BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020I08

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095628.1|  PREDICTED: KH domain-containing protein At5g...    244   4e-76   Sesamum indicum [beniseed]
ref|XP_009762106.1|  PREDICTED: KH domain-containing protein At5g...    242   2e-75   Nicotiana sylvestris
ref|XP_009762105.1|  PREDICTED: KH domain-containing protein At5g...    242   2e-75   Nicotiana sylvestris
gb|KJB63132.1|  hypothetical protein B456_009G454400                    236   3e-75   Gossypium raimondii
gb|KHN01498.1|  KH domain-containing protein                            240   3e-75   Glycine soja [wild soybean]
ref|XP_011000365.1|  PREDICTED: KH domain-containing protein At5g...    242   3e-75   Populus euphratica
ref|XP_006377999.1|  hypothetical protein POPTR_0011s17110g             241   5e-75   Populus trichocarpa [western balsam poplar]
gb|AGV54732.1|  KH domain-containing protein                            241   6e-75   Phaseolus vulgaris [French bean]
gb|ABK95423.1|  unknown                                                 237   7e-75   Populus trichocarpa [western balsam poplar]
gb|KDP36322.1|  hypothetical protein JCGZ_09537                         241   7e-75   Jatropha curcas
gb|KJB63133.1|  hypothetical protein B456_009G454400                    236   9e-75   Gossypium raimondii
ref|XP_007148648.1|  hypothetical protein PHAVU_005G003500g             240   9e-75   Phaseolus vulgaris [French bean]
ref|XP_011097700.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    240   1e-74   Sesamum indicum [beniseed]
ref|XP_009620233.1|  PREDICTED: KH domain-containing protein At5g...    240   1e-74   Nicotiana tomentosiformis
ref|XP_010244820.1|  PREDICTED: KH domain-containing protein At5g...    240   1e-74   Nelumbo nucifera [Indian lotus]
ref|XP_003522828.1|  PREDICTED: KH domain-containing protein At5g...    240   1e-74   Glycine max [soybeans]
ref|XP_009620232.1|  PREDICTED: KH domain-containing protein At5g...    240   2e-74   Nicotiana tomentosiformis
ref|XP_006452745.1|  hypothetical protein CICLE_v10009077mg             235   2e-74   
ref|XP_006452748.1|  hypothetical protein CICLE_v10009077mg             236   2e-74   
gb|KJB63136.1|  hypothetical protein B456_009G454400                    238   3e-74   Gossypium raimondii
gb|EYU27503.1|  hypothetical protein MIMGU_mgv1a011068mg                239   4e-74   Erythranthe guttata [common monkey flower]
ref|XP_008384622.1|  PREDICTED: KH domain-containing protein At5g...    239   4e-74   
ref|XP_006346087.1|  PREDICTED: KH domain-containing protein At5g...    238   4e-74   Solanum tuberosum [potatoes]
ref|XP_006452754.1|  hypothetical protein CICLE_v10009077mg             236   5e-74   
ref|XP_006474774.1|  PREDICTED: KH domain-containing protein At5g...    238   5e-74   Citrus sinensis [apfelsine]
ref|XP_003527575.1|  PREDICTED: KH domain-containing protein At5g...    238   5e-74   Glycine max [soybeans]
ref|XP_006346086.1|  PREDICTED: KH domain-containing protein At5g...    238   6e-74   Solanum tuberosum [potatoes]
ref|XP_002274648.1|  PREDICTED: KH domain-containing protein At5g...    238   7e-74   Vitis vinifera
ref|XP_010252937.1|  PREDICTED: KH domain-containing protein At5g...    238   8e-74   Nelumbo nucifera [Indian lotus]
gb|KJB63134.1|  hypothetical protein B456_009G454400                    238   1e-73   Gossypium raimondii
ref|XP_008813751.1|  PREDICTED: KH domain-containing protein At5g...    237   1e-73   
gb|KHG00195.1|  hypothetical protein F383_19595                         238   1e-73   Gossypium arboreum [tree cotton]
ref|XP_002532938.1|  nucleic acid binding protein, putative             238   2e-73   Ricinus communis
ref|XP_008813752.1|  PREDICTED: KH domain-containing protein At5g...    237   2e-73   Phoenix dactylifera
ref|XP_008813749.1|  PREDICTED: KH domain-containing protein At5g...    237   2e-73   
gb|KDO73992.1|  hypothetical protein CISIN_1g022785mg                   237   2e-73   Citrus sinensis [apfelsine]
ref|XP_008813750.1|  PREDICTED: KH domain-containing protein At5g...    237   2e-73   Phoenix dactylifera
ref|XP_006452747.1|  hypothetical protein CICLE_v10009077mg             237   2e-73   Citrus clementina [clementine]
ref|XP_006452752.1|  hypothetical protein CICLE_v10009077mg             236   2e-73   
ref|XP_008447796.1|  PREDICTED: KH domain-containing protein At5g...    235   2e-73   
ref|XP_004953739.1|  PREDICTED: KH domain-containing protein At5g...    236   3e-73   Setaria italica
ref|XP_006452751.1|  hypothetical protein CICLE_v10009077mg             236   3e-73   
ref|XP_002454368.1|  hypothetical protein SORBIDRAFT_04g029520          236   4e-73   Sorghum bicolor [broomcorn]
ref|XP_007205649.1|  hypothetical protein PRUPE_ppa009341mg             236   4e-73   Prunus persica
ref|XP_004139764.1|  PREDICTED: KH domain-containing protein At5g...    236   5e-73   Cucumis sativus [cucumbers]
ref|XP_008219129.1|  PREDICTED: KH domain-containing protein At5g...    236   5e-73   Prunus mume [ume]
ref|XP_008219133.1|  PREDICTED: KH domain-containing protein At5g...    236   6e-73   Prunus mume [ume]
ref|XP_006647814.1|  PREDICTED: KH domain-containing protein At5g...    235   7e-73   Oryza brachyantha
gb|KJB45527.1|  hypothetical protein B456_007G310100                    236   7e-73   Gossypium raimondii
gb|KJB45526.1|  hypothetical protein B456_007G310100                    235   8e-73   Gossypium raimondii
ref|XP_009379123.1|  PREDICTED: KH domain-containing protein At5g...    236   9e-73   Pyrus x bretschneideri [bai li]
gb|ACG35732.1|  nucleic acid binding protein                            235   1e-72   Zea mays [maize]
ref|XP_008447797.1|  PREDICTED: KH domain-containing protein At5g...    235   1e-72   Cucumis melo [Oriental melon]
ref|XP_010092393.1|  KH domain-containing protein                       236   1e-72   Morus notabilis
ref|XP_008353854.1|  PREDICTED: KH domain-containing protein At5g...    235   1e-72   Malus domestica [apple tree]
ref|NP_001141163.1|  uncharacterized protein LOC100273249               235   1e-72   Zea mays [maize]
dbj|BAK03295.1|  predicted protein                                      233   1e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010324228.1|  PREDICTED: KH domain-containing protein At5g...    235   1e-72   Solanum lycopersicum
ref|XP_004244006.1|  PREDICTED: KH domain-containing protein At5g...    235   1e-72   Solanum lycopersicum
ref|XP_011095627.1|  PREDICTED: KH domain-containing protein At5g...    235   1e-72   Sesamum indicum [beniseed]
ref|XP_004244007.1|  PREDICTED: KH domain-containing protein At5g...    235   1e-72   Solanum lycopersicum
ref|XP_010324227.1|  PREDICTED: KH domain-containing protein At5g...    235   2e-72   Solanum lycopersicum
ref|XP_010676133.1|  PREDICTED: KH domain-containing protein At5g...    234   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676134.1|  PREDICTED: KH domain-containing protein At5g...    234   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002299073.2|  KH domain-containing family protein                235   2e-72   Populus trichocarpa [western balsam poplar]
gb|ACN25994.1|  unknown                                                 229   2e-72   Zea mays [maize]
ref|XP_011039862.1|  PREDICTED: KH domain-containing protein At5g...    234   2e-72   Populus euphratica
emb|CDP13650.1|  unnamed protein product                                234   3e-72   Coffea canephora [robusta coffee]
ref|XP_009346681.1|  PREDICTED: KH domain-containing protein At5g...    234   3e-72   Pyrus x bretschneideri [bai li]
dbj|BAJ88160.1|  predicted protein                                      233   4e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006857601.1|  hypothetical protein AMTR_s00061p00100880          233   5e-72   Amborella trichopoda
ref|XP_003570477.1|  PREDICTED: KH domain-containing protein At5g...    232   1e-71   Brachypodium distachyon [annual false brome]
ref|XP_010539129.1|  PREDICTED: KH domain-containing protein At4g...    230   2e-71   
gb|ACN35020.1|  unknown                                                 231   2e-71   Zea mays [maize]
ref|XP_008805544.1|  PREDICTED: KH domain-containing protein At5g...    231   3e-71   Phoenix dactylifera
ref|XP_004294880.1|  PREDICTED: KH domain-containing protein At5g...    231   3e-71   Fragaria vesca subsp. vesca
ref|XP_008805547.1|  PREDICTED: KH domain-containing protein At5g...    231   4e-71   Phoenix dactylifera
ref|XP_008805546.1|  PREDICTED: KH domain-containing protein At5g...    231   4e-71   
ref|XP_008805545.1|  PREDICTED: KH domain-containing protein At5g...    231   5e-71   Phoenix dactylifera
gb|EAZ24441.1|  hypothetical protein OsJ_08192                          230   5e-71   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87341.1|  hypothetical protein OsI_08744                          231   5e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_008805542.1|  PREDICTED: KH domain-containing protein At5g...    231   5e-71   Phoenix dactylifera
ref|XP_008805543.1|  PREDICTED: KH domain-containing protein At5g...    231   6e-71   
ref|XP_003598316.1|  KH domain-containing protein                       227   6e-71   
ref|XP_010063216.1|  PREDICTED: KH domain-containing protein At5g...    228   2e-70   Eucalyptus grandis [rose gum]
ref|XP_010063215.1|  PREDICTED: KH domain-containing protein At5g...    229   3e-70   Eucalyptus grandis [rose gum]
ref|XP_009415554.1|  PREDICTED: KH domain-containing protein At5g...    228   4e-70   
ref|XP_003598315.1|  KH domain-containing protein                       228   5e-70   Medicago truncatula
ref|XP_004499705.1|  PREDICTED: KH domain-containing protein At5g...    228   5e-70   Cicer arietinum [garbanzo]
dbj|BAD13019.1|  putative KH domain protein                             230   5e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009415555.1|  PREDICTED: KH domain-containing protein At5g...    228   6e-70   
ref|XP_009415553.1|  PREDICTED: KH domain-containing protein At5g...    228   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415552.1|  PREDICTED: KH domain-containing protein At5g...    228   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928018.1|  PREDICTED: KH domain-containing protein At5g...    227   1e-69   Elaeis guineensis
ref|XP_010928019.1|  PREDICTED: KH domain-containing protein At5g...    227   1e-69   Elaeis guineensis
ref|XP_010928017.1|  PREDICTED: KH domain-containing protein At5g...    227   2e-69   Elaeis guineensis
ref|XP_010928016.1|  PREDICTED: KH domain-containing protein At5g...    227   2e-69   Elaeis guineensis
ref|XP_010539351.1|  PREDICTED: KH domain-containing protein At5g...    227   3e-69   
ref|XP_010545297.1|  PREDICTED: KH domain-containing protein At4g...    226   6e-69   Tarenaya hassleriana [spider flower]
ref|XP_010913288.1|  PREDICTED: KH domain-containing protein At5g...    225   7e-69   Elaeis guineensis
ref|XP_010913285.1|  PREDICTED: KH domain-containing protein At5g...    225   8e-69   
ref|XP_010913287.1|  PREDICTED: KH domain-containing protein At5g...    225   8e-69   
ref|XP_009407925.1|  PREDICTED: KH domain-containing protein At5g...    225   9e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913286.1|  PREDICTED: KH domain-containing protein At5g...    225   1e-68   Elaeis guineensis
ref|XP_010913282.1|  PREDICTED: KH domain-containing protein At5g...    225   1e-68   
ref|XP_010913284.1|  PREDICTED: KH domain-containing protein At5g...    225   1e-68   Elaeis guineensis
ref|XP_010438749.1|  PREDICTED: KH domain-containing protein At4g...    225   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006284180.1|  hypothetical protein CARUB_v10005327mg             225   2e-68   Capsella rubella
ref|XP_010448266.1|  PREDICTED: KH domain-containing protein At4g...    225   2e-68   Camelina sativa [gold-of-pleasure]
gb|KFK29165.1|  hypothetical protein AALP_AA7G098000                    225   2e-68   Arabis alpina [alpine rockcress]
ref|NP_194378.2|  RNA-binding KH domain-containing protein              224   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413178.1|  hypothetical protein EUTSA_v10025796mg             224   5e-68   Eutrema salsugineum [saltwater cress]
ref|XP_009399829.1|  PREDICTED: KH domain-containing protein At5g...    222   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010433498.1|  PREDICTED: KH domain-containing protein At4g...    223   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009395891.1|  PREDICTED: KH domain-containing protein At5g...    222   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782987.1|  PREDICTED: KH domain-containing protein At5g...    222   1e-67   Phoenix dactylifera
ref|XP_009399821.1|  PREDICTED: KH domain-containing protein At5g...    222   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006401374.1|  hypothetical protein EUTSA_v10014150mg             222   2e-67   Eutrema salsugineum [saltwater cress]
gb|AAM14070.1|  unknown protein                                         222   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004973255.1|  PREDICTED: KH domain-containing protein At4g...    221   3e-67   Setaria italica
ref|XP_010929006.1|  PREDICTED: KH domain-containing protein At5g...    221   3e-67   Elaeis guineensis
ref|XP_006280844.1|  hypothetical protein CARUB_v10026819mg             221   6e-67   Capsella rubella
ref|NP_200425.1|  KH domain-containing protein                          221   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864436.1|  KH domain-containing protein                       221   7e-67   
ref|XP_007020328.1|  RNA-binding KH domain-containing protein           221   7e-67   
ref|XP_009410310.1|  PREDICTED: KH domain-containing protein At5g...    218   7e-67   
gb|AAL87326.1|  putative RNA-binding protein                            218   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410308.1|  PREDICTED: KH domain-containing protein At5g...    219   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410309.1|  PREDICTED: KH domain-containing protein At5g...    219   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE77960.1|  unknown                                                 219   2e-66   Picea sitchensis
ref|XP_010443253.1|  PREDICTED: KH domain-containing protein At5g...    219   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010483081.1|  PREDICTED: KH domain-containing protein At5g...    219   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010450699.1|  PREDICTED: KH domain-containing protein At5g...    219   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009120127.1|  PREDICTED: KH domain-containing protein At5g...    217   3e-66   Brassica rapa
gb|KFK27184.1|  hypothetical protein AALP_AA8G346800                    219   6e-66   Arabis alpina [alpine rockcress]
ref|XP_009120126.1|  PREDICTED: KH domain-containing protein At5g...    218   8e-66   Brassica rapa
emb|CDY17395.1|  BnaA10g10290D                                          218   8e-66   Brassica napus [oilseed rape]
emb|CDY66744.1|  BnaAnng22840D                                          218   1e-65   Brassica napus [oilseed rape]
emb|CDY51960.1|  BnaCnng21440D                                          217   1e-65   Brassica napus [oilseed rape]
ref|XP_009142357.1|  PREDICTED: KH domain-containing protein At4g...    217   2e-65   Brassica rapa
emb|CAA18222.1|  putative protein                                       223   4e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42731.1|  BnaA03g48080D                                          216   5e-65   Brassica napus [oilseed rape]
emb|CDX94326.1|  BnaC01g18580D                                          216   6e-65   
ref|XP_009137598.1|  PREDICTED: KH domain-containing protein At4g...    216   6e-65   Brassica rapa
ref|XP_010942516.1|  PREDICTED: KH domain-containing protein At5g...    213   7e-65   
ref|XP_010942514.1|  PREDICTED: KH domain-containing protein At5g...    214   1e-64   Elaeis guineensis
ref|XP_010942512.1|  PREDICTED: KH domain-containing protein At5g...    214   1e-64   Elaeis guineensis
ref|XP_002867563.1|  KH domain-containing protein                       221   2e-64   
emb|CDX92817.1|  BnaC07g40750D                                          213   3e-64   
ref|XP_008794733.1|  PREDICTED: KH domain-containing protein At5g...    211   8e-64   
ref|XP_008794732.1|  PREDICTED: KH domain-containing protein At5g...    212   1e-63   Phoenix dactylifera
ref|XP_010942515.1|  PREDICTED: KH domain-containing protein At5g...    208   1e-62   Elaeis guineensis
ref|XP_010942513.1|  PREDICTED: KH domain-containing protein At5g...    209   2e-62   Elaeis guineensis
emb|CDY11960.1|  BnaC03g13860D                                          209   2e-62   Brassica napus [oilseed rape]
ref|XP_009132341.1|  PREDICTED: KH domain-containing protein At5g...    207   1e-61   Brassica rapa
ref|XP_003573788.1|  PREDICTED: KH domain-containing protein At5g...    197   5e-58   Brachypodium distachyon [annual false brome]
gb|ABK25791.1|  unknown                                                 196   2e-57   Picea sitchensis
ref|XP_010278944.1|  PREDICTED: KH domain-containing protein At2g...    195   3e-57   Nelumbo nucifera [Indian lotus]
ref|XP_009600354.1|  PREDICTED: KH domain-containing protein At3g...    192   2e-56   Nicotiana tomentosiformis
ref|XP_009772459.1|  PREDICTED: KH domain-containing protein At3g...    192   3e-56   Nicotiana sylvestris
ref|XP_010931399.1|  PREDICTED: KH domain-containing protein SPIN...    192   3e-56   
ref|XP_009600353.1|  PREDICTED: KH domain-containing protein At3g...    192   3e-56   Nicotiana tomentosiformis
ref|XP_009772457.1|  PREDICTED: KH domain-containing protein At3g...    192   3e-56   Nicotiana sylvestris
ref|XP_010244588.1|  PREDICTED: KH domain-containing protein At2g...    192   3e-56   Nelumbo nucifera [Indian lotus]
gb|AFK41792.1|  unknown                                                 192   4e-56   Lotus japonicus
gb|ABR16439.1|  unknown                                                 192   4e-56   Picea sitchensis
ref|XP_008803015.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    191   1e-55   Phoenix dactylifera
ref|XP_008775562.1|  PREDICTED: KH domain-containing protein At1g...    191   1e-55   Phoenix dactylifera
ref|XP_006842569.1|  hypothetical protein AMTR_s00077p00149420          191   2e-55   Amborella trichopoda
ref|XP_010922800.1|  PREDICTED: KH domain-containing protein SPIN...    191   2e-55   Elaeis guineensis
ref|XP_008775561.1|  PREDICTED: KH domain-containing protein At1g...    191   2e-55   Phoenix dactylifera
ref|XP_010930408.1|  PREDICTED: KH domain-containing protein At1g...    191   3e-55   Elaeis guineensis
ref|XP_009617855.1|  PREDICTED: KH domain-containing protein At3g...    189   4e-55   Nicotiana tomentosiformis
ref|XP_009793498.1|  PREDICTED: KH domain-containing protein At3g...    189   4e-55   Nicotiana sylvestris
ref|XP_010927868.1|  PREDICTED: KH domain-containing protein At1g...    190   4e-55   Elaeis guineensis
ref|XP_008786388.1|  PREDICTED: KH domain-containing protein At1g...    190   5e-55   Phoenix dactylifera
ref|XP_009793497.1|  PREDICTED: KH domain-containing protein At3g...    189   5e-55   Nicotiana sylvestris
ref|XP_010245420.1|  PREDICTED: KH domain-containing protein At1g...    189   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010245421.1|  PREDICTED: KH domain-containing protein At1g...    189   6e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009617854.1|  PREDICTED: KH domain-containing protein At3g...    189   6e-55   Nicotiana tomentosiformis
gb|EYU42056.1|  hypothetical protein MIMGU_mgv1a011431mg                189   9e-55   Erythranthe guttata [common monkey flower]
ref|XP_002533340.1|  nucleic acid binding protein, putative             188   9e-55   
ref|XP_003553178.1|  PREDICTED: KH domain-containing protein At3g...    188   1e-54   Glycine max [soybeans]
gb|KHN18643.1|  KH domain-containing protein                            188   1e-54   Glycine soja [wild soybean]
ref|XP_010908089.1|  PREDICTED: KH domain-containing protein At1g...    188   2e-54   Elaeis guineensis
ref|XP_006381264.1|  hypothetical protein POPTR_0006s11210g             186   2e-54   
ref|XP_003552330.1|  PREDICTED: KH domain-containing protein At2g...    187   2e-54   Glycine max [soybeans]
gb|KDO64189.1|  hypothetical protein CISIN_1g023068mg                   184   3e-54   Citrus sinensis [apfelsine]
ref|XP_003616062.1|  KH domain-containing protein                       186   3e-54   
ref|XP_002466215.1|  hypothetical protein SORBIDRAFT_01g003680          187   3e-54   Sorghum bicolor [broomcorn]
ref|XP_004981292.1|  PREDICTED: KH domain-containing protein SPIN...    187   3e-54   Setaria italica
gb|AES99021.2|  RNA-binding KH domain protein                           186   3e-54   Medicago truncatula
ref|XP_006381266.1|  KH domain-containing family protein                187   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011018951.1|  PREDICTED: KH domain-containing protein At2g...    187   4e-54   Populus euphratica
gb|KDP21840.1|  hypothetical protein JCGZ_00627                         187   4e-54   Jatropha curcas
ref|XP_009414641.1|  PREDICTED: KH domain-containing protein At1g...    187   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011018950.1|  PREDICTED: KH domain-containing protein At2g...    187   4e-54   Populus euphratica
ref|NP_001051685.1|  Os03g0815700                                       187   5e-54   
gb|KHG17170.1|  hypothetical protein F383_07324                         184   5e-54   Gossypium arboreum [tree cotton]
gb|ACJ84729.1|  unknown                                                 186   5e-54   Medicago truncatula
ref|XP_003616061.1|  KH domain-containing protein                       186   5e-54   
ref|XP_006650789.1|  PREDICTED: KH domain-containing protein SPIN...    186   7e-54   Oryza brachyantha
ref|XP_003626662.1|  KH domain-containing protein                       187   7e-54   
ref|XP_011095178.1|  PREDICTED: KH domain-containing protein At2g...    186   7e-54   Sesamum indicum [beniseed]
ref|XP_003626661.1|  KH domain-containing protein                       186   7e-54   Medicago truncatula
ref|XP_006645141.1|  PREDICTED: KH domain-containing protein At1g...    186   7e-54   Oryza brachyantha
ref|XP_007205691.1|  hypothetical protein PRUPE_ppa009701mg             186   8e-54   Prunus persica
ref|XP_009370879.1|  PREDICTED: KH domain-containing protein At3g...    186   9e-54   Pyrus x bretschneideri [bai li]
ref|XP_008355743.1|  PREDICTED: KH domain-containing protein At3g...    186   9e-54   Malus domestica [apple tree]
ref|XP_009337813.1|  PREDICTED: KH domain-containing protein At3g...    186   9e-54   Pyrus x bretschneideri [bai li]
ref|XP_008359840.1|  PREDICTED: KH domain-containing protein At3g...    186   9e-54   
ref|XP_002323686.2|  KH domain-containing family protein                186   1e-53   
ref|XP_011006271.1|  PREDICTED: KH domain-containing protein At2g...    186   1e-53   Populus euphratica
gb|KHN40599.1|  KH domain-containing protein                            187   1e-53   Glycine soja [wild soybean]
ref|XP_004492593.1|  PREDICTED: KH domain-containing protein At2g...    185   2e-53   Cicer arietinum [garbanzo]
ref|XP_007033461.1|  RNA-binding KH domain-containing protein           185   2e-53   Theobroma cacao [chocolate]
gb|KJB71497.1|  hypothetical protein B456_011G125700                    184   2e-53   Gossypium raimondii
ref|XP_004955829.1|  PREDICTED: KH domain-containing protein SPIN...    185   2e-53   Setaria italica
gb|KDO64187.1|  hypothetical protein CISIN_1g023068mg                   183   2e-53   Citrus sinensis [apfelsine]
ref|XP_003534621.1|  PREDICTED: KH domain-containing protein At2g...    185   2e-53   Glycine max [soybeans]
gb|KHG24418.1|  hypothetical protein F383_31230                         185   2e-53   Gossypium arboreum [tree cotton]
ref|XP_009760263.1|  PREDICTED: KH domain-containing protein At2g...    185   2e-53   Nicotiana sylvestris
gb|KJB71496.1|  hypothetical protein B456_011G125700                    185   2e-53   Gossypium raimondii
gb|KHG12649.1|  hypothetical protein F383_20322                         185   2e-53   Gossypium arboreum [tree cotton]
ref|XP_008463292.1|  PREDICTED: KH domain-containing protein At2g...    185   3e-53   
ref|XP_009589069.1|  PREDICTED: KH domain-containing protein At2g...    185   3e-53   Nicotiana tomentosiformis
ref|XP_006858588.1|  hypothetical protein AMTR_s00071p00192730          185   3e-53   Amborella trichopoda
ref|XP_004142668.1|  PREDICTED: KH domain-containing protein At2g...    184   3e-53   Cucumis sativus [cucumbers]
ref|XP_008463293.1|  PREDICTED: KH domain-containing protein At2g...    184   3e-53   Cucumis melo [Oriental melon]
ref|XP_007134588.1|  hypothetical protein PHAVU_010G059400g             184   3e-53   Phaseolus vulgaris [French bean]
ref|NP_001045029.1|  Os01g0886300                                       185   3e-53   
gb|EMT27361.1|  KH domain-containing protein                            183   3e-53   
ref|NP_001132735.1|  hypothetical protein                               179   4e-53   
gb|KDP45673.1|  hypothetical protein JCGZ_17280                         184   4e-53   Jatropha curcas
ref|XP_010043877.1|  PREDICTED: KH domain-containing protein At2g...    184   5e-53   Eucalyptus grandis [rose gum]
emb|CDP06370.1|  unnamed protein product                                184   5e-53   Coffea canephora [robusta coffee]
ref|XP_002268790.1|  PREDICTED: KH domain-containing protein At2g...    184   5e-53   Vitis vinifera
ref|XP_010683433.1|  PREDICTED: KH domain-containing protein At3g...    184   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004970832.1|  PREDICTED: KH domain-containing protein At1g...    184   6e-53   Setaria italica
ref|XP_006591271.1|  PREDICTED: KH domain-containing protein At3g...    182   6e-53   Glycine max [soybeans]
gb|KHN29474.1|  KH domain-containing protein                            186   6e-53   Glycine soja [wild soybean]
gb|AFK41392.1|  unknown                                                 184   6e-53   Medicago truncatula
ref|XP_004510090.1|  PREDICTED: KH domain-containing protein At2g...    184   8e-53   
ref|XP_002456759.1|  hypothetical protein SORBIDRAFT_03g042090          184   8e-53   Sorghum bicolor [broomcorn]
ref|XP_006429644.1|  hypothetical protein CICLE_v10012376mg             184   8e-53   Citrus clementina [clementine]
gb|ACU24211.1|  unknown                                                 183   9e-53   Glycine max [soybeans]
ref|XP_006657570.1|  PREDICTED: KH domain-containing protein SPIN...    183   9e-53   Oryza brachyantha
ref|NP_001130116.1|  uncharacterized protein LOC100191210               183   1e-52   Zea mays [maize]
gb|EMS59864.1|  KH domain-containing protein SPIN1                      182   1e-52   Triticum urartu
ref|XP_004246970.1|  PREDICTED: KH domain-containing protein At2g...    183   1e-52   Solanum lycopersicum
ref|XP_004962051.1|  PREDICTED: KH domain-containing protein At1g...    183   1e-52   Setaria italica
ref|XP_006359981.1|  PREDICTED: KH domain-containing protein At2g...    183   1e-52   Solanum tuberosum [potatoes]
ref|NP_001148920.1|  nucleic acid binding protein                       183   1e-52   Zea mays [maize]
gb|KHN24715.1|  KH domain-containing protein                            183   2e-52   Glycine soja [wild soybean]
ref|XP_003538343.1|  PREDICTED: KH domain-containing protein At3g...    182   2e-52   Glycine max [soybeans]
tpg|DAA60064.1|  TPA: hypothetical protein ZEAMMB73_533537              181   2e-52   
ref|XP_003538342.1|  PREDICTED: KH domain-containing protein At3g...    182   2e-52   Glycine max [soybeans]
emb|CDP04028.1|  unnamed protein product                                183   2e-52   Coffea canephora [robusta coffee]
ref|XP_010228217.1|  PREDICTED: KH domain-containing protein SPIN...    182   2e-52   Brachypodium distachyon [annual false brome]
ref|XP_007140039.1|  hypothetical protein PHAVU_008G079200g             182   2e-52   Phaseolus vulgaris [French bean]
ref|XP_002459573.1|  hypothetical protein SORBIDRAFT_02g006770          182   2e-52   Sorghum bicolor [broomcorn]
ref|XP_002264308.1|  PREDICTED: KH domain-containing protein At3g...    182   2e-52   Vitis vinifera
emb|CAN61397.1|  hypothetical protein VITISV_015779                     182   2e-52   Vitis vinifera
ref|XP_004490738.1|  PREDICTED: KH domain-containing protein At3g...    182   3e-52   Cicer arietinum [garbanzo]
ref|XP_010913290.1|  PREDICTED: KH domain-containing protein At5g...    181   3e-52   Elaeis guineensis
ref|XP_001777736.1|  predicted protein                                  182   3e-52   
ref|NP_001150031.1|  nucleic acid binding protein                       182   3e-52   Zea mays [maize]
ref|XP_003557365.1|  PREDICTED: KH domain-containing protein SPIN...    182   3e-52   Brachypodium distachyon [annual false brome]
ref|XP_003564796.1|  PREDICTED: KH domain-containing protein At1g...    182   3e-52   Brachypodium distachyon [annual false brome]
ref|XP_004490737.1|  PREDICTED: KH domain-containing protein At3g...    183   3e-52   
ref|NP_001059216.1|  Os07g0227400                                       182   4e-52   
ref|XP_010913289.1|  PREDICTED: KH domain-containing protein At5g...    181   4e-52   
dbj|BAJ96236.1|  predicted protein                                      181   5e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU19015.1|  unknown                                                 181   7e-52   Glycine max [soybeans]
ref|XP_003521946.1|  PREDICTED: KH domain-containing protein At2g...    181   7e-52   Glycine max [soybeans]
ref|XP_004302513.1|  PREDICTED: KH domain-containing protein At3g...    181   8e-52   Fragaria vesca subsp. vesca
gb|KGN58679.1|  hypothetical protein Csa_3G727970                       179   9e-52   Cucumis sativus [cucumbers]
gb|AFK47467.1|  unknown                                                 181   1e-51   Lotus japonicus
ref|XP_006350897.1|  PREDICTED: KH domain-containing protein At3g...    181   1e-51   Solanum tuberosum [potatoes]
tpg|DAA60062.1|  TPA: nucleic acid binding protein                      182   1e-51   
ref|XP_002441114.1|  hypothetical protein SORBIDRAFT_09g020640          181   1e-51   
ref|XP_007146910.1|  hypothetical protein PHAVU_006G080900g             179   1e-51   
ref|XP_003548334.1|  PREDICTED: KH domain-containing protein At2g...    180   2e-51   
ref|XP_004170718.1|  PREDICTED: KH domain-containing protein At2g...    180   2e-51   
ref|XP_009383283.1|  PREDICTED: KH domain-containing protein SPIN...    180   2e-51   
ref|XP_009411877.1|  PREDICTED: KH domain-containing protein At1g...    180   2e-51   
gb|AET01129.2|  RNA-binding KH domain protein                           179   2e-51   
ref|XP_003626653.1|  KH domain-containing protein                       180   2e-51   
ref|XP_001780004.1|  predicted protein                                  179   3e-51   
ref|XP_006654415.1|  PREDICTED: KH domain-containing protein At1g...    180   3e-51   
ref|NP_001140438.1|  hypothetical protein                               179   4e-51   
ref|XP_008672523.1|  PREDICTED: hypothetical protein isoform X1         179   4e-51   
ref|XP_004242461.1|  PREDICTED: KH domain-containing protein At3g...    179   4e-51   
ref|NP_001142049.1|  hypothetical protein                               179   4e-51   
ref|XP_003623654.1|  KH domain-containing protein                       179   4e-51   
ref|XP_008672524.1|  PREDICTED: hypothetical protein isoform X2         179   4e-51   
ref|XP_002974032.1|  hypothetical protein SELMODRAFT_100146             178   6e-51   
ref|XP_011041754.1|  PREDICTED: KH domain-containing protein At2g...    178   7e-51   
ref|XP_003519299.1|  PREDICTED: KH domain-containing protein At3g...    178   8e-51   
ref|XP_006429645.1|  hypothetical protein CICLE_v10012376mg             178   8e-51   
ref|XP_004137670.1|  PREDICTED: KH domain-containing protein At2g...    180   9e-51   
ref|XP_006575463.1|  PREDICTED: KH domain-containing protein At3g...    179   9e-51   
ref|XP_001764522.1|  predicted protein                                  178   9e-51   
gb|KHN41004.1|  KH domain-containing protein                            179   1e-50   
dbj|BAJ94104.1|  predicted protein                                      178   1e-50   
ref|XP_007141998.1|  hypothetical protein PHAVU_008G244000g             178   1e-50   
ref|XP_006655420.1|  PREDICTED: KH domain-containing protein SPIN...    177   1e-50   
gb|ACU19066.1|  unknown                                                 177   1e-50   
emb|CDM85378.1|  unnamed protein product                                178   1e-50   
gb|AFW78410.1|  hypothetical protein ZEAMMB73_819710                    174   2e-50   
ref|XP_006362335.1|  PREDICTED: KH domain-containing protein At3g...    177   3e-50   
ref|XP_010327700.1|  PREDICTED: KH domain-containing protein At3g...    177   3e-50   
ref|XP_009355253.1|  PREDICTED: KH domain-containing protein At3g...    176   4e-50   
ref|XP_002325628.1|  hypothetical protein POPTR_0019s15270g             176   5e-50   
ref|XP_009374412.1|  PREDICTED: KH domain-containing protein At3g...    176   5e-50   
ref|XP_004294849.1|  PREDICTED: KH domain-containing protein At3g...    176   6e-50   
ref|XP_003563829.1|  PREDICTED: KH domain-containing protein SPIN...    176   6e-50   
gb|KHG06086.1|  hypothetical protein F383_05584                         176   6e-50   
ref|XP_008354244.1|  PREDICTED: KH domain-containing protein At3g...    176   6e-50   
ref|XP_010227830.1|  PREDICTED: KH domain-containing protein SPIN...    176   6e-50   
ref|XP_007205693.1|  hypothetical protein PRUPE_ppa009725mg             176   6e-50   
ref|XP_004500397.1|  PREDICTED: KH domain-containing protein SPIN...    176   8e-50   
dbj|BAD06470.1|  hypothetical protein                                   176   1e-49   
ref|XP_009780437.1|  PREDICTED: KH domain-containing protein At2g...    176   1e-49   
ref|XP_006407758.1|  hypothetical protein EUTSA_v10021281mg             176   1e-49   
gb|AFW78409.1|  hypothetical protein ZEAMMB73_819710                    174   1e-49   
tpg|DAA39471.1|  TPA: LOW QUALITY PROTEIN: hypothetical protein Z...    177   1e-49   
ref|NP_001055861.1|  Os05g0481500                                       175   1e-49   
gb|EEE64120.1|  hypothetical protein OsJ_18952                          175   1e-49   
ref|XP_009614149.1|  PREDICTED: KH domain-containing protein At3g...    175   1e-49   
ref|XP_002319982.1|  hypothetical protein POPTR_0013s15580g             175   2e-49   
ref|XP_002531808.1|  conserved hypothetical protein                     182   2e-49   
ref|NP_187474.2|  RNA-binding KH domain-containing protein              174   2e-49   
ref|XP_009410498.1|  PREDICTED: KH domain-containing protein SPIN...    174   3e-49   
ref|XP_009410499.1|  PREDICTED: KH domain-containing protein SPIN...    174   3e-49   
ref|XP_010558412.1|  PREDICTED: KH domain-containing protein At3g...    174   3e-49   
ref|XP_010464471.1|  PREDICTED: KH domain-containing protein At3g...    174   3e-49   
ref|XP_009146996.1|  PREDICTED: KH domain-containing protein At3g...    174   3e-49   
ref|XP_004961722.1|  PREDICTED: KH domain-containing protein SPIN...    174   3e-49   
ref|NP_001150991.1|  nucleic acid binding protein                       174   4e-49   
ref|XP_006298282.1|  hypothetical protein CARUB_v10014346mg             174   5e-49   
gb|EPS71004.1|  hypothetical protein M569_03750                         174   5e-49   
ref|XP_003568231.1|  PREDICTED: KH domain-containing protein SPIN1      174   5e-49   
gb|AAG51340.1|AC012562_1  unknown protein; 28504-31237                  175   5e-49   
ref|XP_010930407.1|  PREDICTED: KH domain-containing protein At1g...    175   6e-49   
ref|XP_010553177.1|  PREDICTED: KH domain-containing protein At3g...    173   8e-49   
ref|XP_010462948.1|  PREDICTED: KH domain-containing protein At3g...    173   9e-49   
ref|NP_001044630.1|  Os01g0818300                                       173   1e-48   
ref|XP_010486402.1|  PREDICTED: KH domain-containing protein At3g...    172   1e-48   
emb|CDY27991.1|  BnaC05g43930D                                          172   2e-48   
ref|XP_002882575.1|  KH domain-containing protein                       172   2e-48   
gb|EAZ39172.1|  hypothetical protein OsJ_23597                          172   2e-48   
ref|XP_009374444.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    168   2e-48   
ref|XP_009587501.1|  PREDICTED: KH domain-containing protein At1g...    172   3e-48   
ref|XP_009790260.1|  PREDICTED: KH domain-containing protein At1g...    172   3e-48   
ref|XP_006644907.1|  PREDICTED: KH domain-containing protein SPIN...    172   3e-48   
ref|XP_011008510.1|  PREDICTED: KH domain-containing protein At3g...    171   3e-48   
ref|XP_011008509.1|  PREDICTED: KH domain-containing protein At2g...    171   4e-48   
gb|ACG41186.1|  nucleic acid binding protein                            171   4e-48   
gb|EMT11095.1|  KH domain-containing protein                            171   6e-48   
ref|XP_006349313.1|  PREDICTED: KH domain-containing protein At1g...    171   7e-48   
ref|XP_003616063.1|  KH domain-containing protein                       172   7e-48   
ref|XP_004230441.1|  PREDICTED: KH domain-containing protein At1g...    171   8e-48   
ref|XP_002441276.1|  hypothetical protein SORBIDRAFT_09g023640          171   9e-48   
gb|KHN30620.1|  KH domain-containing protein                            171   1e-47   
gb|EYU46041.1|  hypothetical protein MIMGU_mgv1a007711mg                172   2e-47   
gb|ACN27764.1|  unknown                                                 168   3e-47   
ref|XP_009776889.1|  PREDICTED: KH domain-containing protein At1g...    169   5e-47   
gb|EMT15768.1|  KH domain-containing protein                            168   8e-47   
ref|NP_001168305.1|  hypothetical protein                               168   9e-47   
gb|KJB77959.1|  hypothetical protein B456_012G169800                    168   1e-46   
gb|EMS48704.1|  KH domain-containing protein SPIN1                      169   1e-46   
ref|XP_002456539.1|  hypothetical protein SORBIDRAFT_03g038070          167   2e-46   
ref|NP_001148784.1|  protein held out wings                             166   4e-46   
ref|XP_010529949.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    167   4e-46   
gb|ACF83493.1|  unknown                                                 166   4e-46   
gb|EAZ13953.1|  hypothetical protein OsJ_03879                          166   4e-46   
ref|XP_006411077.1|  hypothetical protein EUTSA_v10017040mg             166   4e-46   
ref|XP_010509148.1|  PREDICTED: KH domain-containing protein At2g...    166   5e-46   
emb|CDY60757.1|  BnaA05g34810D                                          166   5e-46   
ref|NP_181395.1|  RNA-binding KH domain-containing protein              166   6e-46   
ref|XP_009143371.1|  PREDICTED: KH domain-containing protein At2g...    166   6e-46   
gb|KFK36766.1|  hypothetical protein AALP_AA4G167700                    166   6e-46   
emb|CDX91481.1|  BnaC04g06690D                                          166   7e-46   
ref|XP_002452631.1|  hypothetical protein SORBIDRAFT_04g029426          160   7e-46   
ref|XP_006294628.1|  hypothetical protein CARUB_v10023665mg             166   8e-46   
ref|XP_009133271.1|  PREDICTED: KH domain-containing protein At2g...    165   9e-46   
emb|CDY07718.1|  BnaA03g17930D                                          165   1e-45   
ref|XP_004970377.1|  PREDICTED: KH domain-containing protein SPIN...    164   2e-45   
ref|XP_010098608.1|  KH domain-containing protein                       165   3e-45   
emb|CDY14446.1|  BnaC03g21490D                                          164   3e-45   
gb|EMS53218.1|  hypothetical protein TRIUR3_13157                       164   4e-45   
ref|NP_001055572.1|  Os05g0419500                                       164   4e-45   
ref|XP_008218703.1|  PREDICTED: KH domain-containing protein At1g...    162   5e-45   
gb|AAB60723.1|  F21M12.5 gene product                                   159   6e-45   
ref|XP_008218701.1|  PREDICTED: KH domain-containing protein At1g...    163   7e-45   
ref|XP_011092287.1|  PREDICTED: KH domain-containing protein At1g...    163   7e-45   
ref|XP_009353790.1|  PREDICTED: KH domain-containing protein At1g...    163   8e-45   
ref|XP_002977855.1|  hypothetical protein SELMODRAFT_107444             161   1e-44   
ref|XP_006431582.1|  hypothetical protein CICLE_v10002036mg             162   1e-44   
ref|XP_006431583.1|  hypothetical protein CICLE_v10002036mg             162   1e-44   
ref|NP_001132285.1|  uncharacterized protein LOC100193725               162   1e-44   
ref|XP_007225752.1|  hypothetical protein PRUPE_ppa009432mg             162   2e-44   
ref|XP_008218700.1|  PREDICTED: KH domain-containing protein At1g...    162   2e-44   
ref|XP_008361674.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    162   3e-44   
ref|XP_008357681.1|  PREDICTED: KH domain-containing protein At1g...    161   3e-44   
ref|XP_002979473.1|  hypothetical protein SELMODRAFT_110771             161   4e-44   
ref|XP_010096437.1|  KH domain-containing protein                       161   6e-44   
ref|XP_008378908.1|  PREDICTED: KH domain-containing protein At1g...    160   7e-44   
ref|XP_009355337.1|  PREDICTED: KH domain-containing protein At1g...    160   8e-44   
ref|XP_011028364.1|  PREDICTED: KH domain-containing protein At1g...    160   1e-43   
ref|XP_006385053.1|  hypothetical protein POPTR_0004s23460g             160   1e-43   
ref|XP_002526434.1|  nucleic acid binding protein, putative             160   1e-43   
ref|XP_006417550.1|  hypothetical protein EUTSA_v10008323mg             160   2e-43   
ref|XP_006305461.1|  hypothetical protein CARUB_v10009882mg             159   2e-43   
ref|XP_002892515.1|  hypothetical protein ARALYDRAFT_471067             159   2e-43   
ref|NP_172437.2|  RNA-binding KH domain-containing protein              159   3e-43   
gb|AAL31922.1|AF419590_1  At1g09660/F21M12_5                            159   3e-43   
ref|XP_010490233.1|  PREDICTED: KH domain-containing protein At1g...    159   3e-43   
ref|XP_010475807.1|  PREDICTED: KH domain-containing protein At1g...    159   3e-43   
ref|XP_004300000.1|  PREDICTED: KH domain-containing protein At1g...    159   3e-43   
gb|EMT28447.1|  hypothetical protein F775_05859                         158   9e-43   
ref|NP_001239952.1|  uncharacterized protein LOC100796731               157   1e-42   
ref|XP_006591877.1|  PREDICTED: uncharacterized protein LOC100796...    157   1e-42   
ref|XP_010458263.1|  PREDICTED: KH domain-containing protein At1g...    157   1e-42   
gb|KJB47895.1|  hypothetical protein B456_008G046100                    154   2e-42   
ref|XP_002263798.1|  PREDICTED: KH domain-containing protein At1g...    157   2e-42   
ref|XP_007148574.1|  hypothetical protein PHAVU_006G219900g             157   2e-42   
emb|CDO97629.1|  unnamed protein product                                156   2e-42   
ref|XP_007041198.1|  RNA-binding KH domain-containing protein iso...    156   2e-42   
ref|XP_010030195.1|  PREDICTED: KH domain-containing protein At1g...    156   3e-42   
ref|XP_010030193.1|  PREDICTED: KH domain-containing protein At1g...    156   3e-42   
ref|XP_006389504.1|  hypothetical protein POPTR_0022s00450g             155   5e-42   
gb|KHG06621.1|  hypothetical protein F383_33149                         155   8e-42   
gb|KJB47893.1|  hypothetical protein B456_008G046100                    154   2e-41   
ref|XP_009110812.1|  PREDICTED: KH domain-containing protein At1g...    154   3e-41   
emb|CDY20680.1|  BnaC08g13780D                                          154   3e-41   
ref|XP_009110811.1|  PREDICTED: KH domain-containing protein At1g...    154   3e-41   
emb|CDX93492.1|  BnaA06g05560D                                          154   3e-41   
emb|CDY31072.1|  BnaA08g26220D                                          154   3e-41   
emb|CDY50885.1|  BnaCnng19770D                                          154   4e-41   
ref|XP_004133720.1|  PREDICTED: KH domain-containing protein At1g...    153   4e-41   
ref|XP_009148265.1|  PREDICTED: KH domain-containing protein At1g...    154   4e-41   
ref|XP_010030197.1|  PREDICTED: KH domain-containing protein At1g...    152   4e-41   
ref|XP_010030196.1|  PREDICTED: KH domain-containing protein At1g...    152   4e-41   
ref|XP_011047889.1|  PREDICTED: KH domain-containing protein At1g...    152   1e-40   
ref|XP_003592904.1|  KH domain-containing protein                       152   1e-40   
gb|KEH36412.1|  RNA-binding KH domain protein                           152   1e-40   
ref|XP_010030191.1|  PREDICTED: KH domain-containing protein At1g...    152   2e-40   
gb|KGN56263.1|  hypothetical protein Csa_3G110600                       154   2e-40   
ref|XP_010030192.1|  PREDICTED: KH domain-containing protein At1g...    152   2e-40   
gb|KDP42460.1|  hypothetical protein JCGZ_00257                         151   4e-40   
gb|KJB63135.1|  hypothetical protein B456_009G454400                    149   6e-40   
gb|KJB19741.1|  hypothetical protein B456_003G117200                    145   9e-40   
ref|XP_006280843.1|  hypothetical protein CARUB_v10026819mg             145   3e-38   
ref|XP_009395222.1|  PREDICTED: KH domain-containing protein SPIN...    146   3e-38   
gb|KJB09230.1|  hypothetical protein B456_001G130400                    142   3e-38   
ref|XP_010553190.1|  PREDICTED: KH domain-containing protein At2g...    145   6e-38   
ref|XP_006492549.1|  PREDICTED: KH domain-containing protein At1g...    141   8e-38   
ref|XP_010549026.1|  PREDICTED: KH domain-containing protein At1g...    144   9e-38   
gb|AAO60031.1|  unknown protein, 5'-partial                             137   3e-37   
gb|EPS67293.1|  hypothetical protein M569_07482                         140   1e-36   
ref|XP_004962052.1|  PREDICTED: KH domain-containing protein At1g...    138   9e-36   
ref|XP_006654416.1|  PREDICTED: KH domain-containing protein At1g...    134   2e-34   
gb|AFB34202.1|  hypothetical protein CL3054Contig1_01                   125   6e-33   
ref|XP_010094450.1|  KH domain-containing protein                       124   1e-31   
gb|AFB34203.1|  hypothetical protein CL3054Contig1_01                   122   1e-31   
ref|XP_008788353.1|  PREDICTED: KH domain-containing protein At1g...    125   1e-30   
gb|EYU33281.1|  hypothetical protein MIMGU_mgv1a0259741mg               122   2e-30   
ref|XP_011018952.1|  PREDICTED: KH domain-containing protein At2g...    123   4e-30   
gb|ACJ85819.1|  unknown                                                 119   1e-29   
gb|AFW84763.1|  hypothetical protein ZEAMMB73_536570                    120   5e-29   
ref|XP_006411078.1|  hypothetical protein EUTSA_v10017040mg             120   8e-29   
gb|AAW56869.1|  putative KH domain-like protein                         121   3e-28   
gb|KJB27614.1|  hypothetical protein B456_005G002300                    118   3e-28   
gb|KJB27615.1|  hypothetical protein B456_005G002300                    118   5e-28   
gb|KHN39678.1|  KH domain-containing protein                            114   6e-27   
ref|XP_003600563.1|  KH domain-containing protein                       114   6e-27   
ref|NP_973800.1|  RNA-binding KH domain-containing protein              112   5e-26   
gb|KJB47892.1|  hypothetical protein B456_008G046100                    111   1e-25   
gb|KDO39787.1|  hypothetical protein CISIN_1g039634mg                   105   2e-24   
ref|XP_005535069.1|  similar to RNA-binding protein QKI                 110   6e-24   
ref|XP_001622397.1|  hypothetical protein NEMVEDRAFT_v1g141408          103   4e-23   
ref|XP_005702863.1|  RNA-binding protein                                102   6e-22   
ref|XP_009022527.1|  hypothetical protein HELRODRAFT_67109            96.3    3e-20   
dbj|BAH29736.1|  quaking protein                                      97.1    3e-20   
gb|ELU10377.1|  hypothetical protein CAPTEDRAFT_94427                 95.9    4e-20   
gb|EMT02598.1|  hypothetical protein F775_43967                       93.6    1e-19   
gb|EYB90649.1|  hypothetical protein Y032_0217g2408                   91.3    2e-19   
emb|CDJ98369.1|  KH domain containing protein                         93.6    3e-19   
pdb|2BL5|A  Chain A, Solution Structure Of The Kh-Qua2 Region Of ...  90.9    4e-19   
gb|EGW03094.1|  Protein quaking                                       92.4    5e-19   
ref|XP_005156411.1|  PREDICTED: protein quaking-B isoform X2          94.0    5e-19   
ref|XP_009305087.1|  PREDICTED: protein quaking-B isoform X5          93.6    5e-19   
ref|XP_005156412.1|  PREDICTED: protein quaking-B isoform X4          93.6    5e-19   
ref|XP_005462305.1|  PREDICTED: protein quaking-like isoform X2       93.2    6e-19   
gb|EYB90653.1|  hypothetical protein Y032_0217g2408                   92.4    6e-19   
gb|ERG86719.1|  protein quaking                                       92.8    6e-19   
ref|XP_005951932.1|  PREDICTED: protein quaking-like                  93.6    6e-19   
gb|EYB90652.1|  hypothetical protein Y032_0217g2408                   92.4    6e-19   



>ref|XP_011095628.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Sesamum indicum]
Length=285

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  160  RGNSLKRVEATTDCRVLIRGRGSIKDPVREEMMRGKPGYEHLNEPLHILVEAELPVEIID  219

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDFYKK QLRELA+LNGTLREEGSQMSGSVSPF+NSLGMK
Sbjct  220  ARLMQAREILEDLLKPVDESQDFYKKQQLRELAVLNGTLREEGSQMSGSVSPFHNSLGMK  279

Query  368  RAKTRG  351
            RAKTRG
Sbjct  280  RAKTRG  285



>ref|XP_009762106.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Nicotiana sylvestris]
Length=289

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  164  RGNSLKRVEATTECRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREILEDLLKP+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+NSLGMK
Sbjct  224  ARLLQAREILEDLLKPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLGMK  283

Query  368  RAKTRG  351
            RAKTRG
Sbjct  284  RAKTRG  289



>ref|XP_009762105.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Nicotiana sylvestris]
Length=293

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  168  RGNSLKRVEATTECRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  227

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREILEDLLKP+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+NSLGMK
Sbjct  228  ARLLQAREILEDLLKPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLGMK  287

Query  368  RAKTRG  351
            RAKTRG
Sbjct  288  RAKTRG  293



>gb|KJB63132.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=140

 Score =   236 bits (603),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  14   RGNSLKRVEANTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  73

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPF-NNSLGM  372
            ARLMQAREILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF NNSLGM
Sbjct  74   ARLMQAREILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFQNNSLGM  133

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  134  KRAKTRG  140



>gb|KHN01498.1| KH domain-containing protein [Glycine soja]
Length=238

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  113  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  172

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  173  ARLMQAREILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  232

Query  368  RAKTRG  351
            RAKTRG
Sbjct  233  RAKTRG  238



>ref|XP_011000365.1| PREDICTED: KH domain-containing protein At5g56140-like [Populus 
euphratica]
Length=302

 Score =   242 bits (617),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VE ELPVEI+D
Sbjct  177  RGNSLKRVEASTECRVLIRGRGSIKDPAKEEMMRGKPGYEHLNEPLHILVEGELPVEIVD  236

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQD+YKK QLRELAMLNGTLREEGS MSGSVSPFNNSLGMK
Sbjct  237  ARLMQAREILEDLLKPVDESQDYYKKQQLRELAMLNGTLREEGSPMSGSVSPFNNSLGMK  296

Query  368  RAKTRG  351
            RAKTRG
Sbjct  297  RAKTRG  302



>ref|XP_006377999.1| hypothetical protein POPTR_0011s17110g [Populus trichocarpa]
 gb|ERP55796.1| hypothetical protein POPTR_0011s17110g [Populus trichocarpa]
Length=301

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VE ELPVEI+D
Sbjct  176  RGNSLKRVEASTECRVLIRGRGSIKDPAKEEMMRGKPGYEHLNEPLHILVEGELPVEIVD  235

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQD+YKK QLRELAMLNGTLREEGS MSGSVSPFNNSLGMK
Sbjct  236  ARLMQAREILEDLLKPVDESQDYYKKQQLRELAMLNGTLREEGSPMSGSVSPFNNSLGMK  295

Query  368  RAKTRG  351
            RAKTRG
Sbjct  296  RAKTRG  301



>gb|AGV54732.1| KH domain-containing protein [Phaseolus vulgaris]
Length=291

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  166  RGNSLKRVEASTDCRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIID  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAR+ILEDLLKPVDESQDFYKK QLRELA+LNGTLREEGS MSGSVSPF NSLGMK
Sbjct  226  ARLLQARDILEDLLKPVDESQDFYKKQQLRELALLNGTLREEGSPMSGSVSPFQNSLGMK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>gb|ABK95423.1| unknown [Populus trichocarpa]
Length=176

 Score =   237 bits (604),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VE ELPVEI+D
Sbjct  51   RGNSLKRVEASTECRVLIRGRGSIKDPAKEEMMRGKPGYEHLNEPLHILVEGELPVEIVD  110

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQA EILEDLLKPVDESQD+YKK QLRELAMLNGTLREEGS MSGSVSPFNNSLGMK
Sbjct  111  ARLMQASEILEDLLKPVDESQDYYKKQQLRELAMLNGTLREEGSPMSGSVSPFNNSLGMK  170

Query  368  RAKTRG  351
            RAKTRG
Sbjct  171  RAKTRG  176



>gb|KDP36322.1| hypothetical protein JCGZ_09537 [Jatropha curcas]
Length=295

 Score =   241 bits (614),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  170  RGNSLKRVEASTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  229

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  230  ARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  289

Query  368  RAKTRG  351
            RAKTRG
Sbjct  290  RAKTRG  295



>gb|KJB63133.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=177

 Score =   236 bits (603),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  51   RGNSLKRVEANTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  110

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPF-NNSLGM  372
            ARLMQAREILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF NNSLGM
Sbjct  111  ARLMQAREILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFQNNSLGM  170

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  171  KRAKTRG  177



>ref|XP_007148648.1| hypothetical protein PHAVU_005G003500g [Phaseolus vulgaris]
 gb|ESW20642.1| hypothetical protein PHAVU_005G003500g [Phaseolus vulgaris]
Length=291

 Score =   240 bits (613),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  166  RGNSLKRVEASTDCRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAR+ILEDLLKPVDESQDFYKK QLRELA+LNGTLREEGS MSGSVSPF NSLGMK
Sbjct  226  ARLLQARDILEDLLKPVDESQDFYKKQQLRELALLNGTLREEGSPMSGSVSPFQNSLGMK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>ref|XP_011097700.1| PREDICTED: LOW QUALITY PROTEIN: KH domain-containing protein 
At4g26480-like [Sesamum indicum]
Length=286

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  161  RGNSLKRVEATTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIID  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDFYKK QLRELA+LNGTLREEGSQMSGSVSPFN++LGMK
Sbjct  221  ARLMQAREILEDLLKPVDESQDFYKKQQLRELALLNGTLREEGSQMSGSVSPFNSTLGMK  280

Query  368  RAKTRG  351
            RAKT G
Sbjct  281  RAKTTG  286



>ref|XP_009620233.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Nicotiana tomentosiformis]
Length=289

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  164  RGNSLKRVEATTECRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QA EILEDLLKP+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+NSLGMK
Sbjct  224  ARLLQAHEILEDLLKPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLGMK  283

Query  368  RAKTRG  351
            RAKTRG
Sbjct  284  RAKTRG  289



>ref|XP_010244820.1| PREDICTED: KH domain-containing protein At5g56140-like [Nelumbo 
nucifera]
Length=290

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  165  RGNSLKRVEASTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  224

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDE QDF+KK QLRELAMLNGTLREEGS +SGSVSPFNNSLGMK
Sbjct  225  ARLMQAREILEDLLKPVDECQDFFKKQQLRELAMLNGTLREEGSHLSGSVSPFNNSLGMK  284

Query  368  RAKTRG  351
            RAKTRG
Sbjct  285  RAKTRG  290



>ref|XP_003522828.1| PREDICTED: KH domain-containing protein At5g56140-like [Glycine 
max]
Length=291

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  166  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  226  ARLMQAREILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>ref|XP_009620232.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Nicotiana tomentosiformis]
Length=293

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  168  RGNSLKRVEATTECRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  227

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QA EILEDLLKP+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+NSLGMK
Sbjct  228  ARLLQAHEILEDLLKPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLGMK  287

Query  368  RAKTRG  351
            RAKTRG
Sbjct  288  RAKTRG  293



>ref|XP_006452745.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 ref|XP_006452746.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65985.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65986.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=172

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  47   RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  106

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DFYKK QLRELA+LNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  107  ARLMQAREILEDLLKPVDESHDFYKKQQLRELALLNGTLREEGSPMSGSVSPFHNSLGMK  166

Query  368  RAKTRG  351
            RAKTRG
Sbjct  167  RAKTRG  172



>ref|XP_006452748.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 ref|XP_006452749.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 ref|XP_006452753.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65988.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65989.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65993.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=178

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  53   RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  112

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DFYKK QLRELA+LNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  113  ARLMQAREILEDLLKPVDESHDFYKKQQLRELALLNGTLREEGSPMSGSVSPFHNSLGMK  172

Query  368  RAKTRG  351
            RAKTRG
Sbjct  173  RAKTRG  178



>gb|KJB63136.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=274

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  148  RGNSLKRVEANTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  207

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPF-NNSLGM  372
            ARLMQAREILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF NNSLGM
Sbjct  208  ARLMQAREILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFQNNSLGM  267

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  268  KRAKTRG  274



>gb|EYU27503.1| hypothetical protein MIMGU_mgv1a011068mg [Erythranthe guttata]
Length=293

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPV+IID
Sbjct  168  RGNSLKRVEATTDCRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVDIID  227

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP+DE QDFYKK QLRELA+LNGTLREE SQMSGSVSPF+NSLGMK
Sbjct  228  ARLMQAREILEDLLKPMDECQDFYKKQQLRELALLNGTLREEDSQMSGSVSPFHNSLGMK  287

Query  368  RAKTRG  351
            RAKTRG
Sbjct  288  RAKTRG  293



>ref|XP_008384622.1| PREDICTED: KH domain-containing protein At5g56140-like [Malus 
domestica]
Length=299

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVEV+T+CRVLIRGRGSIKDPTKEE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  174  RGNSLKRVEVTTECRVLIRGRGSIKDPTKEEMMRGKPGYEHLNEPLHILVEAELPVEIID  233

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL+QARE+LEDLL+PVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  234  TRLLQAREVLEDLLRPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  293

Query  368  RAKTRG  351
            RAKTRG
Sbjct  294  RAKTRG  299



>ref|XP_006346087.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Solanum tuberosum]
Length=289

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  164  RGNSLKRVEATTECRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREILEDLL+P+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+NSLGMK
Sbjct  224  ARLLQAREILEDLLRPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLGMK  283

Query  368  RAKTR  354
            RAKTR
Sbjct  284  RAKTR  288



>ref|XP_006452754.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65994.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=223

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  98   RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  157

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DFYKK QLRELA+LNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  158  ARLMQAREILEDLLKPVDESHDFYKKQQLRELALLNGTLREEGSPMSGSVSPFHNSLGMK  217

Query  368  RAKTRG  351
            RAKTRG
Sbjct  218  RAKTRG  223



>ref|XP_006474774.1| PREDICTED: KH domain-containing protein At5g56140-like [Citrus 
sinensis]
Length=292

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  167  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  227  ARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  286

Query  368  RAKTRG  351
            RAKTRG
Sbjct  287  RAKTRG  292



>ref|XP_003527575.1| PREDICTED: KH domain-containing protein At5g56140-like [Glycine 
max]
 gb|KHN20564.1| KH domain-containing protein [Glycine soja]
Length=292

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  167  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR+ILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  227  ARLMQARDILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  286

Query  368  RAKTRG  351
            RAKTRG
Sbjct  287  RAKTRG  292



>ref|XP_006346086.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Solanum tuberosum]
Length=293

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  168  RGNSLKRVEATTECRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  227

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREILEDLL+P+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+NSLGMK
Sbjct  228  ARLLQAREILEDLLRPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLGMK  287

Query  368  RAKTR  354
            RAKTR
Sbjct  288  RAKTR  292



>ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g56140 [Vitis vinifera]
 emb|CBI39805.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   238 bits (607),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E +T+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  162  RGNSLKRMEATTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  221

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  222  ARLMQAREILEDLLKPVDESQDFFKKQQLRELAMLNGTLREEGSHMSGSVSPFHNSLGMK  281

Query  368  RAKTRG  351
            RAKTRG
Sbjct  282  RAKTRG  287



>ref|XP_010252937.1| PREDICTED: KH domain-containing protein At5g56140-like [Nelumbo 
nucifera]
Length=294

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  169  RGNSLKRVEASTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  228

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREILEDLLKP+DESQDF+KK QLRELAMLNGTLREEGS +SGSVSPF+NSLGMK
Sbjct  229  ARLLQAREILEDLLKPMDESQDFFKKQQLRELAMLNGTLREEGSHLSGSVSPFHNSLGMK  288

Query  368  RAKTRG  351
            RAKTRG
Sbjct  289  RAKTRG  294



>gb|KJB63134.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=301

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  175  RGNSLKRVEANTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  234

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPF-NNSLGM  372
            ARLMQAREILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF NNSLGM
Sbjct  235  ARLMQAREILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFQNNSLGM  294

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  295  KRAKTRG  301



>ref|XP_008813751.1| PREDICTED: KH domain-containing protein At5g56140 isoform X3 
[Phoenix dactylifera]
Length=286

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+C +LIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  161  RGNSLKRVEASTECHILIRGRGSIKDPTQEEMMRGKPGYEHLNEPLHILVEAELPVEIVD  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KKHQLRELA+LNGTLREEGS MSGS SPF NSLGMK
Sbjct  221  ARLMQAREILEDLLKPVDESQDFFKKHQLRELALLNGTLREEGSHMSGSGSPFRNSLGMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>gb|KHG00195.1| hypothetical protein F383_19595 [Gossypium arboreum]
Length=321

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  195  RGNSLKRVEANTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  254

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPF-NNSLGM  372
            ARLMQAREILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF NNSLGM
Sbjct  255  ARLMQAREILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFQNNSLGM  314

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  315  KRAKTRG  321



>ref|XP_002532938.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF29442.1| nucleic acid binding protein, putative [Ricinus communis]
Length=300

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  175  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  234

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            AR+ QAREILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  235  ARIAQAREILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  294

Query  368  RAKTRG  351
            RAKTRG
Sbjct  295  RAKTRG  300



>ref|XP_008813752.1| PREDICTED: KH domain-containing protein At5g56140 isoform X4 
[Phoenix dactylifera]
Length=285

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+C +LIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  160  RGNSLKRVEASTECHILIRGRGSIKDPTQEEMMRGKPGYEHLNEPLHILVEAELPVEIVD  219

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KKHQLRELA+LNGTLREEGS MSGS SPF NSLGMK
Sbjct  220  ARLMQAREILEDLLKPVDESQDFFKKHQLRELALLNGTLREEGSHMSGSGSPFRNSLGMK  279

Query  368  RAKTRG  351
            RAKTRG
Sbjct  280  RAKTRG  285



>ref|XP_008813749.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Phoenix dactylifera]
Length=292

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+C +LIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  167  RGNSLKRVEASTECHILIRGRGSIKDPTQEEMMRGKPGYEHLNEPLHILVEAELPVEIVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KKHQLRELA+LNGTLREEGS MSGS SPF NSLGMK
Sbjct  227  ARLMQAREILEDLLKPVDESQDFFKKHQLRELALLNGTLREEGSHMSGSGSPFRNSLGMK  286

Query  368  RAKTRG  351
            RAKTRG
Sbjct  287  RAKTRG  292



>gb|KDO73992.1| hypothetical protein CISIN_1g022785mg [Citrus sinensis]
Length=292

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  167  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DFYKK QLRELA+LNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  227  ARLMQAREILEDLLKPVDESHDFYKKQQLRELALLNGTLREEGSPMSGSVSPFHNSLGMK  286

Query  368  RAKTRG  351
            RAKTRG
Sbjct  287  RAKTRG  292



>ref|XP_008813750.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Phoenix dactylifera]
Length=291

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+C +LIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  166  RGNSLKRVEASTECHILIRGRGSIKDPTQEEMMRGKPGYEHLNEPLHILVEAELPVEIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KKHQLRELA+LNGTLREEGS MSGS SPF NSLGMK
Sbjct  226  ARLMQAREILEDLLKPVDESQDFFKKHQLRELALLNGTLREEGSHMSGSGSPFRNSLGMK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>ref|XP_006452747.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65987.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=292

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  167  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DFYKK QLRELA+LNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  227  ARLMQAREILEDLLKPVDESHDFYKKQQLRELALLNGTLREEGSPMSGSVSPFHNSLGMK  286

Query  368  RAKTRG  351
            RAKTRG
Sbjct  287  RAKTRG  292



>ref|XP_006452752.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65992.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=279

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  154  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  213

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DFYKK QLRELA+LNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  214  ARLMQAREILEDLLKPVDESHDFYKKQQLRELALLNGTLREEGSPMSGSVSPFHNSLGMK  273

Query  368  RAKTRG  351
            RAKTRG
Sbjct  274  RAKTRG  279



>ref|XP_008447796.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Cucumis melo]
Length=238

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  113  RGNSLKRVEASTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIID  172

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP++ES DFYKK QLRELAMLNGTLREEGS MS SVSPF+NSLGMK
Sbjct  173  ARLMQAREILEDLLKPMEESHDFYKKQQLRELAMLNGTLREEGSPMSSSVSPFHNSLGMK  232

Query  368  RAKTRG  351
            RAKTRG
Sbjct  233  RAKTRG  238



>ref|XP_004953739.1| PREDICTED: KH domain-containing protein At5g56140-like [Setaria 
italica]
Length=286

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  161  RGNSLKRVEANTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIID  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DF+KK QLRELAMLNGTLREEG Q SGS SPFNNSLGMK
Sbjct  221  ARLMQAREILEDLLKPVDESHDFFKKQQLRELAMLNGTLREEGMQRSGSASPFNNSLGMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>ref|XP_006452751.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65991.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=269

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  144  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  203

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDES DFYKK QLRELA+LNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  204  ARLMQAREILEDLLKPVDESHDFYKKQQLRELALLNGTLREEGSPMSGSVSPFHNSLGMK  263

Query  368  RAKTRG  351
            RAKTRG
Sbjct  264  RAKTRG  269



>ref|XP_002454368.1| hypothetical protein SORBIDRAFT_04g029520 [Sorghum bicolor]
 gb|EES07344.1| hypothetical protein SORBIDRAFT_04g029520 [Sorghum bicolor]
Length=286

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  161  RGNSLKRVEANTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIID  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KK QLRELAMLNGTLREEG Q SGS SPF+NSLGMK
Sbjct  221  ARLMQAREILEDLLKPVDESQDFFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>ref|XP_007205649.1| hypothetical protein PRUPE_ppa009341mg [Prunus persica]
 gb|EMJ06848.1| hypothetical protein PRUPE_ppa009341mg [Prunus persica]
Length=296

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  171  RGNSLKRVEATTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIID  230

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QARE+LEDLL+PVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  231  ARLSQAREVLEDLLRPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  290

Query  368  RAKTRG  351
            RAKTRG
Sbjct  291  RAKTRG  296



>ref|XP_004139764.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis 
sativus]
 ref|XP_004163285.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis 
sativus]
 gb|KGN44103.1| hypothetical protein Csa_7G188690 [Cucumis sativus]
Length=296

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  171  RGNSLKRVEASTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIID  230

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP++ES DFYKK QLRELAMLNGTLREEGS MS SVSPF+NSLGMK
Sbjct  231  ARLMQAREILEDLLKPMEESHDFYKKQQLRELAMLNGTLREEGSPMSSSVSPFHNSLGMK  290

Query  368  RAKTRG  351
            RAKTRG
Sbjct  291  RAKTRG  296



>ref|XP_008219129.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Prunus mume]
Length=306

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  181  RGNSLKRVEATTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIID  240

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QARE+LEDLL+PVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  241  ARLSQAREVLEDLLRPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  300

Query  368  RAKTRG  351
            RAKTRG
Sbjct  301  RAKTRG  306



>ref|XP_008219133.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Prunus mume]
Length=296

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  171  RGNSLKRVEATTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIID  230

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QARE+LEDLL+PVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  231  ARLSQAREVLEDLLRPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  290

Query  368  RAKTRG  351
            RAKTRG
Sbjct  291  RAKTRG  296



>ref|XP_006647814.1| PREDICTED: KH domain-containing protein At5g56140-like [Oryza 
brachyantha]
Length=285

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  160  RGNSLKRVEATTDCRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIID  219

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQAREILEDLLKPVDESQDF+KK QLRELAMLNGTLREEG Q SGS SPF+N+LGMK
Sbjct  220  TRLMQAREILEDLLKPVDESQDFFKKQQLRELAMLNGTLREEGMQRSGSASPFHNNLGMK  279

Query  368  RAKTRG  351
            RAKTRG
Sbjct  280  RAKTRG  285



>gb|KJB45527.1| hypothetical protein B456_007G310100 [Gossypium raimondii]
Length=295

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH+++EAELPVEI+D
Sbjct  170  RGNSLKRVEANTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILIEAELPVEIVD  229

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP DESQDFYKK QLRELAMLNGTLREEGS MSGS+SPF NSLGMK
Sbjct  230  ARLMQAREILEDLLKPTDESQDFYKKQQLRELAMLNGTLREEGSPMSGSLSPFQNSLGMK  289

Query  368  RAKTRG  351
            RAKTRG
Sbjct  290  RAKTRG  295



>gb|KJB45526.1| hypothetical protein B456_007G310100 [Gossypium raimondii]
Length=294

 Score =   235 bits (600),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH+++EAELPVEI+D
Sbjct  169  RGNSLKRVEANTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILIEAELPVEIVD  228

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP DESQDFYKK QLRELAMLNGTLREEGS MSGS+SPF NSLGMK
Sbjct  229  ARLMQAREILEDLLKPTDESQDFYKKQQLRELAMLNGTLREEGSPMSGSLSPFQNSLGMK  288

Query  368  RAKTRG  351
            RAKTRG
Sbjct  289  RAKTRG  294



>ref|XP_009379123.1| PREDICTED: KH domain-containing protein At5g56140-like [Pyrus 
x bretschneideri]
Length=299

 Score =   236 bits (601),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  174  RGNSLKRVEATTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIID  233

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QARE+LEDLL+PVDESQDFYKK QLRELAMLNGTLREEGS MSGS+SPF NSLGMK
Sbjct  234  ARLLQAREVLEDLLRPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSLSPFRNSLGMK  293

Query  368  RAKTRG  351
            RAKTRG
Sbjct  294  RAKTRG  299



>gb|ACG35732.1| nucleic acid binding protein [Zea mays]
Length=286

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  161  RGNSLKRVEANTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIID  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQD++KK QLRELAMLNGTLREEG Q SGS SPF+NSLGMK
Sbjct  221  ARLMQAREILEDLLKPVDESQDYFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>ref|XP_008447797.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Cucumis melo]
Length=296

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  171  RGNSLKRVEASTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIID  230

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP++ES DFYKK QLRELAMLNGTLREEGS MS SVSPF+NSLGMK
Sbjct  231  ARLMQAREILEDLLKPMEESHDFYKKQQLRELAMLNGTLREEGSPMSSSVSPFHNSLGMK  290

Query  368  RAKTRG  351
            RAKTRG
Sbjct  291  RAKTRG  296



>ref|XP_010092393.1| KH domain-containing protein [Morus notabilis]
 gb|EXB51069.1| KH domain-containing protein [Morus notabilis]
Length=307

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGK GYEHLNEPLH++VEAELPVEI+D
Sbjct  182  RGNSLKRVEATTECRVLIRGRGSIKDPTREEMMRGKQGYEHLNEPLHILVEAELPVEIVD  241

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQAREILEDLLKP+DESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  242  TRLMQAREILEDLLKPIDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMK  301

Query  368  RAKTRG  351
            RAKTRG
Sbjct  302  RAKTRG  307



>ref|XP_008353854.1| PREDICTED: KH domain-containing protein At5g56140 [Malus domestica]
Length=299

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPT+EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  174  RGNSLKRVEATTECRVLIRGRGSIKDPTREEMMRGKPGYEHLNEPLHILVEAELPVEIID  233

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QARE+LEDLL+PVDESQDFYKK QLRELA+LNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  234  ARLLQAREVLEDLLRPVDESQDFYKKQQLRELAILNGTLREEGSPMSGSVSPFHNSLGMK  293

Query  368  RAKTRG  351
            RAKTRG
Sbjct  294  RAKTRG  299



>ref|NP_001141163.1| uncharacterized protein LOC100273249 [Zea mays]
 gb|ACF85597.1| unknown [Zea mays]
 gb|AFW73198.1| nucleic acid binding protein [Zea mays]
Length=286

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  161  RGNSLKRVEANTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIID  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQD++KK QLRELAMLNGTLREEG Q SGS SPF+NSLGMK
Sbjct  221  ARLMQAREILEDLLKPVDESQDYFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>dbj|BAK03295.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +E++MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  100  RGNSLKRVEATTDCRVLIRGRGSIKDPAREDMMRGKPGYEHLNEPLHILVEAELPVEIID  159

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLL+P+DESQDF+KK QLRELAMLNGTLREEG Q SGS SPF+NSLGMK
Sbjct  160  ARLMQAREILEDLLRPMDESQDFFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMK  219

Query  368  RAKTRG  351
            RAKTRG
Sbjct  220  RAKTRG  225



>ref|XP_010324228.1| PREDICTED: KH domain-containing protein At5g56140 isoform X4 
[Solanum lycopersicum]
Length=291

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 2/127 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  164  RGNSLKRVEATTECRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNN--SLG  375
            ARL+QAREILEDLLKP+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+N  SLG
Sbjct  224  ARLLQAREILEDLLKPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLSLG  283

Query  374  MKRAKTR  354
            MKRAKTR
Sbjct  284  MKRAKTR  290



>ref|XP_004244006.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Solanum lycopersicum]
Length=299

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 2/127 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  172  RGNSLKRVEATTECRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  231

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNN--SLG  375
            ARL+QAREILEDLLKP+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+N  SLG
Sbjct  232  ARLLQAREILEDLLKPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLSLG  291

Query  374  MKRAKTR  354
            MKRAKTR
Sbjct  292  MKRAKTR  298



>ref|XP_011095627.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Sesamum indicum]
Length=297

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 123/138 (89%), Gaps = 12/138 (9%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTK------------EEVMRGKPGYEHLNEPLHV  585
            RGNSLKRVE +TDCRVLIRGRGSIKDP +            EE+MRGKPGYEHLNEPLH+
Sbjct  160  RGNSLKRVEATTDCRVLIRGRGSIKDPVRVIGIWPLSLSQIEEMMRGKPGYEHLNEPLHI  219

Query  584  VVEAELPVEIIDARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSG  405
            +VEAELPVEIIDARLMQAREILEDLLKPVDESQDFYKK QLRELA+LNGTLREEGSQMSG
Sbjct  220  LVEAELPVEIIDARLMQAREILEDLLKPVDESQDFYKKQQLRELAVLNGTLREEGSQMSG  279

Query  404  SVSPFNNSLGMKRAKTRG  351
            SVSPF+NSLGMKRAKTRG
Sbjct  280  SVSPFHNSLGMKRAKTRG  297



>ref|XP_004244007.1| PREDICTED: KH domain-containing protein At5g56140 isoform X3 
[Solanum lycopersicum]
Length=295

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 2/127 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  168  RGNSLKRVEATTECRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  227

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNN--SLG  375
            ARL+QAREILEDLLKP+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+N  SLG
Sbjct  228  ARLLQAREILEDLLKPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLSLG  287

Query  374  MKRAKTR  354
            MKRAKTR
Sbjct  288  MKRAKTR  294



>ref|XP_010324227.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Solanum lycopersicum]
Length=303

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 2/127 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLHV+VEAELPVEIID
Sbjct  176  RGNSLKRVEATTECRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEPLHVIVEAELPVEIID  235

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNN--SLG  375
            ARL+QAREILEDLLKP+DESQDFYKK QLRELAMLNGTLREEGSQMSGSVSPF+N  SLG
Sbjct  236  ARLLQAREILEDLLKPMDESQDFYKKQQLRELAMLNGTLREEGSQMSGSVSPFHNSLSLG  295

Query  374  MKRAKTR  354
            MKRAKTR
Sbjct  296  MKRAKTR  302



>ref|XP_010676133.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=292

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 122/127 (96%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KE++MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  166  RGNSLKRVEATTECRVLIRGRGSIKDPAKEDMMRGKPGYEHLNEPLHILVEAELPVEIID  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPF-NNSLGM  372
            ARLMQAREILEDLLKPVDESQDF+KK QLRELAMLNGTLRE+GS MSGSVSPF NNSLGM
Sbjct  226  ARLMQAREILEDLLKPVDESQDFFKKQQLRELAMLNGTLREDGSHMSGSVSPFHNNSLGM  285

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  286  KRAKTRG  292



>ref|XP_010676134.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=291

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 122/127 (96%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP KE++MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  165  RGNSLKRVEATTECRVLIRGRGSIKDPAKEDMMRGKPGYEHLNEPLHILVEAELPVEIID  224

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPF-NNSLGM  372
            ARLMQAREILEDLLKPVDESQDF+KK QLRELAMLNGTLRE+GS MSGSVSPF NNSLGM
Sbjct  225  ARLMQAREILEDLLKPVDESQDFFKKQQLRELAMLNGTLREDGSHMSGSVSPFHNNSLGM  284

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  285  KRAKTRG  291



>ref|XP_002299073.2| KH domain-containing family protein [Populus trichocarpa]
 gb|EEE83878.2| KH domain-containing family protein [Populus trichocarpa]
Length=302

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +E++MRGKPGYEHLNEPLH++VE ELPVEI+D
Sbjct  177  RGNSLKRVEASTECRVLIRGRGSIKDPAREDMMRGKPGYEHLNEPLHILVEGELPVEIVD  236

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLL+PVDESQD+YKK QLRELA+LNGT REEGS MSGSVSPFNNSLGMK
Sbjct  237  ARLMQAREILEDLLRPVDESQDYYKKQQLRELALLNGTFREEGSPMSGSVSPFNNSLGMK  296

Query  368  RAKTRG  351
            RAKTRG
Sbjct  297  RAKTRG  302



>gb|ACN25994.1| unknown [Zea mays]
 gb|AFW63659.1| hypothetical protein ZEAMMB73_233372 [Zea mays]
Length=148

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPV+IID
Sbjct  23   RGNSLKRVEANTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVDIID  82

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLLKPVDESQDF+KK QLRELAMLNGTLREEG Q  GS SPF+NSLGMK
Sbjct  83   ARLMQAREILQDLLKPVDESQDFFKKQQLRELAMLNGTLREEGMQRFGSASPFHNSLGMK  142

Query  368  RAKTRG  351
            RAKTRG
Sbjct  143  RAKTRG  148



>ref|XP_011039862.1| PREDICTED: KH domain-containing protein At5g56140 [Populus euphratica]
Length=300

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +E++MRGKPGYEHLNEPLH++VE ELPVEI+D
Sbjct  175  RGNSLKRVEASTECRVLIRGRGSIKDPAREDMMRGKPGYEHLNEPLHILVEGELPVEIVD  234

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            A+LMQAREILEDLLKPVDESQD+YKK QLRELA+LNGT REEGS MSGSVSPFNNSLGMK
Sbjct  235  AQLMQAREILEDLLKPVDESQDYYKKQQLRELALLNGTFREEGSPMSGSVSPFNNSLGMK  294

Query  368  RAKTRG  351
            RAKTRG
Sbjct  295  RAKTRG  300



>emb|CDP13650.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 124/141 (88%), Gaps = 15/141 (11%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDPTKE++MRGKPGYEHLNEPLH++VEAELPVE+ID
Sbjct  169  RGNSLKRVEANTDCRVLIRGRGSIKDPTKEDMMRGKPGYEHLNEPLHILVEAELPVEVID  228

Query  548  ARLMQAREILEDLLKPV---------------DESQDFYKKHQLRELAMLNGTLREEGSQ  414
            ARLMQAREILEDLLKPV               DESQDFYKK QLRELAM+NGTLREEGSQ
Sbjct  229  ARLMQAREILEDLLKPVIGISNDEAFCPLQMQDESQDFYKKQQLRELAMINGTLREEGSQ  288

Query  413  MSGSVSPFNNSLGMKRAKTRG  351
            MSGSVSPF+NSLGMKRAKTRG
Sbjct  289  MSGSVSPFHNSLGMKRAKTRG  309



>ref|XP_009346681.1| PREDICTED: KH domain-containing protein At5g56140-like [Pyrus 
x bretschneideri]
Length=295

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDPTKEE+MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  170  RGNSLKRVEATTECRVLIRGRGSIKDPTKEEMMRGKPGYEHLNEPLHILVEAELPVEIID  229

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL+QARE+LEDLL+PVDES+DFYKK QLRELA+LNGTLREEGS MSGSVSPF+NSLGMK
Sbjct  230  TRLLQAREVLEDLLRPVDESRDFYKKQQLRELAILNGTLREEGSPMSGSVSPFHNSLGMK  289

Query  368  RAKTRG  351
            RAKTRG
Sbjct  290  RAKTRG  295



>dbj|BAJ88160.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +E++MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  162  RGNSLKRVEATTDCRVLIRGRGSIKDPAREDMMRGKPGYEHLNEPLHILVEAELPVEIID  221

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLL+P+DESQDF+KK QLRELAMLNGTLREEG Q SGS SPF+NSLGMK
Sbjct  222  ARLMQAREILEDLLRPMDESQDFFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMK  281

Query  368  RAKTRG  351
            RAKTRG
Sbjct  282  RAKTRG  287



>ref|XP_006857601.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda]
 gb|ERN19068.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda]
Length=286

 Score =   233 bits (594),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 123/127 (97%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELP+EIID
Sbjct  160  RGNSLKRVEANTECRVLIRGRGSIKDPAREELMRGKPGYEHLNEPLHILVEAELPMEIID  219

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPF-NNSLGM  372
            ARLMQAREIL+DLLKPVDESQDF+KKHQLRELA+LNGTLR+EGS MSGSVSPF NNSLGM
Sbjct  220  ARLMQAREILDDLLKPVDESQDFFKKHQLRELAILNGTLRDEGSHMSGSVSPFQNNSLGM  279

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  280  KRAKTRG  286



>ref|XP_003570477.1| PREDICTED: KH domain-containing protein At5g56140-like [Brachypodium 
distachyon]
Length=283

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  158  RGNSLKRVEATTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVEIVD  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR+IL+DLLKP+DESQDF+KK QLRELA+LNGTLREEG Q SGS SPF+NSLGMK
Sbjct  218  ARLMQARDILQDLLKPIDESQDFFKKQQLRELALLNGTLREEGMQRSGSASPFHNSLGMK  277

Query  368  RAKTRG  351
            RAKTRG
Sbjct  278  RAKTRG  283



>ref|XP_010539129.1| PREDICTED: KH domain-containing protein At4g26480 [Tarenaya hassleriana]
Length=236

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  110  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  169

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNN-SLGM  372
            ARLMQAREILEDLL PVDESQDFYKK QLRELAMLNG+LREEGS MSGSVSP+N+  +GM
Sbjct  170  ARLMQAREILEDLLTPVDESQDFYKKQQLRELAMLNGSLREEGSPMSGSVSPYNSLGMGM  229

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  230  KRAKTRG  236



>gb|ACN35020.1| unknown [Zea mays]
 gb|AFW63661.1| hypothetical protein ZEAMMB73_233372 [Zea mays]
Length=286

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPV+IID
Sbjct  161  RGNSLKRVEANTDCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEAELPVDIID  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLLKPVDESQDF+KK QLRELAMLNGTLREEG Q  GS SPF+NSLGMK
Sbjct  221  ARLMQAREILQDLLKPVDESQDFFKKQQLRELAMLNGTLREEGMQRFGSASPFHNSLGMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>ref|XP_008805544.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Phoenix dactylifera]
Length=292

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKD  +E++MRGKPGYEHLNEPLHV++EAELPVEI+D
Sbjct  167  RGNSLKRVEASTECRVLIRGRGSIKDLAREDMMRGKPGYEHLNEPLHVLIEAELPVEIVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP+DESQDF+KK QLRELAMLNGTLREEGS MSGSVSPF N+LGMK
Sbjct  227  ARLMQAREILEDLLKPMDESQDFFKKQQLRELAMLNGTLREEGSHMSGSVSPFRNNLGMK  286

Query  368  RAKTRG  351
            RAKTRG
Sbjct  287  RAKTRG  292



>ref|XP_004294880.1| PREDICTED: KH domain-containing protein At5g56140-like [Fragaria 
vesca subsp. vesca]
Length=297

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 122/127 (96%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP +E++MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  171  RGNSLKRVEATTECRVLIRGRGSIKDPAREDMMRGKPGYEHLNEPLHILVEAELPVEIID  230

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSL-GM  372
            ARL+QARE+LEDLL+PVDESQDFYKK QLRELAMLNGTLR+EGS MSGSVSPFNNSL GM
Sbjct  231  ARLLQAREVLEDLLRPVDESQDFYKKQQLRELAMLNGTLRDEGSPMSGSVSPFNNSLGGM  290

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  291  KRAKTRG  297



>ref|XP_008805547.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X6 [Phoenix dactylifera]
Length=285

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKD  +E++MRGKPGYEHLNEPLHV++EAELPVEI+D
Sbjct  160  RGNSLKRVEASTECRVLIRGRGSIKDLAREDMMRGKPGYEHLNEPLHVLIEAELPVEIVD  219

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP+DESQDF+KK QLRELAMLNGTLREEGS MSGSVSPF N+LGMK
Sbjct  220  ARLMQAREILEDLLKPMDESQDFFKKQQLRELAMLNGTLREEGSHMSGSVSPFRNNLGMK  279

Query  368  RAKTRG  351
            RAKTRG
Sbjct  280  RAKTRG  285



>ref|XP_008805546.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X5 [Phoenix dactylifera]
Length=286

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKD  +E++MRGKPGYEHLNEPLHV++EAELPVEI+D
Sbjct  161  RGNSLKRVEASTECRVLIRGRGSIKDLAREDMMRGKPGYEHLNEPLHVLIEAELPVEIVD  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP+DESQDF+KK QLRELAMLNGTLREEGS MSGSVSPF N+LGMK
Sbjct  221  ARLMQAREILEDLLKPMDESQDFFKKQQLRELAMLNGTLREEGSHMSGSVSPFRNNLGMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>ref|XP_008805545.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Phoenix dactylifera]
Length=291

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKD  +E++MRGKPGYEHLNEPLHV++EAELPVEI+D
Sbjct  166  RGNSLKRVEASTECRVLIRGRGSIKDLAREDMMRGKPGYEHLNEPLHVLIEAELPVEIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP+DESQDF+KK QLRELAMLNGTLREEGS MSGSVSPF N+LGMK
Sbjct  226  ARLMQAREILEDLLKPMDESQDFFKKQQLRELAMLNGTLREEGSHMSGSVSPFRNNLGMK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>gb|EAZ24441.1| hypothetical protein OsJ_08192 [Oryza sativa Japonica Group]
Length=261

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +E++MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  136  RGNSLKRVEATTDCRVLIRGRGSIKDPAREDMMRGKPGYEHLNEPLHILVEAELPVEIID  195

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL+QAR+ILEDLLKPVDESQDF+KK QLRELAMLNGTLREEG Q SGS SPF+NSLGMK
Sbjct  196  TRLIQARDILEDLLKPVDESQDFFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMK  255

Query  368  RAKTRG  351
            RAKTRG
Sbjct  256  RAKTRG  261



>gb|EAY87341.1| hypothetical protein OsI_08744 [Oryza sativa Indica Group]
 dbj|BAH01623.1| unnamed protein product [Oryza sativa Japonica Group]
Length=286

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +E++MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  161  RGNSLKRVEATTDCRVLIRGRGSIKDPAREDMMRGKPGYEHLNEPLHILVEAELPVEIID  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL+QAR+ILEDLLKPVDESQDF+KK QLRELAMLNGTLREEG Q SGS SPF+NSLGMK
Sbjct  221  TRLIQARDILEDLLKPVDESQDFFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>ref|XP_008805542.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Phoenix dactylifera]
Length=299

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKD  +E++MRGKPGYEHLNEPLHV++EAELPVEI+D
Sbjct  174  RGNSLKRVEASTECRVLIRGRGSIKDLAREDMMRGKPGYEHLNEPLHVLIEAELPVEIVD  233

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP+DESQDF+KK QLRELAMLNGTLREEGS MSGSVSPF N+LGMK
Sbjct  234  ARLMQAREILEDLLKPMDESQDFFKKQQLRELAMLNGTLREEGSHMSGSVSPFRNNLGMK  293

Query  368  RAKTRG  351
            RAKTRG
Sbjct  294  RAKTRG  299



>ref|XP_008805543.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Phoenix dactylifera]
Length=298

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKD  +E++MRGKPGYEHLNEPLHV++EAELPVEI+D
Sbjct  173  RGNSLKRVEASTECRVLIRGRGSIKDLAREDMMRGKPGYEHLNEPLHVLIEAELPVEIVD  232

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKP+DESQDF+KK QLRELAMLNGTLREEGS MSGSVSPF N+LGMK
Sbjct  233  ARLMQAREILEDLLKPMDESQDFFKKQQLRELAMLNGTLREEGSHMSGSVSPFRNNLGMK  292

Query  368  RAKTRG  351
            RAKTRG
Sbjct  293  RAKTRG  298



>ref|XP_003598316.1| KH domain-containing protein [Medicago truncatula]
Length=195

 Score =   227 bits (579),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKD  +EE+MRGKPGYEHLNEPLH++VEAELP EIID
Sbjct  70   RGNSLKRVEANTECRVLIRGRGSIKDTAREEMMRGKPGYEHLNEPLHILVEAELPAEIID  129

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLL+PV+ES DFYKK QLRELAM+NGTLREEGS MSGSVSPF+NSLGMK
Sbjct  130  ARLMQAREILEDLLRPVEESHDFYKKQQLRELAMINGTLREEGSPMSGSVSPFHNSLGMK  189

Query  368  RAKTRG  351
            RAKTRG
Sbjct  190  RAKTRG  195



>ref|XP_010063216.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Eucalyptus grandis]
Length=274

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH+++EAELPVEIID
Sbjct  149  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILIEAELPVEIID  208

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAR+IL+DLLKPVDESQD YKK QLRELAMLNGTLR+E S MSGSVSPFN SLG+K
Sbjct  209  ARLIQARDILQDLLKPVDESQDVYKKQQLRELAMLNGTLRDESSPMSGSVSPFNTSLGLK  268

Query  368  RAKTRG  351
            RAKTRG
Sbjct  269  RAKTRG  274



>ref|XP_010063215.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW70422.1| hypothetical protein EUGRSUZ_F03650 [Eucalyptus grandis]
Length=287

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH+++EAELPVEIID
Sbjct  162  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILIEAELPVEIID  221

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAR+IL+DLLKPVDESQD YKK QLRELAMLNGTLR+E S MSGSVSPFN SLG+K
Sbjct  222  ARLIQARDILQDLLKPVDESQDVYKKQQLRELAMLNGTLRDESSPMSGSVSPFNTSLGLK  281

Query  368  RAKTRG  351
            RAKTRG
Sbjct  282  RAKTRG  287



>ref|XP_009415554.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCR+LIRGRGSIKDPTKEE+MRGKPGYEHLNEPLH++VEAELP EI+D
Sbjct  151  RGNSLKRVEANTDCRILIRGRGSIKDPTKEEMMRGKPGYEHLNEPLHILVEAELPAEIVD  210

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQAREILEDLLKPV+ESQDF+KK QLRELAM+NGTLREEG  MSGSVSPF++SL MK
Sbjct  211  TRLMQAREILEDLLKPVEESQDFFKKQQLRELAMINGTLREEGGHMSGSVSPFHSSLSMK  270

Query  368  RAKTR  354
            RAKTR
Sbjct  271  RAKTR  275



>ref|XP_003598315.1| KH domain-containing protein [Medicago truncatula]
 gb|AES68566.1| RNA-binding KH domain protein [Medicago truncatula]
Length=293

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKD  +EE+MRGKPGYEHLNEPLH++VEAELP EIID
Sbjct  168  RGNSLKRVEANTECRVLIRGRGSIKDTAREEMMRGKPGYEHLNEPLHILVEAELPAEIID  227

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLL+PV+ES DFYKK QLRELAM+NGTLREEGS MSGSVSPF+NSLGMK
Sbjct  228  ARLMQAREILEDLLRPVEESHDFYKKQQLRELAMINGTLREEGSPMSGSVSPFHNSLGMK  287

Query  368  RAKTRG  351
            RAKTRG
Sbjct  288  RAKTRG  293



>ref|XP_004499705.1| PREDICTED: KH domain-containing protein At5g56140-like [Cicer 
arietinum]
Length=294

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKD  +EE+MRGKPGYEHLNEPLH++VEAELP EIID
Sbjct  168  RGNSLKRVEANTECRVLIRGRGSIKDTAREEMMRGKPGYEHLNEPLHILVEAELPAEIID  227

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPF-NNSLGM  372
            ARLMQAR+ILEDLLKPVDES DFYKK QLRELAMLNGTLREEGS MSGSVSPF NNSLGM
Sbjct  228  ARLMQARDILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFQNNSLGM  287

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  288  KRAKTRG  294



>dbj|BAD13019.1| putative KH domain protein [Oryza sativa Japonica Group]
 dbj|BAD13022.1| putative KH domain protein [Oryza sativa Japonica Group]
Length=341

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKDP +E++MRGKPGYEHLNEPLH++VEAELPVEIID
Sbjct  216  RGNSLKRVEATTDCRVLIRGRGSIKDPAREDMMRGKPGYEHLNEPLHILVEAELPVEIID  275

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL+QAR+ILEDLLKPVDESQDF+KK QLRELAMLNGTLREEG Q SGS SPF+NSLGMK
Sbjct  276  TRLIQARDILEDLLKPVDESQDFFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMK  335

Query  368  RAKTRG  351
            RAKTRG
Sbjct  336  RAKTRG  341



>ref|XP_009415555.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=272

 Score =   228 bits (580),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCR+LIRGRGSIKDPTKEE+MRGKPGYEHLNEPLH++VEAELP EI+D
Sbjct  147  RGNSLKRVEANTDCRILIRGRGSIKDPTKEEMMRGKPGYEHLNEPLHILVEAELPAEIVD  206

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQAREILEDLLKPV+ESQDF+KK QLRELAM+NGTLREEG  MSGSVSPF++SL MK
Sbjct  207  TRLMQAREILEDLLKPVEESQDFFKKQQLRELAMINGTLREEGGHMSGSVSPFHSSLSMK  266

Query  368  RAKTR  354
            RAKTR
Sbjct  267  RAKTR  271



>ref|XP_009415553.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=291

 Score =   228 bits (581),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCR+LIRGRGSIKDPTKEE+MRGKPGYEHLNEPLH++VEAELP EI+D
Sbjct  166  RGNSLKRVEANTDCRILIRGRGSIKDPTKEEMMRGKPGYEHLNEPLHILVEAELPAEIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQAREILEDLLKPV+ESQDF+KK QLRELAM+NGTLREEG  MSGSVSPF++SL MK
Sbjct  226  TRLMQAREILEDLLKPVEESQDFFKKQQLRELAMINGTLREEGGHMSGSVSPFHSSLSMK  285

Query  368  RAKTR  354
            RAKTR
Sbjct  286  RAKTR  290



>ref|XP_009415552.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=292

 Score =   228 bits (581),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCR+LIRGRGSIKDPTKEE+MRGKPGYEHLNEPLH++VEAELP EI+D
Sbjct  167  RGNSLKRVEANTDCRILIRGRGSIKDPTKEEMMRGKPGYEHLNEPLHILVEAELPAEIVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQAREILEDLLKPV+ESQDF+KK QLRELAM+NGTLREEG  MSGSVSPF++SL MK
Sbjct  227  TRLMQAREILEDLLKPVEESQDFFKKQQLRELAMINGTLREEGGHMSGSVSPFHSSLSMK  286

Query  368  RAKTR  354
            RAKTR
Sbjct  287  RAKTR  291



>ref|XP_010928018.1| PREDICTED: KH domain-containing protein At5g56140 isoform X3 
[Elaeis guineensis]
Length=286

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CR+LIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPV+I+D
Sbjct  161  RGNSLKRVEASTECRILIRGRGSIKDPAQEEMMRGKPGYEHLNEPLHILVEAELPVDIVD  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQ REILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS +SGS SPF NSL MK
Sbjct  221  ARLMQIREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHLSGSGSPFRNSLSMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>ref|XP_010928019.1| PREDICTED: KH domain-containing protein At5g56140 isoform X4 
[Elaeis guineensis]
Length=285

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CR+LIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPV+I+D
Sbjct  160  RGNSLKRVEASTECRILIRGRGSIKDPAQEEMMRGKPGYEHLNEPLHILVEAELPVDIVD  219

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQ REILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS +SGS SPF NSL MK
Sbjct  220  ARLMQIREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHLSGSGSPFRNSLSMK  279

Query  368  RAKTRG  351
            RAKTRG
Sbjct  280  RAKTRG  285



>ref|XP_010928017.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Elaeis guineensis]
Length=291

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CR+LIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPV+I+D
Sbjct  166  RGNSLKRVEASTECRILIRGRGSIKDPAQEEMMRGKPGYEHLNEPLHILVEAELPVDIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQ REILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS +SGS SPF NSL MK
Sbjct  226  ARLMQIREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHLSGSGSPFRNSLSMK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>ref|XP_010928016.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Elaeis guineensis]
Length=292

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CR+LIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEAELPV+I+D
Sbjct  167  RGNSLKRVEASTECRILIRGRGSIKDPAQEEMMRGKPGYEHLNEPLHILVEAELPVDIVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQ REILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS +SGS SPF NSL MK
Sbjct  227  ARLMQIREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHLSGSGSPFRNSLSMK  286

Query  368  RAKTRG  351
            RAKTRG
Sbjct  287  RAKTRG  292



>ref|XP_010539351.1| PREDICTED: KH domain-containing protein At5g56140 [Tarenaya hassleriana]
 ref|XP_010539352.1| PREDICTED: KH domain-containing protein At5g56140 [Tarenaya hassleriana]
Length=310

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNS+KRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  186  RGNSIKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  245

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLL P++E+ DFYKK QLRELA+LNGTLREEGS MSGSVSP+ NSLGMK
Sbjct  246  ARLMQAREILEDLLTPMEETHDFYKKQQLRELALLNGTLREEGSPMSGSVSPY-NSLGMK  304

Query  368  RAKTRG  351
            RAKTRG
Sbjct  305  RAKTRG  310



>ref|XP_010545297.1| PREDICTED: KH domain-containing protein At4g26480-like [Tarenaya 
hassleriana]
Length=314

 Score =   226 bits (576),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRVLIRGRGSIKDP KEE++RGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  190  RGNSLKRVEASTGCRVLIRGRGSIKDPIKEEMLRGKPGYEHLNEPLHILVEAELPIEIVD  249

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQA EILEDLL PVDES DFYKK QLRELAMLNGTLREEGS MSGSVSP+ NSLGMK
Sbjct  250  ARLMQAHEILEDLLTPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGSVSPY-NSLGMK  308

Query  368  RAKTRG  351
            RAKTRG
Sbjct  309  RAKTRG  314



>ref|XP_010913288.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X6 [Elaeis guineensis]
Length=285

 Score =   225 bits (573),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RG SLKRVE ST+C VLIRG+GSIKDP +EE+MRGKPGYEHLNEPLHV+VEAELP+EI+D
Sbjct  160  RGYSLKRVEASTECHVLIRGQGSIKDPAREEMMRGKPGYEHLNEPLHVLVEAELPIEIVD  219

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS MS SVSPF N+L MK
Sbjct  220  ARLMQAREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHMSASVSPFRNNLSMK  279

Query  368  RAKTRG  351
            RAKTRG
Sbjct  280  RAKTRG  285



>ref|XP_010913285.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Elaeis guineensis]
Length=292

 Score =   225 bits (574),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RG SLKRVE ST+C VLIRG+GSIKDP +EE+MRGKPGYEHLNEPLHV+VEAELP+EI+D
Sbjct  167  RGYSLKRVEASTECHVLIRGQGSIKDPAREEMMRGKPGYEHLNEPLHVLVEAELPIEIVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS MS SVSPF N+L MK
Sbjct  227  ARLMQAREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHMSASVSPFRNNLSMK  286

Query  368  RAKTRG  351
            RAKTRG
Sbjct  287  RAKTRG  292



>ref|XP_010913287.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X5 [Elaeis guineensis]
Length=286

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RG SLKRVE ST+C VLIRG+GSIKDP +EE+MRGKPGYEHLNEPLHV+VEAELP+EI+D
Sbjct  161  RGYSLKRVEASTECHVLIRGQGSIKDPAREEMMRGKPGYEHLNEPLHVLVEAELPIEIVD  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS MS SVSPF N+L MK
Sbjct  221  ARLMQAREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHMSASVSPFRNNLSMK  280

Query  368  RAKTRG  351
            RAKTRG
Sbjct  281  RAKTRG  286



>ref|XP_009407925.1| PREDICTED: KH domain-containing protein At5g56140-like [Musa 
acuminata subsp. malaccensis]
Length=290

 Score =   225 bits (573),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E +T CRVLIRGRGSIKDP++EE+MRGKPGYEHLNEPLH++VEA+LPVEI+D
Sbjct  165  RGNSLKRIEATTGCRVLIRGRGSIKDPSREEMMRGKPGYEHLNEPLHILVEADLPVEIVD  224

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            AR++QAREILED+LKPVDES DF+KK QLRELAMLNGTLR++GS  SGSVSPF+NSLGMK
Sbjct  225  ARILQAREILEDMLKPVDESVDFFKKQQLRELAMLNGTLRDDGSHTSGSVSPFHNSLGMK  284

Query  368  RAKTRG  351
            RAKTRG
Sbjct  285  RAKTRG  290



>ref|XP_010913286.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Elaeis guineensis]
Length=291

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RG SLKRVE ST+C VLIRG+GSIKDP +EE+MRGKPGYEHLNEPLHV+VEAELP+EI+D
Sbjct  166  RGYSLKRVEASTECHVLIRGQGSIKDPAREEMMRGKPGYEHLNEPLHVLVEAELPIEIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS MS SVSPF N+L MK
Sbjct  226  ARLMQAREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHMSASVSPFRNNLSMK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>ref|XP_010913282.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Elaeis guineensis]
Length=299

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RG SLKRVE ST+C VLIRG+GSIKDP +EE+MRGKPGYEHLNEPLHV+VEAELP+EI+D
Sbjct  174  RGYSLKRVEASTECHVLIRGQGSIKDPAREEMMRGKPGYEHLNEPLHVLVEAELPIEIVD  233

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS MS SVSPF N+L MK
Sbjct  234  ARLMQAREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHMSASVSPFRNNLSMK  293

Query  368  RAKTRG  351
            RAKTRG
Sbjct  294  RAKTRG  299



>ref|XP_010913284.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Elaeis guineensis]
Length=298

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RG SLKRVE ST+C VLIRG+GSIKDP +EE+MRGKPGYEHLNEPLHV+VEAELP+EI+D
Sbjct  173  RGYSLKRVEASTECHVLIRGQGSIKDPAREEMMRGKPGYEHLNEPLHVLVEAELPIEIVD  232

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREILEDLLKPVDESQDF+KK QLRELA+LNGTLREEGS MS SVSPF N+L MK
Sbjct  233  ARLMQAREILEDLLKPVDESQDFFKKQQLRELALLNGTLREEGSHMSASVSPFRNNLSMK  292

Query  368  RAKTRG  351
            RAKTRG
Sbjct  293  RAKTRG  298



>ref|XP_010438749.1| PREDICTED: KH domain-containing protein At4g26480-like [Camelina 
sativa]
Length=308

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  184  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  243

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  244  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  302

Query  368  RAKTRG  351
            RAKTRG
Sbjct  303  RAKTRG  308



>ref|XP_006284180.1| hypothetical protein CARUB_v10005327mg [Capsella rubella]
 gb|EOA17078.1| hypothetical protein CARUB_v10005327mg [Capsella rubella]
Length=306

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  182  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  241

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  242  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  300

Query  368  RAKTRG  351
            RAKTRG
Sbjct  301  RAKTRG  306



>ref|XP_010448266.1| PREDICTED: KH domain-containing protein At4g26480 [Camelina sativa]
Length=307

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  183  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  242

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  243  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  301

Query  368  RAKTRG  351
            RAKTRG
Sbjct  302  RAKTRG  307



>gb|KFK29165.1| hypothetical protein AALP_AA7G098000 [Arabis alpina]
Length=312

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  188  RGNSLKRVEASTDCRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  247

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  248  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  306

Query  368  RAKTRG  351
            RAKTRG
Sbjct  307  RAKTRG  312



>ref|NP_194378.2| RNA-binding KH domain-containing protein [Arabidopsis thaliana]
 sp|Q0WLR1.1|QKIL1_ARATH RecName: Full=KH domain-containing protein At4g26480; AltName: 
Full=Quaking-like protein 1 [Arabidopsis thaliana]
 dbj|BAF01946.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85206.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana]
Length=308

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KE++MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  184  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMRGKPGYEHLNEPLHILVEAELPIEIVD  243

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  244  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  302

Query  368  RAKTRG  351
            RAKTRG
Sbjct  303  RAKTRG  308



>ref|XP_006413178.1| hypothetical protein EUTSA_v10025796mg [Eutrema salsugineum]
 gb|ESQ54631.1| hypothetical protein EUTSA_v10025796mg [Eutrema salsugineum]
Length=309

 Score =   224 bits (570),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KE++MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  185  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMRGKPGYEHLNEPLHILVEAELPIEIVD  244

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  245  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  303

Query  368  RAKTRG  351
            RAKTRG
Sbjct  304  RAKTRG  309



>ref|XP_009399829.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEA++PVEI+D
Sbjct  151  RGNSLKRVEANTGCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEADMPVEIVD  210

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREIL+D+LKPVDES DF+KK QLRELAMLNGTLR+EGS  SGS SPF+NSLG+K
Sbjct  211  ARLLQAREILKDMLKPVDESVDFFKKQQLRELAMLNGTLRDEGSHTSGSASPFHNSLGLK  270

Query  368  RAKTRG  351
            RAKTRG
Sbjct  271  RAKTRG  276



>ref|XP_010433498.1| PREDICTED: KH domain-containing protein At4g26480-like [Camelina 
sativa]
Length=308

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  184  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  243

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQA EIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  244  ARLMQAHEILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  302

Query  368  RAKTRG  351
            RAKTRG
Sbjct  303  RAKTRG  308



>ref|XP_009395891.1| PREDICTED: KH domain-containing protein At5g56140-like [Musa 
acuminata subsp. malaccensis]
Length=289

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDC +LIRGRGSIKD  KEE+MRGKPGYEHLNEPLH++VEAELPVEI+D
Sbjct  164  RGNSLKRVEANTDCHILIRGRGSIKDSAKEEMMRGKPGYEHLNEPLHILVEAELPVEIVD  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQ REILED+LKPV+ESQDF+KK QLRELAM+NGTLRE+G+ MSGSVSPF+NSL MK
Sbjct  224  ARLMQVREILEDMLKPVEESQDFFKKQQLRELAMINGTLREDGAHMSGSVSPFHNSLSMK  283

Query  368  RAKTR  354
            RAKTR
Sbjct  284  RAKTR  288



>ref|XP_008782987.1| PREDICTED: KH domain-containing protein At5g56140 [Phoenix dactylifera]
Length=291

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH+++EAELPVEI+D
Sbjct  166  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILIEAELPVEIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR ILEDLLKPVDES DF+KK QLRELAMLNGTLREEG+  S SVSPF++SL MK
Sbjct  226  ARLMQARGILEDLLKPVDESLDFFKKQQLRELAMLNGTLREEGAHTSPSVSPFHSSLSMK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>ref|XP_009399821.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=291

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VEA++PVEI+D
Sbjct  166  RGNSLKRVEANTGCRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEADMPVEIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREIL+D+LKPVDES DF+KK QLRELAMLNGTLR+EGS  SGS SPF+NSLG+K
Sbjct  226  ARLLQAREILKDMLKPVDESVDFFKKQQLRELAMLNGTLRDEGSHTSGSASPFHNSLGLK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>ref|XP_006401374.1| hypothetical protein EUTSA_v10014150mg [Eutrema salsugineum]
 gb|ESQ42827.1| hypothetical protein EUTSA_v10014150mg [Eutrema salsugineum]
Length=314

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPG+EHLNEPLH++VEAELP+EI+D
Sbjct  189  RGNSLKRVEASTDCRVLIRGRGSIKDPMKEEMMRGKPGFEHLNEPLHILVEAELPIEIVD  248

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ DFYKK QLRELA+LNGTLREEGS MSGSVSP+ NSLGMK
Sbjct  249  ARLMQAREILDDLLTPMEETHDFYKKQQLRELALLNGTLREEGSPMSGSVSPY-NSLGMK  307

Query  368  RAKTR  354
            RAKTR
Sbjct  308  RAKTR  312



>gb|AAM14070.1| unknown protein [Arabidopsis thaliana]
Length=308

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KE++MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  184  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMRGKPGYEHLNEPLHILVEAELPIEIVD  243

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  244  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  302

Query  368  RAKTR  354
            RAKTR
Sbjct  303  RAKTR  307



>ref|XP_004973255.1| PREDICTED: KH domain-containing protein At4g26480-like [Setaria 
italica]
Length=282

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRVLIRGRGSIKD  KEE+MRGKPGYEHLNEPLH+V+EAELP EI+D
Sbjct  157  RGNSLKRVEANTDCRVLIRGRGSIKDAAKEELMRGKPGYEHLNEPLHLVIEAELPAEIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQAREIL+D+LKPVDES DF+KK QLRELAMLNGTLR++ SQ SGSVSPF NS+GMK
Sbjct  217  IRLMQAREILDDMLKPVDESMDFFKKQQLRELAMLNGTLRDDSSQKSGSVSPFRNSMGMK  276

Query  368  RAKTRG  351
            RAKTRG
Sbjct  277  RAKTRG  282



>ref|XP_010929006.1| PREDICTED: KH domain-containing protein At5g56140-like [Elaeis 
guineensis]
Length=291

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST+CRVLIRGRGSIKDP +EE+MRGK GYEHLNEPLH+++EAELPVEI+D
Sbjct  166  RGNSLKRVEASTECRVLIRGRGSIKDPAREEMMRGKSGYEHLNEPLHILIEAELPVEIVD  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR ILEDLLKPVDES DF+KK QLRELAMLNGTLREEG+  S SVSPF+NSL MK
Sbjct  226  ARLMQARGILEDLLKPVDESLDFFKKQQLRELAMLNGTLREEGAHTSPSVSPFHNSLSMK  285

Query  368  RAKTRG  351
            RAKTRG
Sbjct  286  RAKTRG  291



>ref|XP_006280844.1| hypothetical protein CARUB_v10026819mg [Capsella rubella]
 gb|EOA13742.1| hypothetical protein CARUB_v10026819mg [Capsella rubella]
Length=311

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  186  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  245

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLREEGS MSGSVSP+ NSLGMK
Sbjct  246  ARLMQAREILDDLLTPMEETHDLYKKQQLRELALLNGTLREEGSPMSGSVSPY-NSLGMK  304

Query  368  RAKTR  354
            RAKTR
Sbjct  305  RAKTR  309



>ref|NP_200425.1| KH domain-containing protein [Arabidopsis thaliana]
 sp|Q9FKT4.1|QKIL2_ARATH RecName: Full=KH domain-containing protein At5g56140; AltName: 
Full=Quaking-like protein 2 [Arabidopsis thaliana]
 dbj|BAB09296.1| RNA-binding protein-like [Arabidopsis thaliana]
 gb|AAN41273.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AED96725.1| KH domain-containing protein [Arabidopsis thaliana]
Length=315

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  190  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  249

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLREEGS MSGSVSP+ NSLGMK
Sbjct  250  ARLMQAREILDDLLTPMEETHDMYKKQQLRELALLNGTLREEGSPMSGSVSPY-NSLGMK  308

Query  368  RAKTR  354
            RAKTR
Sbjct  309  RAKTR  313



>ref|XP_002864436.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40695.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=308

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  183  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  242

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLREEGS MSGSVSP+ NSLGMK
Sbjct  243  ARLMQAREILDDLLTPMEETHDLYKKQQLRELALLNGTLREEGSPMSGSVSPY-NSLGMK  301

Query  368  RAKTR  354
            RAKTR
Sbjct  302  RAKTR  306



>ref|XP_007020328.1| RNA-binding KH domain-containing protein [Theobroma cacao]
 gb|EOY11853.1| RNA-binding KH domain-containing protein [Theobroma cacao]
Length=312

 Score =   221 bits (562),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP +EE+MRGKPGYEHLNEPLH++VE ELPVEI+D
Sbjct  174  RGNSLKRVEANTECRVLIRGRGSIKDPAREEMMRGKPGYEHLNEPLHILVEGELPVEIVD  233

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGM  372
            ARLMQAREILEDLLKPVDESQDFYKK QLRELAMLNGTLREEGS MSGSVSPF+NSLG+
Sbjct  234  ARLMQAREILEDLLKPVDESQDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGV  292



>ref|XP_009410310.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=240

 Score =   218 bits (556),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCR+LIRGRGSIKD  KEE+MRGKPGYEHL+EPLH++VEAELPVEI+D
Sbjct  115  RGNSLKRVEANTDCRILIRGRGSIKDLAKEEMMRGKPGYEHLSEPLHILVEAELPVEIVD  174

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREILEDLLKPV+ES DF+K+ QLRELAM+NGTLR+EG+ MSGSVSPF++SL MK
Sbjct  175  ARLLQAREILEDLLKPVEESHDFFKQQQLRELAMINGTLRDEGTHMSGSVSPFHSSLSMK  234

Query  368  RAKTR  354
            RAKTR
Sbjct  235  RAKTR  239



>gb|AAL87326.1| putative RNA-binding protein [Arabidopsis thaliana]
Length=260

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI++
Sbjct  135  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVN  194

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLREEGS MSGSVSP+ NSLGMK
Sbjct  195  ARLMQAREILDDLLTPMEETHDMYKKQQLRELALLNGTLREEGSPMSGSVSPY-NSLGMK  253

Query  368  RAKTR  354
            RAKTR
Sbjct  254  RAKTR  258



>ref|XP_009410308.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=283

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCR+LIRGRGSIKD  KEE+MRGKPGYEHL+EPLH++VEAELPVEI+D
Sbjct  158  RGNSLKRVEANTDCRILIRGRGSIKDLAKEEMMRGKPGYEHLSEPLHILVEAELPVEIVD  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREILEDLLKPV+ES DF+K+ QLRELAM+NGTLR+EG+ MSGSVSPF++SL MK
Sbjct  218  ARLLQAREILEDLLKPVEESHDFFKQQQLRELAMINGTLRDEGTHMSGSVSPFHSSLSMK  277

Query  368  RAKTR  354
            RAKTR
Sbjct  278  RAKTR  282



>ref|XP_009410309.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCR+LIRGRGSIKD  KEE+MRGKPGYEHL+EPLH++VEAELPVEI+D
Sbjct  157  RGNSLKRVEANTDCRILIRGRGSIKDLAKEEMMRGKPGYEHLSEPLHILVEAELPVEIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL+QAREILEDLLKPV+ES DF+K+ QLRELAM+NGTLR+EG+ MSGSVSPF++SL MK
Sbjct  217  ARLLQAREILEDLLKPVEESHDFFKQQQLRELAMINGTLRDEGTHMSGSVSPFHSSLSMK  276

Query  368  RAKTR  354
            RAKTR
Sbjct  277  RAKTR  281



>gb|ADE77960.1| unknown [Picea sitchensis]
Length=286

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 120/127 (94%), Gaps = 1/127 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T+CRVLIRGRGSIKDP++E++MR KPGYEHLNEPLH++VEAELP  IID
Sbjct  160  RGNSLKRVEAATECRVLIRGRGSIKDPSREDMMRDKPGYEHLNEPLHILVEAELPASIID  219

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNS-LGM  372
            ARLMQAR+ILE+LLKPVDESQDF+KK QLRELA+LNGTLRE+GS M+GSVSPFN+S LGM
Sbjct  220  ARLMQARDILEELLKPVDESQDFFKKQQLRELAILNGTLREDGSSMAGSVSPFNSSNLGM  279

Query  371  KRAKTRG  351
            KRAKTRG
Sbjct  280  KRAKTRG  286



>ref|XP_010443253.1| PREDICTED: KH domain-containing protein At5g56140-like [Camelina 
sativa]
Length=310

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  185  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  244

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLR+EGS MSGSVSP+ NSLGMK
Sbjct  245  ARLMQAREILDDLLTPMEETHDLYKKQQLRELALLNGTLRDEGSPMSGSVSPY-NSLGMK  303

Query  368  RAKTR  354
            RAKTR
Sbjct  304  RAKTR  308



>ref|XP_010483081.1| PREDICTED: KH domain-containing protein At5g56140-like [Camelina 
sativa]
Length=314

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  189  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  248

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLR+EGS MSGSVSP+ NSLGMK
Sbjct  249  ARLMQAREILDDLLTPMEETHDLYKKQQLRELALLNGTLRDEGSPMSGSVSPY-NSLGMK  307

Query  368  RAKTR  354
            RAKTR
Sbjct  308  RAKTR  312



>ref|XP_010450699.1| PREDICTED: KH domain-containing protein At5g56140 [Camelina sativa]
Length=318

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  193  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  252

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLR+EGS MSGSVSP+ NSLGMK
Sbjct  253  ARLMQAREILDDLLTPMEETHDLYKKQQLRELALLNGTLRDEGSPMSGSVSPY-NSLGMK  311

Query  368  RAKTR  354
            RAKTR
Sbjct  312  RAKTR  316



>ref|XP_009120127.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Brassica rapa]
Length=251

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPG+EHLNEPLH++VEAELP+EIID
Sbjct  125  RGNSLKRVEASTDCRVLIRGRGSIKDPVKEEMMRGKPGFEHLNEPLHILVEAELPIEIID  184

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLR+EGS MSGSVSPF N LGMK
Sbjct  185  ARLMQAREILDDLLTPMEETHDVYKKQQLRELALLNGTLRDEGSPMSGSVSPF-NGLGMK  243

Query  368  RAKTR  354
            RAKTR
Sbjct  244  RAKTR  248



>gb|KFK27184.1| hypothetical protein AALP_AA8G346800 [Arabis alpina]
Length=320

 Score =   219 bits (557),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  195  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  254

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ DFYKK QLRELA+LNG LR+EG  MSGSVSP+ NSLGMK
Sbjct  255  ARLMQAREILDDLLTPMEETHDFYKKQQLRELALLNGNLRQEGPPMSGSVSPY-NSLGMK  313

Query  368  RAKTR  354
            RAKTR
Sbjct  314  RAKTR  318



>ref|XP_009120126.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Brassica rapa]
Length=304

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPG+EHLNEPLH++VEAELP+EIID
Sbjct  178  RGNSLKRVEASTDCRVLIRGRGSIKDPVKEEMMRGKPGFEHLNEPLHILVEAELPIEIID  237

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLR+EGS MSGSVSPFN  LGMK
Sbjct  238  ARLMQAREILDDLLTPMEETHDVYKKQQLRELALLNGTLRDEGSPMSGSVSPFNG-LGMK  296

Query  368  RAKTR  354
            RAKTR
Sbjct  297  RAKTR  301



>emb|CDY17395.1| BnaA10g10290D [Brassica napus]
Length=304

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPG+EHLNEPLH++VEAELP+EIID
Sbjct  178  RGNSLKRVEASTDCRVLIRGRGSIKDPVKEEMMRGKPGFEHLNEPLHILVEAELPIEIID  237

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLR+EGS MSGSVSPFN  LGMK
Sbjct  238  ARLMQAREILDDLLTPMEETHDVYKKQQLRELALLNGTLRDEGSPMSGSVSPFNG-LGMK  296

Query  368  RAKTR  354
            RAKTR
Sbjct  297  RAKTR  301



>emb|CDY66744.1| BnaAnng22840D [Brassica napus]
Length=314

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNE LH+++EAELP+E++D
Sbjct  190  RGNSLKRVEASTDCRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEQLHILIEAELPIELVD  249

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGSVSP+ NSLGMK
Sbjct  250  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSVSPY-NSLGMK  308

Query  368  RAKTR  354
            RAKTR
Sbjct  309  RAKTR  313



>emb|CDY51960.1| BnaCnng21440D [Brassica napus]
Length=306

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPG+EHLNEPLH++VEAELP+EI+D
Sbjct  180  RGNSLKRVEASTDCRVLIRGRGSIKDPVKEEMMRGKPGFEHLNEPLHILVEAELPIEIVD  239

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL P++E+ D YKK QLRELA+LNGTLR+EGS MSGSVSPFN  LGMK
Sbjct  240  ARLMQAREILDDLLTPMEETHDVYKKQQLRELALLNGTLRDEGSPMSGSVSPFNG-LGMK  298

Query  368  RAKTR  354
            RAKTR
Sbjct  299  RAKTR  303



>ref|XP_009142357.1| PREDICTED: KH domain-containing protein At4g26480 [Brassica rapa]
Length=314

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNE LH+++EAELP+E++D
Sbjct  190  RGNSLKRVEASTDCRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEQLHILIEAELPIELVD  249

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG LREEGS MSGSVSP+ NSLGMK
Sbjct  250  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGNLREEGSPMSGSVSPY-NSLGMK  308

Query  368  RAKTR  354
            RAKTR
Sbjct  309  RAKTR  313



>emb|CAA18222.1| putative protein [Arabidopsis thaliana]
 emb|CAB79503.1| putative protein [Arabidopsis thaliana]
Length=555

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KE++MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  431  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMRGKPGYEHLNEPLHILVEAELPIEIVD  490

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  491  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  549

Query  368  RAKTRG  351
            RAKTRG
Sbjct  550  RAKTRG  555



>emb|CDY42731.1| BnaA03g48080D [Brassica napus]
Length=302

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE S++CRVLIRGRGSIKDP KEE+MRGKPGYEHLNE LH++VEAELP+EI+D
Sbjct  178  RGNSLKRVEASSECRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEQLHILVEAELPIEIVD  237

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGSVSP+ NSLGMK
Sbjct  238  ARLMQAREILADLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSVSPY-NSLGMK  296

Query  368  RAKTR  354
            RAKTR
Sbjct  297  RAKTR  301



>emb|CDX94326.1| BnaC01g18580D [Brassica napus]
Length=312

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNE LH+++EAELP+E++D
Sbjct  188  RGNSLKRVEASTDCRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEQLHILIEAELPIELVD  247

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGSVSP+ +SLGMK
Sbjct  248  ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSVSPY-DSLGMK  306

Query  368  RAKTR  354
            RAKTR
Sbjct  307  RAKTR  311



>ref|XP_009137598.1| PREDICTED: KH domain-containing protein At4g26480-like [Brassica 
rapa]
Length=309

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE S++CRVLIRGRGSIKDP KEE+MRGKPGYEHLNE LH++VEAELP+EI+D
Sbjct  185  RGNSLKRVEASSECRVLIRGRGSIKDPVKEEMMRGKPGYEHLNEQLHILVEAELPIEIVD  244

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL DLL PV+E+ DFYKK QLRELA+LNG+LREEGS MSGSVSP+ NSLGMK
Sbjct  245  ARLMQAREILADLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSVSPY-NSLGMK  303

Query  368  RAKTR  354
            RAKTR
Sbjct  304  RAKTR  308



>ref|XP_010942516.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X5 [Elaeis guineensis]
Length=239

 Score =   213 bits (543),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E ST+CRVLIRGRGSIKDP +EE MRGKPGYEHLNEPLH+++EAELPVEIID
Sbjct  114  RGNSLKRMEASTECRVLIRGRGSIKDPVREETMRGKPGYEHLNEPLHILIEAELPVEIID  173

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR+ILEDL+KPVDES DF+KK QLRELAMLNGT+RE+    S SVSPF+NSL MK
Sbjct  174  ARLMQARDILEDLVKPVDESLDFFKKQQLRELAMLNGTIREDVPHTSPSVSPFHNSLSMK  233

Query  368  RAKTR  354
            RAKTR
Sbjct  234  RAKTR  238



>ref|XP_010942514.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Elaeis guineensis]
Length=276

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E ST+CRVLIRGRGSIKDP +EE MRGKPGYEHLNEPLH+++EAELPVEIID
Sbjct  151  RGNSLKRMEASTECRVLIRGRGSIKDPVREETMRGKPGYEHLNEPLHILIEAELPVEIID  210

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR+ILEDL+KPVDES DF+KK QLRELAMLNGT+RE+    S SVSPF+NSL MK
Sbjct  211  ARLMQARDILEDLVKPVDESLDFFKKQQLRELAMLNGTIREDVPHTSPSVSPFHNSLSMK  270

Query  368  RAKTR  354
            RAKTR
Sbjct  271  RAKTR  275



>ref|XP_010942512.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Elaeis guineensis]
Length=291

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E ST+CRVLIRGRGSIKDP +EE MRGKPGYEHLNEPLH+++EAELPVEIID
Sbjct  166  RGNSLKRMEASTECRVLIRGRGSIKDPVREETMRGKPGYEHLNEPLHILIEAELPVEIID  225

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR+ILEDL+KPVDES DF+KK QLRELAMLNGT+RE+    S SVSPF+NSL MK
Sbjct  226  ARLMQARDILEDLVKPVDESLDFFKKQQLRELAMLNGTIREDVPHTSPSVSPFHNSLSMK  285

Query  368  RAKTR  354
            RAKTR
Sbjct  286  RAKTR  290



>ref|XP_002867563.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43822.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=565

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE STDCRVLIRGRGSIKDP KEE+MRGKPGYEHLNEPLH++VEAELP+EI+D
Sbjct  441  RGNSLKRVEASTDCRVLIRGRGSIKDPIKEEMMRGKPGYEHLNEPLHILVEAELPIEIVD  500

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL+DLL PV+E+ D YKK QLRELA+LNG+LREEGS MSGS+SP+ NSLGMK
Sbjct  501  ARLMQAREILDDLLTPVEETHDLYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMK  559

Query  368  RAKTRG  351
            RAKTRG
Sbjct  560  RAKTRG  565



>emb|CDX92817.1| BnaC07g40750D [Brassica napus]
Length=301

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE S++CRVLIRGRGSIKDP KE++MRGKPGYEHLNE LH++VEAELP+EI+D
Sbjct  177  RGNSLKRVEASSECRVLIRGRGSIKDPVKEDMMRGKPGYEHLNEQLHILVEAELPIEIVD  236

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAREIL DLL PV+E+ DFYKK QLRELA+LNG++REEGS MSGSVSP+ NSLGMK
Sbjct  237  ARLMQAREILADLLTPVEETHDFYKKQQLRELALLNGSIREEGSPMSGSVSPY-NSLGMK  295

Query  368  RAKTR  354
            RAKTR
Sbjct  296  RAKTR  300



>ref|XP_008794733.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Phoenix dactylifera]
Length=273

 Score =   211 bits (538),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E ST+CRVLIRGRGSIKDP +EE MRGKPGYEHLNEPLH+++EAELPVEI+D
Sbjct  149  RGNSLKRMEASTECRVLIRGRGSIKDPAREETMRGKPGYEHLNEPLHILIEAELPVEIVD  208

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR+ILE+LLKPVDES DF+KK QLRELAMLNGTLRE+  Q S SVSPF+NSL MK
Sbjct  209  ARLMQARDILEELLKPVDESLDFFKKQQLRELAMLNGTLREDVPQ-SPSVSPFHNSLSMK  267

Query  368  RAKTR  354
            RAKTR
Sbjct  268  RAKTR  272



>ref|XP_008794732.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Phoenix dactylifera]
Length=288

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E ST+CRVLIRGRGSIKDP +EE MRGKPGYEHLNEPLH+++EAELPVEI+D
Sbjct  164  RGNSLKRMEASTECRVLIRGRGSIKDPAREETMRGKPGYEHLNEPLHILIEAELPVEIVD  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR+ILE+LLKPVDES DF+KK QLRELAMLNGTLRE+  Q S SVSPF+NSL MK
Sbjct  224  ARLMQARDILEELLKPVDESLDFFKKQQLRELAMLNGTLREDVPQ-SPSVSPFHNSLSMK  282

Query  368  RAKTR  354
            RAKTR
Sbjct  283  RAKTR  287



>ref|XP_010942515.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Elaeis guineensis]
Length=274

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 2/125 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E ST+CRVLIRGRGSIKDP  EE MRGKPGYEHLNEPLH+++EAELPVEIID
Sbjct  151  RGNSLKRMEASTECRVLIRGRGSIKDP--EETMRGKPGYEHLNEPLHILIEAELPVEIID  208

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR+ILEDL+KPVDES DF+KK QLRELAMLNGT+RE+    S SVSPF+NSL MK
Sbjct  209  ARLMQARDILEDLVKPVDESLDFFKKQQLRELAMLNGTIREDVPHTSPSVSPFHNSLSMK  268

Query  368  RAKTR  354
            RAKTR
Sbjct  269  RAKTR  273



>ref|XP_010942513.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Elaeis guineensis]
Length=289

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 2/125 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E ST+CRVLIRGRGSIKDP  EE MRGKPGYEHLNEPLH+++EAELPVEIID
Sbjct  166  RGNSLKRMEASTECRVLIRGRGSIKDP--EETMRGKPGYEHLNEPLHILIEAELPVEIID  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQAR+ILEDL+KPVDES DF+KK QLRELAMLNGT+RE+    S SVSPF+NSL MK
Sbjct  224  ARLMQARDILEDLVKPVDESLDFFKKQQLRELAMLNGTIREDVPHTSPSVSPFHNSLSMK  283

Query  368  RAKTR  354
            RAKTR
Sbjct  284  RAKTR  288



>emb|CDY11960.1| BnaC03g13860D [Brassica napus]
Length=301

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CR LIRGRGSIKD  KEE+MRGKPG+EHL+EPLH++VEAELP+EI+D
Sbjct  176  RGNSLKRVEASTGCRFLIRGRGSIKDQYKEEMMRGKPGFEHLSEPLHILVEAELPIEIVD  235

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQARE+L++LL P++E+ DFYKK QLRELA+LNGTLREEGS MSGSVSP+ NSLGMK
Sbjct  236  ARLMQAREVLDELLTPMEETHDFYKKQQLRELALLNGTLREEGSPMSGSVSPY-NSLGMK  294

Query  368  RAKTR  354
            RAKTR
Sbjct  295  RAKTR  299



>ref|XP_009132341.1| PREDICTED: KH domain-containing protein At5g56140-like [Brassica 
rapa]
 emb|CDY36777.1| BnaA03g11090D [Brassica napus]
Length=304

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CR LIRGRGSIKD  KEE+MRGKPG+EHL+EPLH++VEAELP+EI+D
Sbjct  179  RGNSLKRVEASTGCRFLIRGRGSIKDQYKEEMMRGKPGFEHLSEPLHILVEAELPIEIVD  238

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQARE+L++LL P++E+ DFYKK QLRELA+LNG LREEGS MSGSVSP+ NSLGMK
Sbjct  239  ARLMQAREVLDELLTPMEETHDFYKKQQLRELALLNGALREEGSPMSGSVSPY-NSLGMK  297

Query  368  RAKTR  354
            RAKTR
Sbjct  298  RAKTR  302



>ref|XP_003573788.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Brachypodium distachyon]
Length=283

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRVLIRGRGSIKDP +E  MRG+PGYEHL+EPLH+V++AELP EIID
Sbjct  158  RGNSLKRVEAATSCRVLIRGRGSIKDPARENFMRGRPGYEHLDEPLHLVIKAELPAEIID  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARLMQ +EIL+D+LKPVDE+ +F+K  QLRELAM+NGTL ++GSQ SGSVSPF   LGMK
Sbjct  218  ARLMQTQEILDDMLKPVDETMEFFKTQQLRELAMINGTLIDDGSQNSGSVSPFRGDLGMK  277

Query  368  RAK  360
            RAK
Sbjct  278  RAK  280



>gb|ABK25791.1| unknown [Picea sitchensis]
Length=294

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRGRGS+KD  KEE ++ KPGYEHLNEPLHV++EAELP  IID
Sbjct  170  RGNSLKRVEATTGCRVYIRGRGSVKDSAKEEKLKDKPGYEHLNEPLHVLIEAELPSNIID  229

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            AR+ QA EI++DLLKPVDES DF+KK QLRELAMLNGTLREE   MSGSVSPFNN+ GMK
Sbjct  230  ARMKQAFEIIDDLLKPVDESHDFFKKQQLRELAMLNGTLREESPHMSGSVSPFNNA-GMK  288

Query  368  RAKT  357
            R KT
Sbjct  289  RPKT  292



>ref|XP_010278944.1| PREDICTED: KH domain-containing protein At2g38610 [Nelumbo nucifera]
Length=281

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EAELP  I+D
Sbjct  157  RGNSLKRVEASTGCRVYIRGKGSIKDPGKEEKLRGRPGYEHLNDPLHILIEAELPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDFYK+ QLRELAMLN  LREE  + SGSVSPF NS GMK
Sbjct  217  TRLRQAQEIIEELLKPVDESQDFYKRQQLRELAMLNSNLREESPRPSGSVSPF-NSTGMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_009600354.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana tomentosiformis]
Length=258

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLHV++EAELP+ I+D
Sbjct  134  RGNSLKRVEASTGCRVFIRGKGSIKDPDKEESLRGRPGYEHLNEPLHVLLEAELPINIVD  193

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             +L QAREI+E+LLKPVDESQD YK+HQLRELA+LN   REE  Q  GS+SPF++S GMK
Sbjct  194  TQLKQAREIIEELLKPVDESQDLYKRHQLRELALLNNNFREESPQPRGSLSPFSSS-GMK  252

Query  368  RAKT  357
            RAKT
Sbjct  253  RAKT  256



>ref|XP_009772459.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana sylvestris]
Length=258

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLHV++EAELP+ I+D
Sbjct  134  RGNSLKRVEASTGCRVFIRGKGSIKDPDKEESLRGRPGYEHLNEPLHVLLEAELPINIVD  193

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             +L QAREI+E+LLKPVDESQD YK+HQLRELA+LN   REE  Q  GS+SPF++S GMK
Sbjct  194  TQLKQAREIIEELLKPVDESQDLYKRHQLRELALLNNNFREESPQPRGSLSPFSSS-GMK  252

Query  368  RAKT  357
            RAKT
Sbjct  253  RAKT  256



>ref|XP_010931399.1| PREDICTED: KH domain-containing protein SPIN1-like [Elaeis guineensis]
Length=258

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKR+E ST CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EAELPV ++D
Sbjct  134  RGNSLKRMEASTGCRVYIRGKGSIKDPGKEEKLRGRPGYEHLNDPLHILIEAELPVNVVD  193

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+YK+ QLRELAMLN +LRE+    SGSVSPF NS GMK
Sbjct  194  VRLRQAQEIIEELLKPVDESQDYYKRQQLRELAMLNSSLREDSPHPSGSVSPFGNS-GMK  252

Query  368  RAKT  357
            RAKT
Sbjct  253  RAKT  256



>ref|XP_009600353.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana tomentosiformis]
Length=288

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLHV++EAELP+ I+D
Sbjct  164  RGNSLKRVEASTGCRVFIRGKGSIKDPDKEESLRGRPGYEHLNEPLHVLLEAELPINIVD  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             +L QAREI+E+LLKPVDESQD YK+HQLRELA+LN   REE  Q  GS+SPF++S GMK
Sbjct  224  TQLKQAREIIEELLKPVDESQDLYKRHQLRELALLNNNFREESPQPRGSLSPFSSS-GMK  282

Query  368  RAKT  357
            RAKT
Sbjct  283  RAKT  286



>ref|XP_009772457.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana sylvestris]
Length=288

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLHV++EAELP+ I+D
Sbjct  164  RGNSLKRVEASTGCRVFIRGKGSIKDPDKEESLRGRPGYEHLNEPLHVLLEAELPINIVD  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             +L QAREI+E+LLKPVDESQD YK+HQLRELA+LN   REE  Q  GS+SPF++S GMK
Sbjct  224  TQLKQAREIIEELLKPVDESQDLYKRHQLRELALLNNNFREESPQPRGSLSPFSSS-GMK  282

Query  368  RAKT  357
            RAKT
Sbjct  283  RAKT  286



>ref|XP_010244588.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X1 [Nelumbo nucifera]
Length=281

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP  EE +RG+PGYEHLN+PLH++VEAELPV I+D
Sbjct  157  RGNSLKRVEASTGCRVYIRGKGSIKDPGNEEKLRGRPGYEHLNDPLHILVEAELPVNIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDFYK+ QLRELAMLN   REE  + SGSVSPFN++ GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDFYKRQQLRELAMLNSNFREESPRPSGSVSPFNSN-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>gb|AFK41792.1| unknown [Lotus japonicus]
Length=279

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEEV+RGKPGYEHLNEPLHV++EAELPV ++D
Sbjct  155  RGNSLKRVEATTGCRVFIRGQGSIKDPDKEEVLRGKPGYEHLNEPLHVLIEAELPVNVVD  214

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKP DE+QDFYK+ QLRELAMLN   REE  Q+SGS+SPF ++  +K
Sbjct  215  IRLRQAQEIIENLLKPADETQDFYKRQQLRELAMLNSNFREESPQLSGSLSPFTSN-EIK  273

Query  368  RAKT  357
            RAKT
Sbjct  274  RAKT  277



>gb|ABR16439.1| unknown [Picea sitchensis]
Length=289

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +TDCRV IRGRGS+KD  KEE +R KPGYEHL E LH+++EAELP  +ID
Sbjct  165  RGNSLKRVEATTDCRVYIRGRGSVKDTGKEENLRDKPGYEHLKESLHILIEAELPANVID  224

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            A+L QAR+I+ED+LKPVDES D++KK QLRELA+LNGTLREE  +MSGSVSPF+NS GMK
Sbjct  225  AKLKQARDIIEDMLKPVDESHDYFKKQQLRELALLNGTLREESPRMSGSVSPFSNS-GMK  283

Query  368  RAKT  357
            RAKT
Sbjct  284  RAKT  287



>ref|XP_008803015.1| PREDICTED: LOW QUALITY PROTEIN: KH domain-containing protein 
SPIN1-like [Phoenix dactylifera]
Length=281

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EAELPV ++D
Sbjct  157  RGNSLKRVEASTGCRVYIRGKGSIKDPGKEEKLRGRPGYEHLNDPLHILIEAELPVNVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKP+DESQD+YK+ QLRELAMLN  LRE+    SGSVSPF NS GMK
Sbjct  217  VRLRQAQEIIEELLKPIDESQDYYKRQQLRELAMLNSGLREDSLHPSGSVSPFGNS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_008775562.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X2 [Phoenix dactylifera]
Length=277

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRGRGS+KD  KEE +R KPGYEHLNEPLHV+VEAELP +IID
Sbjct  153  RGNSLKRVEASTQCRVYIRGRGSVKDSVKEEKLRDKPGYEHLNEPLHVLVEAELPADIID  212

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA  +LEDLLKPVDE+ D+YKK QLRELA+LNGTLREE   MS S SPF NS GMK
Sbjct  213  ARLNQAVRVLEDLLKPVDETIDYYKKQQLRELAILNGTLREESPHMSPSASPF-NSTGMK  271

Query  368  RAKT  357
            RAKT
Sbjct  272  RAKT  275



>ref|XP_006842569.1| hypothetical protein AMTR_s00077p00149420 [Amborella trichopoda]
 gb|ERN04244.1| hypothetical protein AMTR_s00077p00149420 [Amborella trichopoda]
Length=279

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKD  KEE ++G+PGYEHLNEPLH+++EAELPV+IID
Sbjct  155  RGNSLKRVEASTGCRVYIRGKGSIKDSEKEEKLKGRPGYEHLNEPLHILIEAELPVDIID  214

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            +RL QAREI+E+LLKPVDESQD YK+ QLRELA LN T RE+    SGS+SPFNNS GMK
Sbjct  215  SRLRQAREIIEELLKPVDESQDHYKRQQLRELAFLNSTFREDSPCPSGSLSPFNNS-GMK  273

Query  368  RAKT  357
            RAKT
Sbjct  274  RAKT  277



>ref|XP_010922800.1| PREDICTED: KH domain-containing protein SPIN1-like [Elaeis guineensis]
Length=281

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EAELPV ++D
Sbjct  157  RGNSLKRVEASTGCRVYIRGKGSIKDPGKEEKLRGRPGYEHLNDPLHILIEAELPVNVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+YK+ QLRELAMLN  LRE+    SGSVSPF NS GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDYYKRQQLRELAMLNSGLREDSLHPSGSVSPFGNS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_008775561.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X1 [Phoenix dactylifera]
Length=293

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRGRGS+KD  KEE +R KPGYEHLNEPLHV+VEAELP +IID
Sbjct  169  RGNSLKRVEASTQCRVYIRGRGSVKDSVKEEKLRDKPGYEHLNEPLHVLVEAELPADIID  228

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA  +LEDLLKPVDE+ D+YKK QLRELA+LNGTLREE   MS S SPF NS GMK
Sbjct  229  ARLNQAVRVLEDLLKPVDETIDYYKKQQLRELAILNGTLREESPHMSPSASPF-NSTGMK  287

Query  368  RAKT  357
            RAKT
Sbjct  288  RAKT  291



>ref|XP_010930408.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
isoform X2 [Elaeis guineensis]
Length=299

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GS+KD  KEE +R KPGYEHLNEPLH++VEAE P ++ID
Sbjct  175  RGNSLKRVEATTQCRVYIRGQGSVKDSLKEEKLRDKPGYEHLNEPLHLLVEAEFPADMID  234

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA  ILEDLLKPVDES+D+YKK QLRELAMLNGTLREE  QMS S SPF NS GMK
Sbjct  235  ARLSQAVGILEDLLKPVDESKDYYKKQQLRELAMLNGTLREESPQMSPSASPF-NSTGMK  293

Query  368  RAKT  357
            RAKT
Sbjct  294  RAKT  297



>ref|XP_009617855.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana tomentosiformis]
Length=258

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG PGYEHLNEPLHV++EAELP+ I+D
Sbjct  134  RGNSLKRVEASTGCRVFIRGQGSIKDPEKEESLRGLPGYEHLNEPLHVLLEAELPINIVD  193

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA +I+E+LL+PVDESQD YK+ QLRELA+LN   REE  Q  GSVSPFN+S GMK
Sbjct  194  ARLKQASQIIEELLRPVDESQDLYKRQQLRELAVLNNNFREESPQPRGSVSPFNSS-GMK  252

Query  368  RAKT  357
            RAKT
Sbjct  253  RAKT  256



>ref|XP_009793498.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana sylvestris]
Length=258

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG PGYEHLNEPLHV++EAELP+ I+D
Sbjct  134  RGNSLKRVEASTGCRVFIRGQGSIKDPEKEESLRGLPGYEHLNEPLHVLLEAELPINIVD  193

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA +I+E+LL+PVDESQD YK+ QLRELA+LN   REE  Q  GSVSPFN+S GMK
Sbjct  194  ARLKQASQIIEELLRPVDESQDLYKRQQLRELAVLNNNFREESPQPRGSVSPFNSS-GMK  252

Query  368  RAKT  357
            RAKT
Sbjct  253  RAKT  256



>ref|XP_010927868.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Elaeis guineensis]
Length=293

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRGRGS+KD  KEE +R KPGYEHLNEPLHV+VEAE P +IID
Sbjct  169  RGNSLKRVEASTQCRVYIRGRGSVKDSVKEEKLRDKPGYEHLNEPLHVLVEAEFPADIID  228

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA  +LEDLLKPVDES D+YKK QLRELA+LNGTLREE   MS S SPF NS  MK
Sbjct  229  ARLNQAVAVLEDLLKPVDESMDYYKKQQLRELAILNGTLREESPHMSPSASPF-NSTAMK  287

Query  368  RAKT  357
            RAKT
Sbjct  288  RAKT  291



>ref|XP_008786388.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Phoenix dactylifera]
Length=296

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 1/125 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GS+KD  KEE +R  PGY+HL+EPLHV+VEAE P +++D
Sbjct  172  RGNSLKRVEATTQCRVYIRGQGSVKDTLKEEKLRDTPGYDHLSEPLHVLVEAEFPADVVD  231

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA  ILEDLLKPVDES+D+YKK QLRELA+LNGTLREE  QMS SVSPF NS GMK
Sbjct  232  ARLSQAVGILEDLLKPVDESKDYYKKQQLRELALLNGTLREESPQMSPSVSPF-NSTGMK  290

Query  368  RAKTR  354
            RAKTR
Sbjct  291  RAKTR  295



>ref|XP_009793497.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana sylvestris]
Length=288

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG PGYEHLNEPLHV++EAELP+ I+D
Sbjct  164  RGNSLKRVEASTGCRVFIRGQGSIKDPEKEESLRGLPGYEHLNEPLHVLLEAELPINIVD  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA +I+E+LL+PVDESQD YK+ QLRELA+LN   REE  Q  GSVSPFN+S GMK
Sbjct  224  ARLKQASQIIEELLRPVDESQDLYKRQQLRELAVLNNNFREESPQPRGSVSPFNSS-GMK  282

Query  368  RAKT  357
            RAKT
Sbjct  283  RAKT  286



>ref|XP_010245420.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X1 [Nelumbo nucifera]
Length=298

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRGRGS+KD  KEE +R KPGYEHLNEPLHV++EAE P ++ID
Sbjct  174  RGNSLKRVEATTQCRVYIRGRGSVKDSVKEEKLRDKPGYEHLNEPLHVLLEAEFPADVID  233

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            +RL QA  ILEDLLKPVDES D+YKK QLRELAMLNGTLREE   MS S+SPF NS GMK
Sbjct  234  SRLNQAVAILEDLLKPVDESLDYYKKQQLRELAMLNGTLREESPHMSPSMSPF-NSTGMK  292

Query  368  RAKT  357
            RAKT
Sbjct  293  RAKT  296



>ref|XP_010245421.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X2 [Nelumbo nucifera]
Length=293

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRGRGS+KD  KEE +R KPGYEHLNEPLHV++EAE P ++ID
Sbjct  169  RGNSLKRVEATTQCRVYIRGRGSVKDSVKEEKLRDKPGYEHLNEPLHVLLEAEFPADVID  228

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            +RL QA  ILEDLLKPVDES D+YKK QLRELAMLNGTLREE   MS S+SPF NS GMK
Sbjct  229  SRLNQAVAILEDLLKPVDESLDYYKKQQLRELAMLNGTLREESPHMSPSMSPF-NSTGMK  287

Query  368  RAKT  357
            RAKT
Sbjct  288  RAKT  291



>ref|XP_009617854.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana tomentosiformis]
Length=288

 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG PGYEHLNEPLHV++EAELP+ I+D
Sbjct  164  RGNSLKRVEASTGCRVFIRGQGSIKDPEKEESLRGLPGYEHLNEPLHVLLEAELPINIVD  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA +I+E+LL+PVDESQD YK+ QLRELA+LN   REE  Q  GSVSPFN+S GMK
Sbjct  224  ARLKQASQIIEELLRPVDESQDLYKRQQLRELAVLNNNFREESPQPRGSVSPFNSS-GMK  282

Query  368  RAKT  357
            RAKT
Sbjct  283  RAKT  286



>gb|EYU42056.1| hypothetical protein MIMGU_mgv1a011431mg [Erythranthe guttata]
Length=282

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVEV+T CRV IRG+GSIKDP KE+ +RG+PGYEHLNEPLH+++EA+LP  I+D
Sbjct  158  RGNSLKRVEVTTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNEPLHILIEADLPANIVD  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  218  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  276

Query  368  RAKT  357
            RAKT
Sbjct  277  RAKT  280



>ref|XP_002533340.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF29039.1| nucleic acid binding protein, putative, partial [Ricinus communis]
Length=274

 Score =   188 bits (478),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KE+ +RG+PGYEHL++PLH+++EAELPV I+D
Sbjct  150  RGNSLKRVEASTGCRVYIRGKGSIKDPEKEDSLRGRPGYEHLSDPLHILIEAELPVNIVD  209

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QAREI+E+LLKPVDESQD YK+ QLRELAMLN   REE  + SGSVSPF +S GMK
Sbjct  210  MRLRQAREIIEELLKPVDESQDIYKRQQLRELAMLNSNYREESPRPSGSVSPFTSS-GMK  268

Query  368  RAKT  357
            RAKT
Sbjct  269  RAKT  272



>ref|XP_003553178.1| PREDICTED: KH domain-containing protein At3g08620-like [Glycine 
max]
Length=283

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKD  KEE++RG+PGYEHLN+PLH+++EAELP  ++D
Sbjct  159  RGNSLKRVEATTGCRVFIRGKGSIKDLDKEELLRGRPGYEHLNDPLHILIEAELPASVVD  218

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQA+EI+++LLKPVDESQDFYK+ QLRELAMLN   REE  Q+SGSVSPF ++  +K
Sbjct  219  VRLMQAQEIIQELLKPVDESQDFYKRQQLRELAMLNSNFREESPQLSGSVSPFTSN-EIK  277

Query  368  RAKT  357
            RAKT
Sbjct  278  RAKT  281



>gb|KHN18643.1| KH domain-containing protein [Glycine soja]
Length=283

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKD  KEE++RG+PGYEHLN+PLH+++EAELP  ++D
Sbjct  159  RGNSLKRVEATTGCRVFIRGKGSIKDLDKEELLRGRPGYEHLNDPLHILIEAELPASVVD  218

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQA+EI+++LLKPVDESQDFYK+ QLRELAMLN   REE  Q+SGSVSPF ++  +K
Sbjct  219  VRLMQAQEIIQELLKPVDESQDFYKRQQLRELAMLNSNFREESPQLSGSVSPFTSN-EIK  277

Query  368  RAKT  357
            RAKT
Sbjct  278  RAKT  281



>ref|XP_010908089.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Elaeis 
guineensis]
Length=293

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRGRGS+KD  KEE +R KPGYEHLNEPLHV+VEAE P +II+
Sbjct  169  RGNSLKRVENSTHCRVYIRGRGSVKDSAKEEKLRDKPGYEHLNEPLHVLVEAEFPADIIN  228

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA  ILEDLLKPVDES D+YKK QLRELA+LNGTLR+E   MS S SPF NS GMK
Sbjct  229  ARLNQAVAILEDLLKPVDESMDYYKKQQLRELAILNGTLRDESPHMSPSASPF-NSTGMK  287

Query  368  RAKT  357
            RAKT
Sbjct  288  RAKT  291



>ref|XP_006381264.1| hypothetical protein POPTR_0006s11210g [Populus trichocarpa]
 gb|ERP59061.1| hypothetical protein POPTR_0006s11210g [Populus trichocarpa]
Length=238

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  114  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  173

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  174  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  232

Query  368  RAKT  357
            RAKT
Sbjct  233  RAKT  236



>ref|XP_003552330.1| PREDICTED: KH domain-containing protein At2g38610-like [Glycine 
max]
Length=281

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EAELP  ++D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEAELPANVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELAMLN   REE    SGSVSPFN+S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>gb|KDO64189.1| hypothetical protein CISIN_1g023068mg [Citrus sinensis]
Length=167

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KE+ +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  43   RGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVD  102

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELAMLN   RE+    SGSVSPFN+S GMK
Sbjct  103  IRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSS-GMK  161

Query  368  RAKT  357
            RAKT
Sbjct  162  RAKT  165



>ref|XP_003616062.1| KH domain-containing protein [Medicago truncatula]
 gb|AES99020.1| RNA-binding KH domain protein [Medicago truncatula]
Length=244

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKD  KEE++RG+PG+EHLNEPLH+++EAELPV ++D
Sbjct  119  RGNSLKRVEATTGCRVFIRGKGSIKDFDKEELLRGRPGFEHLNEPLHILIEAELPVNVVD  178

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD YK+ QLRELAMLN + REE  Q+SGS+SPF ++  +K
Sbjct  179  LRLRQAQEIIEELLKPVDESQDIYKRQQLRELAMLNSSFREESPQLSGSLSPFTSNEMIK  238

Query  368  RAKT  357
            RAKT
Sbjct  239  RAKT  242



>ref|XP_002466215.1| hypothetical protein SORBIDRAFT_01g003680 [Sorghum bicolor]
 gb|EER93213.1| hypothetical protein SORBIDRAFT_01g003680 [Sorghum bicolor]
Length=279

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KE+ +RGKPGYEHL++PLH+++EAE P  IID
Sbjct  156  RGNSLKRVEASTGCRVFIRGKGSIKDPGKEDKLRGKPGYEHLSDPLHILIEAEFPASIID  215

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL  A+EI+E+LLKPVDESQDFYK+ QLRELAMLN TLRE+ S   GSVSPF+N  GMK
Sbjct  216  ARLRHAQEIIEELLKPVDESQDFYKRQQLRELAMLNSTLRED-SPHPGSVSPFSNG-GMK  273

Query  368  RAKT  357
            RAKT
Sbjct  274  RAKT  277



>ref|XP_004981292.1| PREDICTED: KH domain-containing protein SPIN1-like [Setaria italica]
Length=279

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KE+ +RGKPGYEHL++PLH+++EAE P  IID
Sbjct  156  RGNSLKRVEASTGCRVFIRGKGSIKDPGKEDKLRGKPGYEHLSDPLHILIEAEFPANIID  215

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL  A+EI+E+LLKPVDESQDFYK+ QLRELAMLN TLRE+ S   GSVSPF+N  GMK
Sbjct  216  ARLRHAQEIIEELLKPVDESQDFYKRQQLRELAMLNSTLRED-SPHPGSVSPFSNG-GMK  273

Query  368  RAKT  357
            RAKT
Sbjct  274  RAKT  277



>gb|AES99021.2| RNA-binding KH domain protein [Medicago truncatula]
Length=266

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKD  KEE++RG+PG+EHLNEPLH+++EAELPV ++D
Sbjct  141  RGNSLKRVEATTGCRVFIRGKGSIKDFDKEELLRGRPGFEHLNEPLHILIEAELPVNVVD  200

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD YK+ QLRELAMLN + REE  Q+SGS+SPF ++  +K
Sbjct  201  LRLRQAQEIIEELLKPVDESQDIYKRQQLRELAMLNSSFREESPQLSGSLSPFTSNEMIK  260

Query  368  RAKT  357
            RAKT
Sbjct  261  RAKT  264



>ref|XP_006381266.1| KH domain-containing family protein [Populus trichocarpa]
 gb|ERP59063.1| KH domain-containing family protein [Populus trichocarpa]
Length=281

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_011018951.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X2 [Populus euphratica]
Length=281

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>gb|KDP21840.1| hypothetical protein JCGZ_00627 [Jatropha curcas]
Length=281

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  217  MRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_009414641.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Musa 
acuminata subsp. malaccensis]
Length=295

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRGRGS+KD  KE+ +R KPGYEHLNEPLHV+VEAE   +IID
Sbjct  171  RGNSLKRVEATTQCRVYIRGRGSVKDSVKEDKLRDKPGYEHLNEPLHVLVEAEFTADIID  230

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL QA  ILEDLLKPVDES D+YKK QLRELA+LNGTLREE  Q+S S+SPF NS GMK
Sbjct  231  ARLNQAVAILEDLLKPVDESVDYYKKQQLRELAILNGTLREESPQLSPSLSPF-NSTGMK  289

Query  368  RAKT  357
            RAKT
Sbjct  290  RAKT  293



>ref|XP_011018950.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X1 [Populus euphratica]
Length=284

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  160  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  219

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  220  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  278

Query  368  RAKT  357
            RAKT
Sbjct  279  RAKT  282



>ref|NP_001051685.1| Os03g0815700 [Oryza sativa Japonica Group]
 sp|Q75GR5.1|SPIN1_ORYSJ RecName: Full=KH domain-containing protein SPIN1; AltName: Full=SPL11-interacting 
protein 1 [Oryza sativa Japonica Group]
 gb|AAR01750.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99540.1| KH domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13599.1| Os03g0815700 [Oryza sativa Japonica Group]
 dbj|BAG89507.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76407.1| hypothetical protein OsI_14057 [Oryza sativa Indica Group]
 gb|EEE60169.1| hypothetical protein OsJ_13097 [Oryza sativa Japonica Group]
Length=281

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 2/124 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KE+ +RGKPGYEHL++PLH+++EAE P  IID
Sbjct  158  RGNSLKRVEASTGCRVFIRGKGSIKDPGKEDKLRGKPGYEHLSDPLHILIEAEFPASIID  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL  A+E++E+LLKPVDESQDFYK+ QLRELAMLN TLRE+ S   GSVSPF+N  GMK
Sbjct  218  ARLRHAQEVIEELLKPVDESQDFYKRQQLRELAMLNSTLRED-SPHPGSVSPFSNG-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>gb|KHG17170.1| hypothetical protein F383_07324 [Gossypium arboreum]
Length=218

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  94   RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  153

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   RE+    SGSVSPFN+S GMK
Sbjct  154  TRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSS-GMK  212

Query  368  RAKT  357
            R KT
Sbjct  213  RPKT  216



>gb|ACJ84729.1| unknown [Medicago truncatula]
Length=281

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKD  KEE++RG+PG+EHLNEPLH+++EAELPV ++D
Sbjct  156  RGNSLKRVEATTGCRVFIRGKGSIKDFDKEELLRGRPGFEHLNEPLHILIEAELPVNVVD  215

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD YK+ QLRELAMLN + REE  Q+SGS+SPF ++  +K
Sbjct  216  LRLRQAQEIIEELLKPVDESQDIYKRQQLRELAMLNSSFREESPQLSGSLSPFTSNEMIK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_003616061.1| KH domain-containing protein [Medicago truncatula]
 gb|AES99019.1| RNA-binding KH domain protein [Medicago truncatula]
Length=281

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKD  KEE++RG+PG+EHLNEPLH+++EAELPV ++D
Sbjct  156  RGNSLKRVEATTGCRVFIRGKGSIKDFDKEELLRGRPGFEHLNEPLHILIEAELPVNVVD  215

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD YK+ QLRELAMLN + REE  Q+SGS+SPF ++  +K
Sbjct  216  LRLRQAQEIIEELLKPVDESQDIYKRQQLRELAMLNSSFREESPQLSGSLSPFTSNEMIK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_006650789.1| PREDICTED: KH domain-containing protein SPIN1-like [Oryza brachyantha]
Length=280

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KE+ +RGKPGYEHL++PLH+++EAE P  IID
Sbjct  157  RGNSLKRVEASTGCRVFIRGKGSIKDPGKEDKLRGKPGYEHLSDPLHILIEAEFPASIID  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL  A+E++E+LLKPVDESQDFYK+ QLRELA+LN TLRE+ S   GSVSPF+NS GMK
Sbjct  217  ARLRHAQEVIEELLKPVDESQDFYKRQQLRELAVLNSTLRED-SPHPGSVSPFSNS-GMK  274

Query  368  RAKT  357
            RAKT
Sbjct  275  RAKT  278



>ref|XP_003626662.1| KH domain-containing protein [Medicago truncatula]
Length=292

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  168  RGNSLKRVEATTGCRVFIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  227

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDES+DF K+ QLRELA+LN  LREE    SGSVSPFN+S GMK
Sbjct  228  MRLRQAQEIIEELLKPVDESEDFIKRQQLRELALLNSNLREESPGPSGSVSPFNSS-GMK  286

Query  368  RAKT  357
            RAKT
Sbjct  287  RAKT  290



>ref|XP_011095178.1| PREDICTED: KH domain-containing protein At2g38610 [Sesamum indicum]
Length=282

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHL+EPLH+++EA+LP  I+D
Sbjct  158  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLSEPLHILIEADLPANIVD  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  218  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  276

Query  368  RAKT  357
            RAKT
Sbjct  277  RAKT  280



>ref|XP_003626661.1| KH domain-containing protein [Medicago truncatula]
 gb|AET01137.1| RNA-binding KH domain protein [Medicago truncatula]
 gb|KEH17806.1| RNA-binding KH domain protein [Medicago truncatula]
 gb|KEH17809.1| RNA-binding KH domain protein [Medicago truncatula]
Length=276

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  152  RGNSLKRVEATTGCRVFIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  211

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDES+DF K+ QLRELA+LN  LREE    SGSVSPFN+S GMK
Sbjct  212  MRLRQAQEIIEELLKPVDESEDFIKRQQLRELALLNSNLREESPGPSGSVSPFNSS-GMK  270

Query  368  RAKT  357
            RAKT
Sbjct  271  RAKT  274



>ref|XP_006645141.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Oryza brachyantha]
Length=290

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRGRGS+KD  KE+ +R KPGYEHLNEPLHV+VEAE P +IID
Sbjct  164  RGNSLKRVEASTQCRVYIRGRGSVKDSVKEDKLRDKPGYEHLNEPLHVLVEAEFPADIID  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREE--GSQMSGSVSPFNNSLG  375
            ARL QA  ILEDLLKP+DES D+YKK QLRELA+LNGTLREE     +S SVSPF NS G
Sbjct  224  ARLNQAVTILEDLLKPIDESMDYYKKQQLRELAILNGTLREESPSPHLSPSVSPF-NSTG  282

Query  374  MKRAKT  357
            MKRAKT
Sbjct  283  MKRAKT  288



>ref|XP_007205691.1| hypothetical protein PRUPE_ppa009701mg [Prunus persica]
 ref|XP_008244492.1| PREDICTED: KH domain-containing protein At3g08620 [Prunus mume]
 gb|EMJ06890.1| hypothetical protein PRUPE_ppa009701mg [Prunus persica]
Length=281

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN   REE    SGSVSPFN+S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_009370879.1| PREDICTED: KH domain-containing protein At3g08620-like [Pyrus 
x bretschneideri]
Length=281

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPASVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN   REE    SGSVSPFN+S GMK
Sbjct  217  LRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_008355743.1| PREDICTED: KH domain-containing protein At3g08620 [Malus domestica]
Length=281

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPASVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN   REE    SGSVSPFN+S GMK
Sbjct  217  LRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_009337813.1| PREDICTED: KH domain-containing protein At3g08620 [Pyrus x bretschneideri]
Length=281

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN   REE    SGSVSPFN+S GMK
Sbjct  217  LRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_008359840.1| PREDICTED: KH domain-containing protein At3g08620-like [Malus 
domestica]
Length=281

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN   REE    SGSVSPFN+S GMK
Sbjct  217  LRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_002323686.2| KH domain-containing family protein [Populus trichocarpa]
 gb|EEF05447.2| KH domain-containing family protein [Populus trichocarpa]
Length=281

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE ++G+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLKGRPGYEHLNDPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_011006271.1| PREDICTED: KH domain-containing protein At2g38610 [Populus euphratica]
Length=281

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE ++G+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLKGRPGYEHLNDPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>gb|KHN40599.1| KH domain-containing protein [Glycine soja]
Length=333

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EAELP  ++D
Sbjct  209  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEAELPANVVD  268

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELAMLN   REE    SGSVSPFN+S GMK
Sbjct  269  IRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREESPGPSGSVSPFNSS-GMK  327

Query  368  RAKT  357
            RAKT
Sbjct  328  RAKT  331



>ref|XP_004492593.1| PREDICTED: KH domain-containing protein At2g38610-like [Cicer 
arietinum]
Length=281

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN   REE    SGSVSPFN+S GMK
Sbjct  217  MRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAK  360
            RAK
Sbjct  276  RAK  278



>ref|XP_007033461.1| RNA-binding KH domain-containing protein [Theobroma cacao]
 gb|EOY04387.1| RNA-binding KH domain-containing protein [Theobroma cacao]
Length=281

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN+S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            R KT
Sbjct  276  RPKT  279



>gb|KJB71497.1| hypothetical protein B456_011G125700 [Gossypium raimondii]
Length=249

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  125  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  184

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   RE+    SGSVSPFN+S GMK
Sbjct  185  TRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSS-GMK  243

Query  368  RAKT  357
            R KT
Sbjct  244  RPKT  247



>ref|XP_004955829.1| PREDICTED: KH domain-containing protein SPIN1-like [Setaria italica]
Length=281

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKD  KEE ++GKPGYEHLNEPLH+++EAELP  IID
Sbjct  158  RGNSLKRVEASTGCRVFIRGKGSIKDTEKEEKLKGKPGYEHLNEPLHILIEAELPANIID  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+E++E+LLKPVDESQDFYK+ QLRELAMLN TLRE+ S   GSVSPF+N  GMK
Sbjct  218  TRLRQAQEVMEELLKPVDESQDFYKRQQLRELAMLNSTLRED-SPHPGSVSPFSNG-GMK  275

Query  368  RAK  360
            RAK
Sbjct  276  RAK  278



>gb|KDO64187.1| hypothetical protein CISIN_1g023068mg [Citrus sinensis]
 gb|KDO64188.1| hypothetical protein CISIN_1g023068mg [Citrus sinensis]
Length=218

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KE+ +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  94   RGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVD  153

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELAMLN   RE+    SGSVSPFN+S GMK
Sbjct  154  IRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSS-GMK  212

Query  368  RAKT  357
            RAKT
Sbjct  213  RAKT  216



>ref|XP_003534621.1| PREDICTED: KH domain-containing protein At2g38610-like [Glycine 
max]
Length=281

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELA+LN   REE    SGSVSPFN+S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDYIKRQQLRELALLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>gb|KHG24418.1| hypothetical protein F383_31230 [Gossypium arboreum]
Length=281

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   RE+    SGSVSPFN+S GMK
Sbjct  217  TRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            R KT
Sbjct  276  RPKT  279



>ref|XP_009760263.1| PREDICTED: KH domain-containing protein At2g38610 [Nicotiana 
sylvestris]
Length=282

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  158  RGNSLKRVEATTGCRVFIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPASVVD  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN   REE    SGSVSPFN S GMK
Sbjct  218  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNTS-GMK  276

Query  368  RAKT  357
            R KT
Sbjct  277  RPKT  280



>gb|KJB71496.1| hypothetical protein B456_011G125700 [Gossypium raimondii]
Length=281

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   RE+    SGSVSPFN+S GMK
Sbjct  217  TRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            R KT
Sbjct  276  RPKT  279



>gb|KHG12649.1| hypothetical protein F383_20322 [Gossypium arboreum]
 gb|KJB61345.1| hypothetical protein B456_009G352600 [Gossypium raimondii]
 gb|KJB61346.1| hypothetical protein B456_009G352600 [Gossypium raimondii]
Length=281

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELAMLN   REE    SGSVSPFN+S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELAMLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            R KT
Sbjct  276  RPKT  279



>ref|XP_008463292.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X1 [Cucumis melo]
Length=282

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVEV+T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  158  RGNSLKRVEVTTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDES D+ K+ QLRELAMLN + REE     GSVSPFN+S GMK
Sbjct  218  IRLRQAQEIIEELLKPVDESHDYIKRQQLRELAMLNSSFREESPGPGGSVSPFNSS-GMK  276

Query  368  RAKT  357
            RAKT
Sbjct  277  RAKT  280



>ref|XP_009589069.1| PREDICTED: KH domain-containing protein At2g38610 [Nicotiana 
tomentosiformis]
Length=282

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  158  RGNSLKRVEATTGCRVFIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPASVVD  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN   REE    SGSVSPFN S GMK
Sbjct  218  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNTS-GMK  276

Query  368  RAKT  357
            R KT
Sbjct  277  RPKT  280



>ref|XP_006858588.1| hypothetical protein AMTR_s00071p00192730 [Amborella trichopoda]
 gb|ERN20055.1| hypothetical protein AMTR_s00071p00192730 [Amborella trichopoda]
Length=298

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRGRGS+KD  KEE +R KPGYEHLNE LHV+VEAELP  IID
Sbjct  174  RGNSLKRVEATTQCRVYIRGRGSVKDSVKEEKLRDKPGYEHLNEQLHVLVEAELPANIID  233

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            AR+ +A  ILEDLLKPVDES D+YKK QLRELA+LNGTLREE  +MS S+SPFN + GMK
Sbjct  234  ARMNEAVGILEDLLKPVDESLDYYKKQQLRELALLNGTLREESPRMSPSLSPFNTT-GMK  292

Query  368  RAKT  357
            RAKT
Sbjct  293  RAKT  296



>ref|XP_004142668.1| PREDICTED: KH domain-containing protein At2g38610-like [Cucumis 
sativus]
 ref|XP_004163826.1| PREDICTED: KH domain-containing protein At2g38610-like [Cucumis 
sativus]
 gb|KGN54470.1| hypothetical protein Csa_4G337270 [Cucumis sativus]
Length=281

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVEV+T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEVTTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDES D+ K+ QLRELAMLN + REE     GSVSPFN+S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESHDYIKRQQLRELAMLNSSFREESPGPGGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_008463293.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X2 [Cucumis melo]
Length=281

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVEV+T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEVTTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDES D+ K+ QLRELAMLN + REE     GSVSPFN+S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESHDYIKRQQLRELAMLNSSFREESPGPGGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_007134588.1| hypothetical protein PHAVU_010G059400g [Phaseolus vulgaris]
 gb|ESW06582.1| hypothetical protein PHAVU_010G059400g [Phaseolus vulgaris]
Length=281

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEASTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPV+ES+D+ K+ QLRELAMLN   REE    SGSVSPFN+S GMK
Sbjct  217  IRLRQAQEIIEELLKPVEESEDYIKRQQLRELAMLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|NP_001045029.1| Os01g0886300 [Oryza sativa Japonica Group]
 dbj|BAD82237.1| QUAKING isoform 5-like [Oryza sativa Japonica Group]
 dbj|BAD82121.1| QUAKING isoform 5-like [Oryza sativa Japonica Group]
 dbj|BAF06943.1| Os01g0886300 [Oryza sativa Japonica Group]
 gb|EAY76753.1| hypothetical protein OsI_04709 [Oryza sativa Indica Group]
 gb|EAZ14414.1| hypothetical protein OsJ_04338 [Oryza sativa Japonica Group]
 dbj|BAG89356.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 103/126 (82%), Gaps = 3/126 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRGRGS+KD  KE+ +R KPGYEHLNEPLHV+VEAE P +IID
Sbjct  164  RGNSLKRVEASTQCRVYIRGRGSVKDSVKEDKLRDKPGYEHLNEPLHVLVEAEFPADIID  223

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREE--GSQMSGSVSPFNNSLG  375
             RL QA  ILEDLLKP+DES D+YKK QLRELA+LNGTLREE     +S SVSPF NS G
Sbjct  224  TRLNQAVTILEDLLKPIDESMDYYKKQQLRELAILNGTLREESPSPHLSPSVSPF-NSTG  282

Query  374  MKRAKT  357
            MKRAKT
Sbjct  283  MKRAKT  288



>gb|EMT27361.1| KH domain-containing protein [Aegilops tauschii]
Length=242

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KE+ +RGKPGYEHL+E LH+++EAE P  IID
Sbjct  119  RGNSLKRVEASTGCRVFIRGKGSIKDPGKEDKLRGKPGYEHLSEQLHILIEAEFPANIID  178

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL  AREILE+LLKPVDE+QD YK+ QLRELAMLN TLRE+ S   GSVSPF+N  GMK
Sbjct  179  ARLRHAREILEELLKPVDETQDIYKRQQLRELAMLNSTLRED-SPHPGSVSPFSNG-GMK  236

Query  368  RAKT  357
            RAKT
Sbjct  237  RAKT  240



>ref|NP_001132735.1| hypothetical protein [Zea mays]
 gb|ACF81713.1| unknown [Zea mays]
 gb|AFW63658.1| hypothetical protein ZEAMMB73_233372 [Zea mays]
Length=123

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -1

Query  644  KEEVMRGKPGYEHLNEPLHVVVEAELPVEIIDARLMQAREILEDLLKPVDESQDFYKKHQ  465
            +EE+MRGKPGYEHLNEPLH++VEAELPV+IIDARLMQAREIL+DLLKPVDESQDF+KK Q
Sbjct  26   QEEMMRGKPGYEHLNEPLHILVEAELPVDIIDARLMQAREILQDLLKPVDESQDFFKKQQ  85

Query  464  LRELAMLNGTLREEGSQMSGSVSPFNNSLGMKRAKTRG  351
            LRELAMLNGTLREEG Q  GS SPF+NSLGMKRAKTRG
Sbjct  86   LRELAMLNGTLREEGMQRFGSASPFHNSLGMKRAKTRG  123



>gb|KDP45673.1| hypothetical protein JCGZ_17280 [Jatropha curcas]
Length=281

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHL++PLH+++E ELPV IID
Sbjct  157  RGNSLKRVEASTGCRVYIRGKGSIKDPEKEESLRGRPGYEHLSDPLHILIEGELPVNIID  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             +L QA+EI+E+LLKPVDESQD YK+ QLRELAMLN   REE  + SGS+SPF +S GMK
Sbjct  217  MQLRQAQEIIEELLKPVDESQDIYKRQQLRELAMLNSNYREESPRPSGSISPFTSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_010043877.1| PREDICTED: KH domain-containing protein At2g38610-like [Eucalyptus 
grandis]
 gb|KCW88420.1| hypothetical protein EUGRSUZ_A00807 [Eucalyptus grandis]
Length=279

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  155  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNDPLHILIEADLPANIVD  214

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELAMLN   RE+    SGS+SPFN+S GMK
Sbjct  215  LRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREDSPGPSGSISPFNSS-GMK  273

Query  368  RAKT  357
            RAKT
Sbjct  274  RAKT  277



>emb|CDP06370.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  158  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  218  IRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  276

Query  368  RAKT  357
            R KT
Sbjct  277  RPKT  280



>ref|XP_002268790.1| PREDICTED: KH domain-containing protein At2g38610 [Vitis vinifera]
 emb|CBI31159.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   184 bits (467),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KE+ +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  157  RGNSLKRVEATTGCRVYIRGKGSIKDPEKEDKLRGRPGYEHLNDPLHILIEADLPANIVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN   REE    SGSVSPFN S GMK
Sbjct  217  MRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNFREESPGPSGSVSPFNTS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_010683433.1| PREDICTED: KH domain-containing protein At3g08620-like [Beta 
vulgaris subsp. vulgaris]
Length=283

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA++   ++D
Sbjct  159  RGNSLKRVEASTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADMAPNMVD  218

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             +L QA+EILE+LLKPVDESQDFYK+ QLRELA+LN   RE+    SGSVSPFN S GMK
Sbjct  219  IKLHQAKEILEELLKPVDESQDFYKRQQLRELALLNSNFREDSPGPSGSVSPFNTS-GMK  277

Query  368  RAKT  357
            RAKT
Sbjct  278  RAKT  281



>ref|XP_004970832.1| PREDICTED: KH domain-containing protein At1g09660-like [Setaria 
italica]
Length=291

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 103/126 (82%), Gaps = 3/126 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRGRGS+KD  KE+ +R KPGYEHLNEPLHV+VEAE P +I+D
Sbjct  165  RGNSLKRVEASTQCRVYIRGRGSVKDSVKEDKLRDKPGYEHLNEPLHVLVEAEFPADIVD  224

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREE--GSQMSGSVSPFNNSLG  375
             RL QA  ILEDLLKP+DES D+YKK QLRELA+LNGTLREE     +S SVSPF NS G
Sbjct  225  GRLNQAVSILEDLLKPIDESMDYYKKQQLRELAILNGTLREESPSPHLSPSVSPF-NSTG  283

Query  374  MKRAKT  357
            MKRAKT
Sbjct  284  MKRAKT  289



>ref|XP_006591271.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X3 [Glycine max]
Length=236

 Score =   182 bits (463),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKD  KEE++RG+PGYEHLN+PLH+++EAELP  + D
Sbjct  112  RGNSLKRVEATTGCRVFIRGKGSIKDLDKEEMLRGRPGYEHLNDPLHIIIEAELPTSVAD  171

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RLMQA+EI+++LLKPVDESQD YK+ QLRELAMLN   REE  Q+SGSVSPF ++  +K
Sbjct  172  VRLMQAQEIIQELLKPVDESQDLYKRQQLRELAMLNSNFREESPQLSGSVSPFTSN-EIK  230

Query  368  RAKT  357
            R KT
Sbjct  231  RVKT  234



>gb|KHN29474.1| KH domain-containing protein [Glycine soja]
Length=353

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EAELP  ++D
Sbjct  229  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEAELPANVVD  288

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELA+LN   REE    SGSVSPFN+S GMK
Sbjct  289  IRLRQAQEIIEELLKPVDESQDYIKRQQLRELALLNSNFREESPGPSGSVSPFNSS-GMK  347

Query  368  RAKT  357
            RAKT
Sbjct  348  RAKT  351



>gb|AFK41392.1| unknown [Medicago truncatula]
Length=276

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  152  RGNSLKRVEATTGCRVFIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  211

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDES+DF K+ QLR LA+LN  LREE    SGSVSPFN+S GMK
Sbjct  212  MRLRQAQEIIEELLKPVDESEDFIKRQQLRGLALLNSNLREESPGPSGSVSPFNSS-GMK  270

Query  368  RAKT  357
            RAKT
Sbjct  271  RAKT  274



>ref|XP_004510090.1| PREDICTED: KH domain-containing protein At2g38610-like [Cicer 
arietinum]
Length=285

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  I++
Sbjct  161  RGNSLKRVEATTGCRVFIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHLLIEADLPANIVE  220

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQDF K+ QLRELA+LN  L EE    SGSVSPFN+S GMK
Sbjct  221  IRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNLGEESPGPSGSVSPFNSS-GMK  279

Query  368  RAKT  357
            RAKT
Sbjct  280  RAKT  283



>ref|XP_002456759.1| hypothetical protein SORBIDRAFT_03g042090 [Sorghum bicolor]
 gb|EES01879.1| hypothetical protein SORBIDRAFT_03g042090 [Sorghum bicolor]
Length=293

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRGRGS+KD  KE+ +R KPGYEHLNE LHV+VEAE PV+++D
Sbjct  167  RGNSLKRVEASTQCRVYIRGRGSVKDSVKEDKLRDKPGYEHLNEQLHVLVEAEFPVDMVD  226

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREE--GSQMSGSVSPFNNSLG  375
            ARL QA  ILEDLLKP+DES DFYKK QLRELA+LNGTLREE     +S SVSPF NS G
Sbjct  227  ARLNQAVSILEDLLKPIDESMDFYKKQQLRELAILNGTLREESPSPHLSPSVSPF-NSTG  285

Query  374  MKRAKT  357
            MKRAKT
Sbjct  286  MKRAKT  291



>ref|XP_006429644.1| hypothetical protein CICLE_v10012376mg [Citrus clementina]
 ref|XP_006481250.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Citrus sinensis]
 gb|ESR42884.1| hypothetical protein CICLE_v10012376mg [Citrus clementina]
 gb|KDO64185.1| hypothetical protein CISIN_1g023068mg [Citrus sinensis]
Length=283

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KE+ +RG+PGYEHLN+PLH+++EA+LP  I+D
Sbjct  159  RGNSLKRVEATTGCRVYIRGKGSIKDPDKEDKLRGRPGYEHLNDPLHILIEADLPANIVD  218

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELAMLN   RE+    SGSVSPFN+S GMK
Sbjct  219  IRLRQAQEIIEELLKPVDESQDYIKRQQLRELAMLNSNFREDSPGPSGSVSPFNSS-GMK  277

Query  368  RAKT  357
            RAKT
Sbjct  278  RAKT  281



>gb|ACU24211.1| unknown [Glycine max]
Length=281

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE  T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  157  RGNSLKRVEAITGCRVYIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPANVVD  216

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+ K+ QLRELA+LN   REE    SGSVSPFN+S GMK
Sbjct  217  IRLRQAQEIIEELLKPVDESQDYIKRQQLRELALLNSNFREESPGPSGSVSPFNSS-GMK  275

Query  368  RAKT  357
            RAKT
Sbjct  276  RAKT  279



>ref|XP_006657570.1| PREDICTED: KH domain-containing protein SPIN1-like [Oryza brachyantha]
Length=282

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKD  KEE ++GKPGYEHLN+PLH+++EAELP  IID
Sbjct  159  RGNSLKRVEASTGCRVFIRGKGSIKDADKEEKLKGKPGYEHLNDPLHILIEAELPANIID  218

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDESQD+YK+ QLRELAMLN TLRE+ S   GSVSPF+N  GMK
Sbjct  219  TRLRQAQEIMEELLKPVDESQDYYKRQQLRELAMLNSTLRED-SPHPGSVSPFSNG-GMK  276

Query  368  RAK  360
            RAK
Sbjct  277  RAK  279



>ref|NP_001130116.1| uncharacterized protein LOC100191210 [Zea mays]
 gb|ACF78251.1| unknown [Zea mays]
 gb|AFW67206.1| nucleic acid binding protein [Zea mays]
Length=279

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG GSIKDP KE+ +RGKPGYEHL++PLH+++EAE P  IID
Sbjct  156  RGNSLKRVEASTGCRVFIRGNGSIKDPGKEDKLRGKPGYEHLSDPLHILIEAEFPASIID  215

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL  A+EI+E+LLKPVDES DFYK+ QLRELA+LN TLRE+ S   GSVSPF+N  GMK
Sbjct  216  ARLRHAQEIIEELLKPVDESHDFYKRQQLRELALLNSTLRED-SPHPGSVSPFSNG-GMK  273

Query  368  RAKT  357
            RAKT
Sbjct  274  RAKT  277



>gb|EMS59864.1| KH domain-containing protein SPIN1 [Triticum urartu]
Length=242

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE ST CRV IRG+GSIKDP KE+ +RGKPGYEHL+E LH+++EAE P  IID
Sbjct  119  RGNSLKRVEASTGCRVFIRGKGSIKDPGKEDKLRGKPGYEHLSEQLHILIEAEFPANIID  178

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
            ARL  A+EILE+LLKPVDE+QD YK+ QLRELAMLN TLRE+ S   GSVSPF+N  GMK
Sbjct  179  ARLRHAQEILEELLKPVDETQDIYKRQQLRELAMLNSTLRED-SPHPGSVSPFSNG-GMK  236

Query  368  RAKT  357
            RAKT
Sbjct  237  RAKT  240



>ref|XP_004246970.1| PREDICTED: KH domain-containing protein At2g38610-like [Solanum 
lycopersicum]
Length=282

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = -1

Query  728  RGNSLKRVEVSTDCRVLIRGRGSIKDPTKEEVMRGKPGYEHLNEPLHVVVEAELPVEIID  549
            RGNSLKRVE +T CRV IRG+GSIKDP KEE +RG+PGYEHLNEPLH+++EA+LP  ++D
Sbjct  158  RGNSLKRVEATTGCRVFIRGKGSIKDPDKEEKLRGRPGYEHLNEPLHILIEADLPASVVD  217

Query  548  ARLMQAREILEDLLKPVDESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMK  369
             RL QA+EI+E+LLKPVDES+D+ K+ QLRELAMLN   REE    SGSVSPFN S GMK
Sbjct  218  IRLRQAQEIIEELLKPVDESEDYIKRQQLRELAMLNSNFREESPGPSGSVSPFNTS-GMK  276

Query  368  RAKT  357
            R KT
Sbjct  277  RPKT  280



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455