   + +  +   + GH  + + E+   +  ++  H+           P+ EP     
Sbjct  466  PAEKRELLETESTSTSVGHLGSLKTEST--STSVSKSHBSRPEDQSRTRVPSTEPALQTP  523

Query  453  ----ESSKASP--RRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFF  292
                E+  A P  + +TS   QS+S  D+   T ATVTVVKNP+ N+MDGL+RRWD +FF
Sbjct  524  LSIMENGSAGPSSQSDTSESIQSTSDGDLSAKTTATVTVVKNPASNVMDGLIRRWDFNFF  583

Query  291  KN  286
            +N
Sbjct  584  RN  585



>ref|XP_008390806.1| PREDICTED: uncharacterized protein LOC103453051 [Malus domestica]
Length=588

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 96/186 (52%), Gaps = 40/186 (22%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVS----------KTP---HVESSNGQPDPF--  613
            +L  FPS ++EEERM MEAV+ SLKDLE+            TP   ++   + QPD    
Sbjct  407  DLEGFPSDVDEEERMLMEAVMLSLKDLEMRGPQADEXPPWDTPDSLNLSQKDDQPDDAST  466

Query  612  --PKNILDSSTSKQCV-----PMNKLPAAGLANGH-------TPAKEPETKPRAA---GI  484
               + +L++ ++   V        +  +  ++  H       TP + P T+P +     I
Sbjct  467  AEKRELLETESTSTSVGHLGSSKTESISTSVSKSHDSRPEDQTPTRVPTTEPASQTPLSI  526

Query  483  ANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWD  304
             +G        S+ AS + +TS   Q +S  D+   T ATVTVVKNP+ N+MDGL+RRWD
Sbjct  527  MDG--------SAGASSQSDTSESIQRTSDXDLSAKTTATVTVVKNPASNVMDGLIRRWD  578

Query  303  LSFFKN  286
             +FF+N
Sbjct  579  FNFFRN  584



>ref|XP_006600321.1| PREDICTED: uncharacterized protein LOC100807823 isoform X1 [Glycine 
max]
Length=608

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 98/204 (48%), Gaps = 52/204 (25%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV-------------------------------  661
            +LA FPS+ EEEERMFMEAV+ESLKDLEV                               
Sbjct  408  DLAGFPSTAEEEERMFMEAVMESLKDLEVRNPNAEQPTSSVSSVYVDAVEPSDKDASSGE  467

Query  660  -SKTPHVESSNGQPDPFPKNILDSSTSKQCVPMN-KLPAAGLANGHTPAKEPETKPRAAG  487
             S+    ESS+ +     K    SSTS++  P+N +  +  + +      EP   P  + 
Sbjct  468  ISRPVETESSSLKHTTESKFKTTSSTSEEFEPLNGESNSISVKHSQNVVSEPSPVPSVSL  527

Query  486  IANGHNPAKEPESSKASPRRNTSVGNQSSS----------------STDMVDHTKATVTV  355
                H   + P S+   P   +SV   S++                 TD+  +TKATVTV
Sbjct  528  EGPAHLQLQPPPSA---PTDTSSVTESSNTSGSASSDSSASLQSSSETDVSHNTKATVTV  584

Query  354  VKNPSGNIMDGLMRRWDLSFFKNR  283
            V+NP+G++MDGLMRRWD +FFKN+
Sbjct  585  VRNPAGHVMDGLMRRWDFNFFKNK  608



>gb|KHN03427.1| Hypothetical protein glysoja_004453 [Glycine soja]
Length=612

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 98/204 (48%), Gaps = 52/204 (25%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV-------------------------------  661
            +LA FPS+ EEEERMFMEAV+ESLKDLEV                               
Sbjct  412  DLAGFPSTAEEEERMFMEAVMESLKDLEVRNPNAEQPTSSVSSVYVDAVEPSDKDASSGE  471

Query  660  -SKTPHVESSNGQPDPFPKNILDSSTSKQCVPMN-KLPAAGLANGHTPAKEPETKPRAAG  487
             S+    ESS+ +     K    SSTS++  P+N +  +  + +      EP   P  + 
Sbjct  472  ISRPVETESSSLKHTTESKFKTTSSTSEEFEPLNGESNSISVKHSQNVVSEPSPVPSVSL  531

Query  486  IANGHNPAKEPESSKASPRRNTSVGNQSSS----------------STDMVDHTKATVTV  355
                H   + P S+   P   +SV   S++                 TD+  +TKATVTV
Sbjct  532  EGPAHLQLQPPPSA---PTDTSSVTESSNTSGSASSDSSASLQSSSETDVSHNTKATVTV  588

Query  354  VKNPSGNIMDGLMRRWDLSFFKNR  283
            V+NP+G++MDGLMRRWD +FFKN+
Sbjct  589  VRNPAGHVMDGLMRRWDFNFFKNK  612



>ref|XP_009139529.1| PREDICTED: uncharacterized protein LOC103863543 isoform X2 [Brassica 
rapa]
Length=548

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 90/163 (55%), Gaps = 29/163 (18%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVPM  565
            LADFPS+ +EEERM MEAV++SLKD+EV         N +P            SK     
Sbjct  406  LADFPSNPDEEERMLMEAVMKSLKDVEVET-----HQNKEP------------SKTTDTE  448

Query  564  NKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKE--PESSKASPRRNTSVG--NQSSS  397
            N +   G A+  T   EPE+       A G  P+    P SS+A+   ++  G  N S  
Sbjct  449  NTVEKEGNASSTT---EPESAHPETFSAFGPTPSNHDAPLSSEANATSDSLPGPVNGSQD  505

Query  396  STDMVD---HTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
            + D++D    TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  506  TDDLIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  548



>ref|XP_009139528.1| PREDICTED: uncharacterized protein LOC103863543 isoform X1 [Brassica 
rapa]
Length=550

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 90/163 (55%), Gaps = 29/163 (18%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVPM  565
            LADFPS+ +EEERM MEAV++SLKD+EV         N +P            SK     
Sbjct  408  LADFPSNPDEEERMLMEAVMKSLKDVEVET-----HQNKEP------------SKTTDTE  450

Query  564  NKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKE--PESSKASPRRNTSVG--NQSSS  397
            N +   G A+  T   EPE+       A G  P+    P SS+A+   ++  G  N S  
Sbjct  451  NTVEKEGNASSTT---EPESAHPETFSAFGPTPSNHDAPLSSEANATSDSLPGPVNGSQD  507

Query  396  STDMVD---HTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
            + D++D    TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  508  TDDLIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  550



>ref|XP_006600322.1| PREDICTED: uncharacterized protein LOC100807823 isoform X2 [Glycine 
max]
Length=606

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 98/204 (48%), Gaps = 52/204 (25%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEV-------------------------------  661
            +LA FPS+ EEEERMFMEAV+ESLKDLEV                               
Sbjct  406  DLAGFPSTAEEEERMFMEAVMESLKDLEVRNPNAEQPTSSVSSVYVDAVEPSDKDASSGE  465

Query  660  -SKTPHVESSNGQPDPFPKNILDSSTSKQCVPMN-KLPAAGLANGHTPAKEPETKPRAAG  487
             S+    ESS+ +     K    SSTS++  P+N +  +  + +      EP   P  + 
Sbjct  466  ISRPVETESSSLKHTTESKFKTTSSTSEEFEPLNGESNSISVKHSQNVVSEPSPVPSVSL  525

Query  486  IANGHNPAKEPESSKASPRRNTSVGNQSSS----------------STDMVDHTKATVTV  355
                H   + P S+   P   +SV   S++                 TD+  +TKATVTV
Sbjct  526  EGPAHLQLQPPPSA---PTDTSSVTESSNTSGSASSDSSASLQSSSETDVSHNTKATVTV  582

Query  354  VKNPSGNIMDGLMRRWDLSFFKNR  283
            V+NP+G++MDGLMRRWD +FFKN+
Sbjct  583  VRNPAGHVMDGLMRRWDFNFFKNK  606



>ref|XP_009139530.1| PREDICTED: uncharacterized protein LOC103863543 isoform X3 [Brassica 
rapa]
Length=546

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 90/163 (55%), Gaps = 29/163 (18%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVPM  565
            LADFPS+ +EEERM MEAV++SLKD+EV         N +P            SK     
Sbjct  404  LADFPSNPDEEERMLMEAVMKSLKDVEVET-----HQNKEP------------SKTTDTE  446

Query  564  NKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKE--PESSKASPRRNTSVG--NQSSS  397
            N +   G A+  T   EPE+       A G  P+    P SS+A+   ++  G  N S  
Sbjct  447  NTVEKEGNASSTT---EPESAHPETFSAFGPTPSNHDAPLSSEANATSDSLPGPVNGSQD  503

Query  396  STDMVD---HTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
            + D++D    TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  504  TDDLIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  546



>ref|XP_010532690.1| PREDICTED: uncharacterized protein LOC104808656 isoform X1 [Tarenaya 
hassleriana]
Length=539

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 82/159 (52%), Gaps = 26/159 (16%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESS---NGQPDPFPKNILDSSTSKQ  577
            +L DFPS+ EEEERM MEAV+ESLKDLEV      ESS   +G+ D   +     S+S +
Sbjct  403  DLGDFPSNAEEEERMLMEAVMESLKDLEVQNHQKQESSGTDDGEKDNETEQEQGVSSSSE  462

Query  576  CVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSS  397
                +   ++  AN                       A E  +S + P       +  + 
Sbjct  463  TCSQDVTLSSSEANA----------------------ACETSASASLPEPVPPADSSLTD  500

Query  396  STDMVDHTKATVTVVK-NPSGNIMDGLMRRWDLSFFKNR  283
            STDM   TKATVTV + N   N++DGL+RRWDL+FFKNR
Sbjct  501  STDMSARTKATVTVERSNAPSNVLDGLIRRWDLNFFKNR  539



>ref|XP_010532691.1| PREDICTED: uncharacterized protein LOC104808656 isoform X2 [Tarenaya 
hassleriana]
Length=537

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 82/159 (52%), Gaps = 26/159 (16%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESS---NGQPDPFPKNILDSSTSKQ  577
            +L DFPS+ EEEERM MEAV+ESLKDLEV      ESS   +G+ D   +     S+S +
Sbjct  401  DLGDFPSNAEEEERMLMEAVMESLKDLEVQNHQKQESSGTDDGEKDNETEQEQGVSSSSE  460

Query  576  CVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSS  397
                +   ++  AN                       A E  +S + P       +  + 
Sbjct  461  TCSQDVTLSSSEANA----------------------ACETSASASLPEPVPPADSSLTD  498

Query  396  STDMVDHTKATVTVVK-NPSGNIMDGLMRRWDLSFFKNR  283
            STDM   TKATVTV + N   N++DGL+RRWDL+FFKNR
Sbjct  499  STDMSARTKATVTVERSNAPSNVLDGLIRRWDLNFFKNR  537



>ref|XP_006283452.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16350.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=558

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 92/171 (54%), Gaps = 33/171 (19%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEV----SKTP--------HVESSNGQPDPFPKNI  601
            LADFPS+ EEEERM MEAV++SLKD+EV    SK P          + +NG        +
Sbjct  404  LADFPSNAEEEERMLMEAVMKSLKDVEVETHQSKEPSWTNTENTEEKEANGTVSTTKPEL  463

Query  600  --LDSSTSKQCVPMNK-LPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPR  430
               ++ +S    P N   P++  AN   P +  ++ P   G  NG  P   P+ S     
Sbjct  464  AHFETDSSSGPTPSNHDTPSSSEANA--PCRTSDSLP---GPINGFVPGASPQMSL----  514

Query  429  RNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
                    ++ + D+  HTKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  515  -------DTNEAIDLSAHTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  558



>ref|XP_006283451.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16349.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=556

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 92/171 (54%), Gaps = 33/171 (19%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEV----SKTP--------HVESSNGQPDPFPKNI  601
            LADFPS+ EEEERM MEAV++SLKD+EV    SK P          + +NG        +
Sbjct  402  LADFPSNAEEEERMLMEAVMKSLKDVEVETHQSKEPSWTNTENTEEKEANGTVSTTKPEL  461

Query  600  --LDSSTSKQCVPMNK-LPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPR  430
               ++ +S    P N   P++  AN   P +  ++ P   G  NG  P   P+ S     
Sbjct  462  AHFETDSSSGPTPSNHDTPSSSEANA--PCRTSDSLP---GPINGFVPGASPQMSL----  512

Query  429  RNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
                    ++ + D+  HTKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  513  -------DTNEAIDLSAHTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  556



>ref|XP_009339931.1| PREDICTED: uncharacterized protein LOC103932104 [Pyrus x bretschneideri]
Length=589

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 91/188 (48%), Gaps = 43/188 (23%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESS--NGQPDPFP------------  610
            +LA FPS ++EEERMFMEAV+ SLKDLE+ + P  E       PD               
Sbjct  407  DLAGFPSDVDEEERMFMEAVILSLKDLEI-RGPQAEEQPPGDTPDSLKSSQKDDQRDDAS  465

Query  609  ----KNILDS-STSKQCVPMNKLPAAGLANG----HTPAKEPETKPRAAGIANGHNPAKE  457
                + +L++ STS        L     +      H    E +++ R         P+ E
Sbjct  466  PAEKRELLETESTSTSVGHFGSLKTESSSTSVSKSHDSRPEDQSRTRV--------PSTE  517

Query  456  P---------ESSKASP--RRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRR  310
            P         E+  A P  R + S   QSSS  D+   T ATVTVVKNP+ N+MDGL+RR
Sbjct  518  PALQTPLSIMENGSAGPSSRSDASESIQSSSDGDLSAKTTATVTVVKNPASNVMDGLIRR  577

Query  309  WDLSFFKN  286
            WD +FF+N
Sbjct  578  WDFNFFRN  585



>ref|XP_008223032.1| PREDICTED: uncharacterized protein LOC103322864 [Prunus mume]
Length=582

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 94/187 (50%), Gaps = 41/187 (22%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNIL--------DS  592
            +LA FPS ++EEERMFMEAV+ SLKDLE+    H ++    P   P + L        D+
Sbjct  400  DLAGFPSDVDEEERMFMEAVILSLKDLEMR---HPQAEEQPPGDTPGSKLSQKDDRLDDA  456

Query  591  STSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHN-----------PAKEPESS  445
            S ++Q   +     +     H  +K   T+     +   H+           P+ EP S 
Sbjct  457  SPAEQRELLETESISTSVGNHGSSK---TESTCTSVVEAHDSRPEDQTRTKVPSTEPASQ  513

Query  444  KASPRRNTSVGN--------------QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRW  307
              +P     +G+              QS+S +DM  +T ATVTVVKNP+ N+MDGL+RRW
Sbjct  514  --TPPSIMDLGSSGPSTQSDTPPASIQSTSDSDMSANTTATVTVVKNPASNVMDGLIRRW  571

Query  306  DLSFFKN  286
            D +FF+N
Sbjct  572  DFNFFRN  578



>ref|XP_007222369.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
 gb|EMJ23568.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
Length=576

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 94/184 (51%), Gaps = 35/184 (19%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPK-----NILDSSTS  583
            +LA FPS ++EEERMFMEAV+ SLKDLE+ + P  E       P  K     + LD ++ 
Sbjct  394  DLAGFPSDVDEEERMFMEAVILSLKDLEM-RHPQAEEQPPGDTPGSKLSQKDDRLDDASP  452

Query  582  KQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHN-----------PAKEPESSKAS  436
             +   + +  +   + GH  + +  T      +   H+           P+ EP S   +
Sbjct  453  AEQRELLETKSTSTSVGHHGSSK--TGSTCTSVVEAHDSRPEDQTLTKVPSTEPASQ--T  508

Query  435  PRRNTSVGN--------------QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLS  298
            P     +G+              QS+S +DM  +T ATVTVVKNP+ N+MDGL+RRWD +
Sbjct  509  PPSIMDLGSSGPSTQSDTPPASIQSTSDSDMSANTTATVTVVKNPASNVMDGLIRRWDFN  568

Query  297  FFKN  286
            FF+N
Sbjct  569  FFRN  572



>gb|KCW84318.1| hypothetical protein EUGRSUZ_B01162 [Eucalyptus grandis]
Length=394

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 92/182 (51%), Gaps = 36/182 (20%)
 Frame = -1

Query  735  FPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVP----  568
            FP ++EEEE+M MEAV+ SLKDLE+    H   ++  PD   ++   S    Q       
Sbjct  215  FPCTVEEEEKMLMEAVMMSLKDLEMR---HYSENDPVPDTSTESFGSSQKDGQATSSTTE  271

Query  567  ------MNKLPAAGLANGH-----------TPAKEPETK-PRAAGIANGHNPAKEP----  454
                   +  PA+ + NGH           TP+  P    P +A  ++ ++ +K P    
Sbjct  272  LSEASKTDSTPASEI-NGHIQMFDAFTDTNTPSSSPSCDNPPSATQSDTNSLSKSPLENA  330

Query  453  ESSKASPRRNTSVGN------QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFF  292
            + ++    + +SVG       QS   TDM  +T+AT+TVV+NPS NIMDG MRRWD   F
Sbjct  331  QRAEVGVEKASSVGTEGPTSIQSPLDTDMSGNTRATLTVVRNPSNNIMDGFMRRWDFGLF  390

Query  291  KN  286
            +N
Sbjct  391  RN  392



>gb|KDP40084.1| hypothetical protein JCGZ_02082 [Jatropha curcas]
Length=575

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 92/177 (52%), Gaps = 36/177 (20%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVP  568
            +L+ FP  +EEEERMFMEAV+ SLKDLE+      E +   P       + + TS++   
Sbjct  410  DLSGFPCDVEEEERMFMEAVIASLKDLEIRYPDAEEQTTISP-------ISTETSQK---  459

Query  567  MNKLPAAGLANGHTPAKEPETKPRAAGIANGHN-----PAKEPESSKASPRRNT------  421
               L A+     H P K   T    A   NG N     P+ +P +S  SP  +T      
Sbjct  460  -PNLSASDTIEQHEPPKADPTFFSPA--INGQNSSMEHPSPDPSASSTSPPFDTPQSMTE  516

Query  420  -----------SVGN-QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
                       + G+ Q+S+ TD+  +TKAT+TV +NP+ +IMDGLMRRWD + F+N
Sbjct  517  SGSSTTSTLSDASGSVQTSTDTDLSSNTKATLTVERNPANHIMDGLMRRWDFNLFRN  573



>ref|XP_010035885.1| PREDICTED: uncharacterized protein LOC104425011 isoform X2 [Eucalyptus 
grandis]
Length=588

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 92/182 (51%), Gaps = 36/182 (20%)
 Frame = -1

Query  735  FPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCV-----  571
            FP ++EEEE+M MEAV+ SLKDLE+    H   ++  PD   ++   S    Q       
Sbjct  409  FPCTVEEEEKMLMEAVMMSLKDLEMR---HYSENDPVPDTSTESFGSSQKDGQATSSTTE  465

Query  570  -----PMNKLPAAGLANGH-----------TPAKEPETK-PRAAGIANGHNPAKEP----  454
                   +  PA+ + NGH           TP+  P    P +A  ++ ++ +K P    
Sbjct  466  LSEASKTDSTPASEI-NGHIQMFDAFTDTNTPSSSPSCDNPPSATQSDTNSLSKSPLENA  524

Query  453  ESSKASPRRNTSVGN------QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFF  292
            + ++    + +SVG       QS   TDM  +T+AT+TVV+NPS NIMDG MRRWD   F
Sbjct  525  QRAEVGVEKASSVGTEGPTSIQSPLDTDMSGNTRATLTVVRNPSNNIMDGFMRRWDFGLF  584

Query  291  KN  286
            +N
Sbjct  585  RN  586



>ref|XP_008458538.1| PREDICTED: uncharacterized protein LOC103497914 isoform X2 [Cucumis 
melo]
Length=595

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  453  ESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
            ES+ A    +T   +Q+S+  D+  +TKATVTVV+NP+ +IMDGL+RRWDL+FF+N
Sbjct  536  ESAGAPSCTSTPANSQNSAEADLSANTKATVTVVRNPASHIMDGLIRRWDLNFFRN  591



>ref|XP_010035879.1| PREDICTED: uncharacterized protein LOC104425011 isoform X1 [Eucalyptus 
grandis]
 gb|KCW84317.1| hypothetical protein EUGRSUZ_B01162 [Eucalyptus grandis]
Length=590

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 92/182 (51%), Gaps = 36/182 (20%)
 Frame = -1

Query  735  FPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCV-----  571
            FP ++EEEE+M MEAV+ SLKDLE+    H   ++  PD   ++   S    Q       
Sbjct  411  FPCTVEEEEKMLMEAVMMSLKDLEMR---HYSENDPVPDTSTESFGSSQKDGQATSSTTE  467

Query  570  -----PMNKLPAAGLANGH-----------TPAKEPETK-PRAAGIANGHNPAKEP----  454
                   +  PA+ + NGH           TP+  P    P +A  ++ ++ +K P    
Sbjct  468  LSEASKTDSTPASEI-NGHIQMFDAFTDTNTPSSSPSCDNPPSATQSDTNSLSKSPLENA  526

Query  453  ESSKASPRRNTSVGN------QSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFF  292
            + ++    + +SVG       QS   TDM  +T+AT+TVV+NPS NIMDG MRRWD   F
Sbjct  527  QRAEVGVEKASSVGTEGPTSIQSPLDTDMSGNTRATLTVVRNPSNNIMDGFMRRWDFGLF  586

Query  291  KN  286
            +N
Sbjct  587  RN  588



>ref|XP_009365782.1| PREDICTED: uncharacterized protein LOC103955607 [Pyrus x bretschneideri]
Length=588

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 94/181 (52%), Gaps = 30/181 (17%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNIL------DSST  586
            +L  FPS ++EEERMFMEAV+ SLKDLE+ +    E       P   N+L      D ++
Sbjct  407  DLEGFPSDVDEEERMFMEAVMLSLKDLEM-RGSQAEEQPPLDTPDSLNLLQKDDQPDDAS  465

Query  585  SKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHN-----------PAKEPES---  448
            + +   + +  +   + GH  + + E+   +  ++  H+           P  EP S   
Sbjct  466  TAEKRELLETESISTSVGHLGSSKTESI--STSVSKSHDSRPEDQTPTRVPTAEPASQTP  523

Query  447  -------SKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
                   +  S + +TS   Q +S +D+   T ATVTVVKNP+ N+MDGL+RRWD +FF+
Sbjct  524  LSIMDGSAGPSSQSDTSESIQRTSDSDLSAKTTATVTVVKNPASNVMDGLIRRWDFNFFR  583

Query  288  N  286
            N
Sbjct  584  N  584



>ref|XP_008458537.1| PREDICTED: uncharacterized protein LOC103497914 isoform X1 [Cucumis 
melo]
Length=597

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  453  ESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
            ES+ A    +T   +Q+S+  D+  +TKATVTVV+NP+ +IMDGL+RRWDL+FF+N
Sbjct  538  ESAGAPSCTSTPANSQNSAEADLSANTKATVTVVRNPASHIMDGLIRRWDLNFFRN  593



>ref|XP_010450069.1| PREDICTED: uncharacterized protein LOC104732228 [Camelina sativa]
Length=556

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 89/168 (53%), Gaps = 30/168 (18%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEV----------SKTPHVESSNGQPDPFPK--NI  601
            LADFPS+ EEEERM MEA+++SLKD+EV          + T + E         P+  + 
Sbjct  405  LADFPSNAEEEERMLMEAMMKSLKDVEVETHKNQGPAMTNTENTEEKEATATAKPELAHF  464

Query  600  LDSSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNT  421
               STS      +  P++  AN   P +  ++ P   G  NG  P   P+ S+       
Sbjct  465  ETDSTSGSTPSNHDAPSSSEANA--PCRTSDSLP---GPVNGFVPGASPKMSQ-------  512

Query  420  SVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
                 ++ + D+   TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  513  ----NTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  556



>ref|XP_006414745.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
 gb|ESQ56198.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
Length=550

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 89/162 (55%), Gaps = 24/162 (15%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQC---  574
            LADFPS+ EEEERM MEAV++SLKD++V    + E S    +   +   +S+ S+     
Sbjct  405  LADFPSNAEEEERMLMEAVMKSLKDVKVEAHQNNEPSKTNTENTEEKEPESAHSETVSAS  464

Query  573  --VPMNK-LPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQS  403
               P N   P++  ANG  P K   T    +G  NG  P   P  S+            +
Sbjct  465  GPTPSNHDAPSSSEANG--PCK---TSDSLSGPVNGLVPGSSPRMSQ-----------NT  508

Query  402  SSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
            S + D+   TKATVTVV   + SGN+++GL+RRWDL+FFK+R
Sbjct  509  SDAIDLSARTKATVTVVARSSTSGNVLEGLLRRWDLNFFKSR  550



>ref|NP_193165.7| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
 gb|AEE83410.1| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
Length=558

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 94/172 (55%), Gaps = 37/172 (22%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKT--------PHVESSNG-------QPDPFP  610
            LADFPS+ EEEERM MEAV++SLKD+EV +T         + E+S G       +P+   
Sbjct  406  LADFPSNAEEEERMLMEAVMKSLKDMEVEQTHQKKEPSRTNTETSEGNAAASTTEPE---  462

Query  609  KNILDSSTSKQCVPMNKLPAAGLAN-GHTPAKEPETKPRAAGIANGHNPAKEPESSKASP  433
              + D+ ++    P N    A L++    P+K  ++ P   G  NG  P   P   K S 
Sbjct  463  LALSDTDSASGPTPCNH--DARLSSVASVPSKTSDSLP---GPVNGFVPGASP---KTSQ  514

Query  432  RRNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
             +N  +        D+   TKATVTVV   + SGN+++GL+RRWDL+FFK+R
Sbjct  515  NKNDVI--------DLSARTKATVTVVGRSSTSGNVLEGLLRRWDLNFFKSR  558



>ref|XP_007154171.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26165.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=611

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  393  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
            TD+  +TKATVTVV+NP+G+ MDGLMRRWD +FFKN+
Sbjct  575  TDISHNTKATVTVVRNPAGHAMDGLMRRWDFNFFKNK  611



>ref|XP_007154170.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26164.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=610

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  393  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
            TD+  +TKATVTVV+NP+G+ MDGLMRRWD +FFKN+
Sbjct  574  TDISHNTKATVTVVRNPAGHAMDGLMRRWDFNFFKNK  610



>ref|XP_010488424.1| PREDICTED: uncharacterized protein LOC104766269 isoform X1 [Camelina 
sativa]
 ref|XP_010488425.1| PREDICTED: uncharacterized protein LOC104766269 isoform X2 [Camelina 
sativa]
Length=561

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 86/165 (52%), Gaps = 18/165 (11%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSS---TSKQ  577
             + DFPS+ EEEERM M+AV+ESLKDLEV        S  + DP    +   S   T+ Q
Sbjct  402  QMEDFPSNAEEEERMLMKAVMESLKDLEVQ-------SQQKKDPPETRVHGGSAFLTAAQ  454

Query  576  CVPMNKLPAAGLANGHTP--AKEPETKPRAAGIANGH-NPAKEPESSKASPRRNTSVGNQ  406
             +P  +   +  AN      A  P T+ +    ++   NP  E  +S A P      G+ 
Sbjct  455  GLPSREESTSTRANQSETDSASSPATRSQDQLPSSCEPNPLSETSTSLARPINAFGPGSL  514

Query  405  SSSST---DMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  286
            S   T   DM   TKATVTV ++ S  G + DGL+RRWDL+FFKN
Sbjct  515  SQKETETGDMSGVTKATVTVERSSSAPGKVFDGLIRRWDLNFFKN  559



>ref|XP_010440497.1| PREDICTED: uncharacterized protein LOC104723788 [Camelina sativa]
Length=559

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 90/171 (53%), Gaps = 33/171 (19%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEV----------SKTPHVESSNGQP-----DPFP  610
            LADFPS+ EEEERM MEA+++SLKD+EV          + T + E   G        P  
Sbjct  405  LADFPSNAEEEERMLMEAMMKSLKDVEVETNQNKEPYRTNTENTEEKEGNATASTTKPEL  464

Query  609  KNILDSSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPR  430
             +    +TS      +  P++  AN   P +  ++ P   G  NG  P        ASP+
Sbjct  465  AHFEIDTTSGPAPSNHDAPSSSEANA--PCRTSDSLP---GPVNGFVPG-------ASPK  512

Query  429  RNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
                +   ++ + D+   TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  513  ----ISQNTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  559



>ref|XP_010435157.1| PREDICTED: uncharacterized protein LOC104719022 isoform X1 [Camelina 
sativa]
Length=559

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 89/171 (52%), Gaps = 33/171 (19%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEV----------SKTPHVESSNGQP-----DPFP  610
            LADFPS+ EEEERM MEA+++SLKD+EV          + T + E   G        P  
Sbjct  405  LADFPSNAEEEERMLMEAMMKSLKDVEVETNQNKEPYRTNTENTEEKEGNATASTTKPEL  464

Query  609  KNILDSSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPR  430
             +    +TS      +  P++  AN   P +  ++ P   G  NG  P   P+ S+    
Sbjct  465  AHFEIDTTSGPAPSNHDAPSSSEANA--PCRTSDSLP---GPVNGFVPGASPKMSQ----  515

Query  429  RNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
                    ++ + D+   TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  516  -------NTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  559



>ref|XP_010435158.1| PREDICTED: uncharacterized protein LOC104719022 isoform X2 [Camelina 
sativa]
Length=557

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 89/171 (52%), Gaps = 33/171 (19%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEV----------SKTPHVESSNGQP-----DPFP  610
            LADFPS+ EEEERM MEA+++SLKD+EV          + T + E   G        P  
Sbjct  403  LADFPSNAEEEERMLMEAMMKSLKDVEVETNQNKEPYRTNTENTEEKEGNATASTTKPEL  462

Query  609  KNILDSSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPR  430
             +    +TS      +  P++  AN   P +  ++ P   G  NG  P   P+ S+    
Sbjct  463  AHFEIDTTSGPAPSNHDAPSSSEANA--PCRTSDSLP---GPVNGFVPGASPKMSQ----  513

Query  429  RNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
                    ++ + D+   TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  514  -------NTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  557



>ref|XP_007147794.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19788.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=591

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  393  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
            TD+  +TKATVTV+KNP+G++++GLMRRWD +FF+NR
Sbjct  552  TDISHNTKATVTVIKNPTGHVLNGLMRRWDFNFFRNR  588



>ref|XP_007147795.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19789.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=590

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -1

Query  393  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKNR  283
            TD+  +TKATVTV+KNP+G++++GLMRRWD +FF+NR
Sbjct  551  TDISHNTKATVTVIKNPTGHVLNGLMRRWDFNFFRNR  587



>ref|XP_008797057.1| PREDICTED: uncharacterized protein LOC103712341 [Phoenix dactylifera]
Length=591

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 84/180 (47%), Gaps = 28/180 (16%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVPM  565
            L+D P SME+E+RMFMEA++ESLKDLE+ +   + S+ G       + +D  T+    P+
Sbjct  409  LSDIPCSMEDEKRMFMEAIIESLKDLEMRQPQDLPSNLGTATSVSLDAMDPVTADSNAPL  468

Query  564  NKLPAAGLANGHTPAKEPETKPRAAGIANGHNP--------------------AKEPESS  445
              +  + L +     K        A  A G +                     A EP S+
Sbjct  469  ETVGTSMLESNEDATKACTAGSNGASEAVGSSTPSSTNLDSTVDPALSSQGSHAMEPTSA  528

Query  444  KASPRRNTSVGNQSSSS--------TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
            K S   +T  G   +S+         DM   T+AT+ V KNP+ +IMDGL  RW L FF+
Sbjct  529  KNSSSSDTVSGTACTSADGSSSIQDADMAAGTRATLIVQKNPASHIMDGLAHRWGLKFFR  588



>ref|XP_010488423.1| PREDICTED: uncharacterized protein LOC104766268 [Camelina sativa]
Length=146

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 72/147 (49%), Gaps = 18/147 (12%)
 Frame = -1

Query  693  AVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSS---TSKQCVPMNKLPAAGLANGHTP  523
            AV+ESLKDLEV        S  + DP    +   S   T+ Q +P  +   +  AN    
Sbjct  5    AVMESLKDLEVQ-------SQQKKDPPETRVHGGSAFLTAAQGLPSREESTSTRANQSET  57

Query  522  --AKEPETKPRAAGIANGH-NPAKEPESSKASPRRNTSVGNQSSSST---DMVDHTKATV  361
              A  P T+ +    ++   NP  E  +S A P      G+ S   T   DM   TKATV
Sbjct  58   DSASSPATRSQDQLPSSCEPNPLSETSTSLARPINAFGPGSLSQKETETGDMSGVTKATV  117

Query  360  TVVKNPS--GNIMDGLMRRWDLSFFKN  286
            TV ++ S  G + DGL+RRWDL+FFKN
Sbjct  118  TVERSSSAPGKVFDGLIRRWDLNFFKN  144



>gb|ABK94721.1| unknown [Populus trichocarpa]
Length=59

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = -1

Query  459  EPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
            E ES  AS   +TS     S  TD+  +TKAT+TV +NP+ +IMDGL+RRWDL  F+N
Sbjct  2    ESESITASSSNDTSGSIHGSIDTDLSGNTKATLTVERNPANHIMDGLLRRWDL--FRN  57



>ref|NP_001030748.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE76775.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=423

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 87/164 (53%), Gaps = 17/164 (10%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSST---SKQ  577
            ++ADFPS+ EEEERM M+AV+ESLKDLEV        S  + +P    I   S    + Q
Sbjct  265  DMADFPSNAEEEERMLMKAVMESLKDLEVQ-------SQQKKEPPETRIHGGSAFLNAVQ  317

Query  576  CVPMNKLPAAGLANGHTP--AKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSV---G  412
            C+   +   +  AN      A  P T+ +    ++  +      SS  +    +SV    
Sbjct  318  CISSREESTSTRANQSETDSASSPVTRSQDQLPSSSESNPPSETSSSLARTVTSSVPGSL  377

Query  411  NQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  286
            +Q  S T  V  TKATVTV ++ S  G ++DGL+RRWDL+FFKN
Sbjct  378  SQKESETGDVPGTKATVTVERSSSAPGKVLDGLIRRWDLNFFKN  421



>ref|XP_006299834.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
 gb|EOA32732.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
Length=564

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 89/172 (52%), Gaps = 32/172 (19%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTS----K  580
            ++ DFPS+ +EEERM M+AV+ESLKDLEV           Q +  P+  +   ++     
Sbjct  405  DMGDFPSNAQEEERMLMKAVMESLKDLEVQSQ--------QKEEAPETRIHGGSAFLKAT  456

Query  579  QCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNP---------AKEPESSKASPRR  427
            QC+   +   +      T A +PET   ++      +            E  +S+A P +
Sbjct  457  QCLSSREESTS------TRANQPETDSASSPATCSQDQLPSSSESNPPSETSTSQARPIK  510

Query  426  NT---SVGNQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  286
             +   S+  + S + DM   TKATVTV ++ S  G ++DGL+RRWDL+FFKN
Sbjct  511  ASDPGSLSQKESETRDMSGVTKATVTVERSSSAPGKVLDGLIRRWDLNFFKN  562



>dbj|BAB02772.1| unnamed protein product [Arabidopsis thaliana]
Length=599

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 87/164 (53%), Gaps = 17/164 (10%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSST---SKQ  577
            ++ADFPS+ EEEERM M+AV+ESLKDLEV        S  + +P    I   S    + Q
Sbjct  441  DMADFPSNAEEEERMLMKAVMESLKDLEVQ-------SQQKKEPPETRIHGGSAFLNAVQ  493

Query  576  CVPMNKLPAAGLANGHTP--AKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSV---G  412
            C+   +   +  AN      A  P T+ +    ++  +      SS  +    +SV    
Sbjct  494  CISSREESTSTRANQSETDSASSPVTRSQDQLPSSSESNPPSETSSSLARTVTSSVPGSL  553

Query  411  NQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  286
            +Q  S T  V  TKATVTV ++ S  G ++DGL+RRWDL+FFKN
Sbjct  554  SQKESETGDVPGTKATVTVERSSSAPGKVLDGLIRRWDLNFFKN  597



>ref|NP_188996.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAT06481.1| At3g23540 [Arabidopsis thaliana]
 gb|AEE76774.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=566

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 87/164 (53%), Gaps = 17/164 (10%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSST---SKQ  577
            ++ADFPS+ EEEERM M+AV+ESLKDLEV        S  + +P    I   S    + Q
Sbjct  408  DMADFPSNAEEEERMLMKAVMESLKDLEVQ-------SQQKKEPPETRIHGGSAFLNAVQ  460

Query  576  CVPMNKLPAAGLANGHTP--AKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSV---G  412
            C+   +   +  AN      A  P T+ +    ++  +      SS  +    +SV    
Sbjct  461  CISSREESTSTRANQSETDSASSPVTRSQDQLPSSSESNPPSETSSSLARTVTSSVPGSL  520

Query  411  NQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  286
            +Q  S T  V  TKATVTV ++ S  G ++DGL+RRWDL+FFKN
Sbjct  521  SQKESETGDVPGTKATVTVERSSSAPGKVLDGLIRRWDLNFFKN  564



>ref|XP_002311822.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
 gb|EEE89189.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
Length=591

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 80/163 (49%), Gaps = 31/163 (19%)
 Frame = -1

Query  693  AVLESLKDLEVSKTPHVE-------------SSNGQPDPF-------PKNILDSSTS-KQ  577
            AV+ESLKDLE+ + P+ E             S     D +       P   L + TS KQ
Sbjct  431  AVIESLKDLEL-RHPNAEEQLASVSPASVKSSQKDNQDAYSIGELGNPLKTLPTPTSVKQ  489

Query  576  CVPMNKLPAAGLANGH----TPAKEPETKPRAAGIANGHNPAK--EPESSKASPRRNTSV  415
             VP+    A+  A  H    T    P+T   +  +    NP+   E ES  AS   +TS 
Sbjct  490  HVPLKTESASSSAVNHQNLATLDPSPDTSASSV-VTPFDNPSSIMESESITASSSNDTSG  548

Query  414  GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
                S  TD+  +TKAT+TV +NP+ +IMDGL+RRWDL  F+N
Sbjct  549  SIHGSIDTDLSGNTKATLTVERNPANHIMDGLLRRWDL--FRN  589



>ref|XP_010669834.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010669835.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
Length=556

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 77/159 (48%), Gaps = 16/159 (10%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVPM  565
            +A+FP   +EEERM MEA++ESLKDL+           G P   P +  D++  +     
Sbjct  406  MAEFPRDSQEEERMVMEAIVESLKDLD----------TGNPPEEPPSCTDTNVVESNQRG  455

Query  564  NKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQS------  403
            +K        G  P+K     P      +  +  +  + S       T + N +      
Sbjct  456  HKPNTLTDKEGCGPSKAGSFLPSTNSDTDCSSSERRLDKSSRVSCGETDLSNDTPGQAVE  515

Query  402  SSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
            SS T+  D TKAT+TVVKN SG+IMDG  RRWD  FFK+
Sbjct  516  SSGTESSDGTKATLTVVKNSSGHIMDGFFRRWDRGFFKS  554



>ref|XP_002883434.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59693.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 87/171 (51%), Gaps = 30/171 (18%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSS---TSKQ  577
            ++ADFPS+ EEEERM M+AV+ESLKDLEV        S  + +P    +  SS   T+ Q
Sbjct  406  DMADFPSNAEEEERMLMKAVMESLKDLEVQ-------SQQKKEPPETRVHGSSAFLTAAQ  458

Query  576  CVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVG-----  412
            C+   +       +  T A + E+   ++ +    +       S      +TS+      
Sbjct  459  CLSSRE------ESTSTRANQSESDSASSPVTGSQDQLPSSSESNPPSETSTSLARPITA  512

Query  411  -------NQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  286
                    + S + DM   TKATVTV ++ S  G ++DGL+R+WDL+FFKN
Sbjct  513  SIPGSLSQKESETGDMSGVTKATVTVERSSSAPGKVLDGLIRKWDLNFFKN  563



>ref|XP_002315536.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
 gb|EEF01707.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
Length=563

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 92/177 (52%), Gaps = 27/177 (15%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFP--------------  610
            +LA FP  +EEEERMFMEAV+ESLKDLE+ + P+ E   GQP                  
Sbjct  389  DLAGFPCDIEEEERMFMEAVIESLKDLEM-RHPNAE---GQPASVSPASVKYSQKDSGDA  444

Query  609  ------KNILDSSTSKQCVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGHNP---AKE  457
                   N L++ TS     M +  ++   N    A E      AA +    +       
Sbjct  445  SSIVEHGNPLNTPTSTSVKQMTESTSSLAVNDQNLATEGPPATSAASVGTTFDTPSSIMG  504

Query  456  PESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
             ES+  S R +TS    SS+ +D+  +TKAT+TV +NP+G+IMDGL+RRWD + F+N
Sbjct  505  SESTTTSSRSDTSGSVHSSTDSDLSGNTKATLTVERNPAGHIMDGLLRRWDFNLFRN  561



>ref|XP_011009031.1| PREDICTED: uncharacterized protein LOC105114237 isoform X2 [Populus 
euphratica]
Length=534

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 79/163 (48%), Gaps = 29/163 (18%)
 Frame = -1

Query  693  AVLESLKDLEVSKTPHVE-------------SSNGQPDPFPKNILDS--------STSKQ  577
            AV+ESLKDLE+ + P+ E             S     D +    L +        ++ KQ
Sbjct  372  AVIESLKDLEL-RHPNAEEQLTSFSPASVKSSQKDNQDAYSIGELGNPLKTRPPPTSVKQ  430

Query  576  CVPMNKLPAAGLANGH----TPAKEPETKPRAAGIANGHNP--AKEPESSKASPRRNTSV  415
             VP+    A+  A  H    T    P+T   +  +    NP    E +S  AS   + S 
Sbjct  431  RVPLKTESASSSAVNHQNLATLDPSPDTSASSV-VTPFDNPPSIMESKSITASSSNDASG  489

Query  414  GNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
              + S+ TD+  +TKAT+TV +NP+ +IMDGL+RRWD + F+N
Sbjct  490  SIRGSTDTDLSGNTKATLTVERNPANHIMDGLLRRWDFNLFRN  532



>ref|XP_011009032.1| PREDICTED: uncharacterized protein LOC105114237 isoform X3 [Populus 
euphratica]
Length=573

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 77/162 (48%), Gaps = 27/162 (17%)
 Frame = -1

Query  693  AVLESLKDLEVSKTPHVE-------------SSNGQPDPFPKNILDS--------STSKQ  577
            AV+ESLKDLE+ + P+ E             S     D +    L +        ++ KQ
Sbjct  411  AVIESLKDLEL-RHPNAEEQLTSFSPASVKSSQKDNQDAYSIGELGNPLKTRPPPTSVKQ  469

Query  576  CVPMNKLPAAGLANGHTPAKEPETKPRAAG---IANGHNP--AKEPESSKASPRRNTSVG  412
             VP+    A+  A  H      +  P  +    +    NP    E +S  AS   + S  
Sbjct  470  RVPLKTESASSSAVNHQNLATLDPSPDTSASSVVTPFDNPPSIMESKSITASSSNDASGS  529

Query  411  NQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
             + S+ TD+  +TKAT+TV +NP+ +IMDGL+RRWD + F+N
Sbjct  530  IRGSTDTDLSGNTKATLTVERNPANHIMDGLLRRWDFNLFRN  571



>ref|XP_011009029.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
 ref|XP_011009030.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
Length=588

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 77/162 (48%), Gaps = 27/162 (17%)
 Frame = -1

Query  693  AVLESLKDLEVSKTPHVE-------------SSNGQPDPFPKNILDS--------STSKQ  577
            AV+ESLKDLE+ + P+ E             S     D +    L +        ++ KQ
Sbjct  426  AVIESLKDLEL-RHPNAEEQLTSFSPASVKSSQKDNQDAYSIGELGNPLKTRPPPTSVKQ  484

Query  576  CVPMNKLPAAGLANGHTPAKEPETKPRAAG---IANGHNP--AKEPESSKASPRRNTSVG  412
             VP+    A+  A  H      +  P  +    +    NP    E +S  AS   + S  
Sbjct  485  RVPLKTESASSSAVNHQNLATLDPSPDTSASSVVTPFDNPPSIMESKSITASSSNDASGS  544

Query  411  NQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
             + S+ TD+  +TKAT+TV +NP+ +IMDGL+RRWD + F+N
Sbjct  545  IRGSTDTDLSGNTKATLTVERNPANHIMDGLLRRWDFNLFRN  586



>ref|XP_010440498.1| PREDICTED: uncharacterized protein LOC104723789 [Camelina sativa]
Length=140

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 13/71 (18%)
 Frame = -1

Query  489  GIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVV--KNPSGNIMDGLM  316
            G  NG  P   P+ S+            ++ + D+   TKATVTVV   + SGN++DGL+
Sbjct  81   GPVNGFVPGASPKMSQ-----------NTNDAIDLSSRTKATVTVVGRSSTSGNVLDGLL  129

Query  315  RRWDLSFFKNR  283
            RRWDL+FFK+R
Sbjct  130  RRWDLNFFKSR  140



>ref|XP_006597567.1| PREDICTED: uncharacterized protein LOC100781610 isoform X1 [Glycine 
max]
Length=582

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 99/189 (52%), Gaps = 36/189 (19%)
 Frame = -1

Query  747  NLADF---PSSmeeeermfmEAVLESLKDLEVSKTPHVE------SSNGQPDPFPKNILD  595
             L DF   PSS ++E++MFMEAV++SLKD E+ + P VE      +S    +P  ++   
Sbjct  391  QLDDFTGCPSSAKKEQKMFMEAVVDSLKDREI-RIPEVEQPPVSSASTMSIEPSDEDDSH  449

Query  594  SSTSKQCVPMNKLPA-----AGLANGHTPAKEP-ETKPRAAGIANGHN--------PAKE  457
            +S+ K   PM   P+         +  + A EP +T+P +  +             P  +
Sbjct  450  ASSHKISKPMETEPSLLNQSVKTISTASDALEPLKTEPNSISVIPSPVPSLSSSKIPLPQ  509

Query  456  P---ESSKASPRRNT---------SVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMR  313
            P   ++S  +   NT         S   QSSS TD+  +TKAT+TV+KNP+G++++ L+ 
Sbjct  510  PPPLDTSSVADSSNTESTTACNDNSASLQSSSDTDISHNTKATLTVIKNPAGHVLNCLLG  569

Query  312  RWDLSFFKN  286
            RWD +FF+N
Sbjct  570  RWDFNFFRN  578



>ref|XP_006597568.1| PREDICTED: uncharacterized protein LOC100781610 isoform X2 [Glycine 
max]
Length=580

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 99/189 (52%), Gaps = 36/189 (19%)
 Frame = -1

Query  747  NLADF---PSSmeeeermfmEAVLESLKDLEVSKTPHVE------SSNGQPDPFPKNILD  595
             L DF   PSS ++E++MFMEAV++SLKD E+ + P VE      +S    +P  ++   
Sbjct  389  QLDDFTGCPSSAKKEQKMFMEAVVDSLKDREI-RIPEVEQPPVSSASTMSIEPSDEDDSH  447

Query  594  SSTSKQCVPMNKLPA-----AGLANGHTPAKEP-ETKPRAAGIANGHN--------PAKE  457
            +S+ K   PM   P+         +  + A EP +T+P +  +             P  +
Sbjct  448  ASSHKISKPMETEPSLLNQSVKTISTASDALEPLKTEPNSISVIPSPVPSLSSSKIPLPQ  507

Query  456  P---ESSKASPRRNT---------SVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMR  313
            P   ++S  +   NT         S   QSSS TD+  +TKAT+TV+KNP+G++++ L+ 
Sbjct  508  PPPLDTSSVADSSNTESTTACNDNSASLQSSSDTDISHNTKATLTVIKNPAGHVLNCLLG  567

Query  312  RWDLSFFKN  286
            RWD +FF+N
Sbjct  568  RWDFNFFRN  576



>ref|XP_010512570.1| PREDICTED: uncharacterized protein LOC104788495 [Camelina sativa]
Length=561

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 87/165 (53%), Gaps = 18/165 (11%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVS---KTPHVESSNGQPDPFPKNILDSSTSKQ  577
             + DFPS+ EEEERM M+AV+ESLKDLEV    K  H E+       F        T+ Q
Sbjct  402  QMEDFPSNAEEEERMLMKAVMESLKDLEVQSQQKKDHPETRVHGGSAF-------LTAAQ  454

Query  576  CVPMNKLPAAGLANGHTP--AKEPETKPR-AAGIANGHNPAKEPESSKASPRRNTSVGNQ  406
             +P  +   +  AN      A  P T+ +     ++  NP  E  +S A P   +  G+ 
Sbjct  455  GLPSREESTSTRANQSETDSASSPATRSQDQLPSSSEPNPPSETSTSLARPINASGPGSL  514

Query  405  SSSST---DMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  286
            S   T   DM   TKATVTV ++ S  G ++DGL+RRWDL+FFKN
Sbjct  515  SQKETENSDMSGVTKATVTVERSSSAPGKVLDGLIRRWDLNFFKN  559



>ref|XP_010466700.1| PREDICTED: uncharacterized protein LOC104746856 [Camelina sativa]
Length=561

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 18/165 (11%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSS---TSKQ  577
             + DFPS+ EEEERM M+AV+ESLKDLEV        S  + DP    +   S   T+ Q
Sbjct  402  QMEDFPSNAEEEERMLMKAVMESLKDLEVQ-------SQQKKDPPETRVHGGSAFLTAAQ  454

Query  576  CVPMNKLPAAGLANGHTP--AKEPETKPR-AAGIANGHNPAKEPESSKASPRRNTSVGNQ  406
             +P  +   +  AN      A  P T+ +     ++  NP  E  +S A P   +  G+ 
Sbjct  455  GLPPREESTSTRANQSETDSASSPATRSQDQLPSSSEPNPPSETSTSLARPINASGPGSL  514

Query  405  SSSST---DMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  286
            S   T   DM   TKATVTV ++ S  G ++DGL+RRWDL+FFKN
Sbjct  515  SQKETETGDMSGVTKATVTVERSSSAPGKVLDGLIRRWDLNFFKN  559



>emb|CDY49406.1| BnaCnng17160D [Brassica napus]
Length=505

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = -1

Query  411  NQSSSSTDMVD---HTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
            N S  + D++D    TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  458  NGSQDTDDLIDLSSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  505



>emb|CDY12752.1| BnaC04g28890D [Brassica napus]
Length=506

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 71/156 (46%), Gaps = 58/156 (37%)
 Frame = -1

Query  744  LADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSSTSKQCVPM  565
            LADFPS+ +EEERM MEAV++SLKD+EV                             +  
Sbjct  407  LADFPSNPDEEERMLMEAVMKSLKDVEVE----------------------------IHQ  438

Query  564  NKLPAAGLANGHTPAKEPETKPRAAGIANGHNPAKEPESSKASPRRNTSVGNQSSSSTDM  385
            NK P+      +T  KE        G  NG                       +  + D+
Sbjct  439  NKEPSKTTDTENTVEKE--------GPVNG--------------------SQDTDDAIDL  470

Query  384  VDHTKATVTVV--KNPSGNIMDGLMRRWDLSFFKNR  283
               TKATVTVV   + SGN++DGL+RRWDL+FFK+R
Sbjct  471  SSRTKATVTVVGRSSTSGNVLDGLLRRWDLNFFKSR  506



>ref|XP_010105703.1| hypothetical protein L484_011315 [Morus notabilis]
 gb|EXC05734.1| hypothetical protein L484_011315 [Morus notabilis]
Length=569

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 87/187 (47%), Gaps = 39/187 (21%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSK-TPHVESSNGQPDPFPKNILDSSTSKQ--  577
            +L+ FPS ++EE+RMFMEAVL SLKDL      P  E       P      DSS S Q  
Sbjct  385  DLSGFPSDVDEEKRMFMEAVLLSLKDLNTRHPQPLAEEQPASTGP------DSSKSTQKD  438

Query  576  --------CVPMNKLPAAGLANGHTPAKEPETKPRAAGIANGH--------NPAKEPESS  445
                      P+  L     +     +   + +  +A +   H        + A++P + 
Sbjct  439  DNSEAALSTKPLEHLKTEATSTSVHQSGLLKEESTSASVTKTHVSEHKHQTHDARDPSTE  498

Query  444  KASPRRNTSVGNQSS--------------SSTDMVDHTKATVTVVKNPSGNIMDGLMRRW  307
             A     ++ G+ SS              S  D+  +TKAT+TV +NP+ NIMDGL+RRW
Sbjct  499  PALDVSMSAKGSGSSGPSHNATSSSTQSTSEADLSANTKATLTVERNPTSNIMDGLIRRW  558

Query  306  DLSFFKN  286
            D SFF+N
Sbjct  559  DFSFFRN  565



>ref|XP_011090819.1| PREDICTED: uncharacterized protein LOC105171411 isoform X4 [Sesamum 
indicum]
Length=600

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  468  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  540  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  598

Query  288  NR  283
            NR
Sbjct  599  NR  600



>ref|XP_011090820.1| PREDICTED: uncharacterized protein LOC105171411 isoform X5 [Sesamum 
indicum]
Length=599

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  468  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  539  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  597

Query  288  NR  283
            NR
Sbjct  598  NR  599



>ref|XP_011090818.1| PREDICTED: uncharacterized protein LOC105171411 isoform X3 [Sesamum 
indicum]
Length=614

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  468  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  554  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  612

Query  288  NR  283
            NR
Sbjct  613  NR  614



>ref|XP_011090817.1| PREDICTED: uncharacterized protein LOC105171411 isoform X2 [Sesamum 
indicum]
Length=614

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  468  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  554  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  612

Query  288  NR  283
            NR
Sbjct  613  NR  614



>ref|XP_011090816.1| PREDICTED: uncharacterized protein LOC105171411 isoform X1 [Sesamum 
indicum]
Length=615

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  468  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  555  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  613

Query  288  NR  283
            NR
Sbjct  614  NR  615



>ref|XP_011090822.1| PREDICTED: uncharacterized protein LOC105171411 isoform X7 [Sesamum 
indicum]
Length=561

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  468  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  501  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  559

Query  288  NR  283
            NR
Sbjct  560  NR  561



>emb|CDX77500.1| BnaA07g06380D [Brassica napus]
Length=566

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 86/167 (51%), Gaps = 21/167 (13%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDS---STSKQ  577
            +L D PS+ EEEERM M+AV+ESLKDLEV      ES         K +L S    T+++
Sbjct  406  HLEDIPSNAEEEERMLMKAVMESLKDLEVQSLEKKESPE-------KRVLGSNSFQTAQE  458

Query  576  CVPMNKLPAAGLANGHTPAKEPETKPRAAG--IANGHNPAKEP---ESSKASPRRNTSVG  412
             +   K   +  AN  +   +  + P   G  +A   + +K P     S  SP   +  G
Sbjct  459  PLLSRKESTSTQAN-QSETTDTASSPATVGGDVAPSSSESKAPNGTSDSLTSPVDASVPG  517

Query  411  ---NQSSSSTDMVDHTKATVTVVK--NPSGNIMDGLMRRWDLSFFKN  286
                +   + DM   TKATVTV +  + SG + DGL+R+WDL+FFKN
Sbjct  518  CTSQEERENGDMSADTKATVTVERTSSASGKVFDGLIRKWDLNFFKN  564



>ref|XP_011090821.1| PREDICTED: uncharacterized protein LOC105171411 isoform X6 [Sesamum 
indicum]
Length=588

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  468  PAKEPESSKASPRRNTSVGNQSSSSTDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFK  289
            P +E  S   S +  +S   + SS  DMVD T  TV V KN + N++DG +RRW+L FF+
Sbjct  528  PTQEETSRLTSHKDASSATPRPSSEVDMVDSTTVTVKVEKNTTSNVIDGWLRRWEL-FFR  586

Query  288  NR  283
            NR
Sbjct  587  NR  588



>emb|CDX85110.1| BnaC07g07960D [Brassica napus]
Length=566

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 86/167 (51%), Gaps = 21/167 (13%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDS---STSKQ  577
            +L D PS+ EEEERM M+AV+ESLKDLEV      ES         K +L S    T+++
Sbjct  406  HLEDIPSNAEEEERMLMKAVMESLKDLEVQSLEKKESPE-------KRVLGSNSFQTAQE  458

Query  576  CVPMNKLPAAGLANGHTPAKEPETKPRAAG--IANGHNPAKEPESSKASPRR--NTSV--  415
             +   K   +  AN  +   +  + P   G  +A   + +K P  +  S     + SV  
Sbjct  459  PLLSRKESTSTQAN-QSETTDSASSPATVGGDVAPSSSESKAPNGTSDSLTAPVDASVPG  517

Query  414  --GNQSSSSTDMVDHTKATVTVVKNPS--GNIMDGLMRRWDLSFFKN  286
                 +S + DM   TKATVTV +  S  G + DGL+R+WDL+FFKN
Sbjct  518  CTSQNASENGDMSADTKATVTVERTSSAPGKVFDGLIRKWDLNFFKN  564



>ref|XP_003594093.1| hypothetical protein MTR_2g021260 [Medicago truncatula]
Length=485

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  393  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
             D+   TKAT+TV +NP+G++M+GLMRRWD +F +N
Sbjct  393  IDISHKTKATLTVTRNPAGHVMNGLMRRWDFNFLRN  428



>ref|XP_006406019.1| hypothetical protein EUTSA_v10020399mg [Eutrema salsugineum]
 gb|ESQ47472.1| hypothetical protein EUTSA_v10020399mg [Eutrema salsugineum]
Length=566

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 96/172 (56%), Gaps = 28/172 (16%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDSS---TSKQ  577
            +L D PS+ EEEERM M+AV+ESLKDLEV        S  + +P  K +  S+   T +Q
Sbjct  403  HLEDIPSNAEEEERMLMKAVMESLKDLEVQ-------SLQEKEPSEKRVHGSNAFRTVQQ  455

Query  576  CVPMNKLPAAGLANGHTP--AKEPETKPR----AAGIANGHNPAKEPESSKASPRRNTSV  415
             +   +  ++  AN      A  P T  R    ++  +NG  P++ P +S A P +++  
Sbjct  456  SLLSREESSSTKANQSETDSASSPATLSRDLVPSSSESNG--PSETP-ASLARPVKDSVP  512

Query  414  G---NQSSSSTDMVDHTKATVTVVKNPS------GNIMDGLMRRWDLSFFKN  286
            G    ++S ++DM   TKATVTV ++ S      G ++DGL+R+WD +FFKN
Sbjct  513  GYSSQKASETSDMSSVTKATVTVERSSSSSSSAPGKVLDGLIRKWDFNFFKN  564



>gb|AES64344.2| alpha/beta hydrolase family protein [Medicago truncatula]
Length=535

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  393  TDMVDHTKATVTVVKNPSGNIMDGLMRRWDLSFFKN  286
             D+   TKAT+TV +NP+G++M+GLMRRWD +F +N
Sbjct  494  IDISHKTKATLTVTRNPAGHVMNGLMRRWDFNFLRN  529



>ref|XP_009102606.1| PREDICTED: uncharacterized protein LOC103828728 [Brassica rapa]
Length=566

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 21/167 (13%)
 Frame = -1

Query  747  NLADFPSSmeeeermfmEAVLESLKDLEVSKTPHVESSNGQPDPFPKNILDS---STSKQ  577
            +L D PS+ EEEERM M+AV+ESLKDLEV      ES         K +L S    T+++
Sbjct  406  HLEDIPSNAEEEERMLMKAVMESLKDLEVQSLEKKESPE-------KRVLGSNSFQTAQE  458

Query  576  CVPMNKLPAAGLANGHTPAKEPETKPRAAG--IANGHNPAKEP---ESSKASPRRNTSVG  412
             +   K   +  AN  +   +  + P   G  +A   + +K P     S  +P   +  G
Sbjct  459  PLLSRKESTSTQAN-QSETTDTASSPATVGGDVAPSSSESKAPNGTSDSLTAPVDASVPG  517

Query  411  NQSSSST---DMVDHTKATVTVVK--NPSGNIMDGLMRRWDLSFFKN  286
              S       D+   TKATVTV +  + SG + DGL+R+WDL+FFKN
Sbjct  518  CTSQKEKENGDVSADTKATVTVERTSSASGKVFDGLIRKWDLNFFKN  564



>gb|KHN37552.1| Hypothetical protein glysoja_007255 [Glycine soja]
Length=597

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 94/192 (49%), Gaps = 40/192 (21%)
 Frame = -1

Query  747  NLADF---PSSmeeeermfmEAVLESLKDLEVSKTPHVE-------SSNGQPDPFPKNIL  598
             L DF   PSS ++E++MF EAV++SLKD E+ + P VE       SS    +P  KN  
Sbjct  404  QLDDFTGCPSSAKKEQKMFTEAVIDSLKDREI-RIPEVEQPPVRSASSTMSIEPSDKNDS  462

Query  597  DSSTSKQCVPMNKLPAAGLANGH------TPAKEPETKPRAAGIANGHNPAKEPESSKAS  436
             +S S +     +  ++ L +        + A EP  K  +  I+   +P     SSK  
Sbjct  463  HASNSHEISKPVETESSLLNHSDKTISTSSDALEP-LKTESNSISVIPSPVTSLSSSKIP  521

Query  435  PRRN--------TSVGNQSSSST--------------DMVDHTKATVTVVKNPSGNIMDG  322
                        T  G+  S+ST              D+  +TKAT+TV+KNP+G++++G
Sbjct  522  SSPLPPLDTSSVTESGDTESASTGNDSSASLQSSSDTDISHNTKATLTVIKNPTGHVLNG  581

Query  321  LMRRWDLSFFKN  286
            L+RRWD  FF+N
Sbjct  582  LLRRWDFKFFRN  593



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630