BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020H03

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011095452.1|  PREDICTED: EH domain-containing protein 1-like     449   5e-153   Sesamum indicum [beniseed]
ref|XP_010270065.1|  PREDICTED: EH domain-containing protein 1          444   4e-151   Nelumbo nucifera [Indian lotus]
gb|EYU27376.1|  hypothetical protein MIMGU_mgv1a004087mg                444   5e-151   Erythranthe guttata [common monkey flower]
ref|XP_010063047.1|  PREDICTED: EH domain-containing protein 1          443   1e-150   Eucalyptus grandis [rose gum]
ref|XP_009603511.1|  PREDICTED: EH domain-containing protein 1-li...    440   3e-150   Nicotiana tomentosiformis
ref|XP_006452453.1|  hypothetical protein CICLE_v10007883mg             438   5e-150   
gb|KDP39189.1|  hypothetical protein JCGZ_00946                         442   5e-150   Jatropha curcas
ref|XP_006829517.1|  hypothetical protein AMTR_s00074p00139810          441   1e-149   Amborella trichopoda
emb|CDP13787.1|  unnamed protein product                                441   1e-149   Coffea canephora [robusta coffee]
gb|KDO62119.1|  hypothetical protein CISIN_1g009050mg                   441   2e-149   Citrus sinensis [apfelsine]
gb|KCW70227.1|  hypothetical protein EUGRSUZ_F03500                     443   2e-149   Eucalyptus grandis [rose gum]
ref|XP_009393691.1|  PREDICTED: EH domain-containing protein 1-like     441   2e-149   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009603507.1|  PREDICTED: EH domain-containing protein 1-li...    439   5e-149   Nicotiana tomentosiformis
ref|XP_004149345.1|  PREDICTED: EH domain-containing protein 1-like     439   5e-149   Cucumis sativus [cucumbers]
ref|XP_006475006.1|  PREDICTED: EH domain-containing protein 3-like     439   6e-149   Citrus sinensis [apfelsine]
ref|XP_002277794.1|  PREDICTED: EH domain-containing protein 1          439   8e-149   Vitis vinifera
ref|XP_008449138.1|  PREDICTED: EH domain-containing protein 1          439   1e-148   Cucumis melo [Oriental melon]
ref|XP_010096102.1|  EH domain-containing protein 1                     438   1e-148   
ref|XP_009589164.1|  PREDICTED: EH domain-containing protein 1-li...    436   1e-148   Nicotiana tomentosiformis
ref|XP_010913401.1|  PREDICTED: EH domain-containing protein 1-like     438   2e-148   Elaeis guineensis
emb|CAN67909.1|  hypothetical protein VITISV_034695                     438   2e-148   Vitis vinifera
ref|XP_011046717.1|  PREDICTED: EH domain-containing protein 3          437   3e-148   Populus euphratica
ref|XP_006452452.1|  hypothetical protein CICLE_v10007883mg             438   4e-148   
ref|XP_009779286.1|  PREDICTED: EH domain-containing protein 1-li...    433   5e-148   Nicotiana sylvestris
ref|XP_004966283.1|  PREDICTED: EH domain-containing protein 1-like     437   5e-148   Setaria italica
ref|XP_009770779.1|  PREDICTED: EH domain-containing protein 1-li...    434   5e-148   Nicotiana sylvestris
ref|XP_009779284.1|  PREDICTED: EH domain-containing protein 1-li...    434   6e-148   Nicotiana sylvestris
ref|XP_009770780.1|  PREDICTED: EH domain-containing protein 1-li...    432   7e-148   Nicotiana sylvestris
ref|XP_008644157.1|  PREDICTED: uncharacterized protein LOC100384...    436   7e-148   
ref|XP_007020711.1|  EPS15 domain 1                                     436   8e-148   
gb|KHG22957.1|  EH domain-containing 1                                  433   1e-147   Gossypium arboreum [tree cotton]
ref|XP_010252586.1|  PREDICTED: EH domain-containing protein 1-li...    432   1e-147   Nelumbo nucifera [Indian lotus]
ref|XP_002437485.1|  hypothetical protein SORBIDRAFT_10g027960          436   1e-147   Sorghum bicolor [broomcorn]
ref|XP_009589162.1|  PREDICTED: EH domain-containing protein 1-li...    435   2e-147   Nicotiana tomentosiformis
ref|XP_008805595.1|  PREDICTED: EH domain-containing protein 1-li...    435   2e-147   Phoenix dactylifera
ref|XP_009770782.1|  PREDICTED: EH domain-containing protein 1-li...    435   2e-147   Nicotiana sylvestris
ref|XP_008805596.1|  PREDICTED: EH domain-containing protein 1-li...    436   2e-147   Phoenix dactylifera
ref|XP_008805597.1|  PREDICTED: EH domain-containing protein 1-li...    435   2e-147   
ref|XP_010090952.1|  EH domain-containing protein 1                     434   3e-147   
ref|XP_009776641.1|  PREDICTED: EH domain-containing protein 1 is...    432   3e-147   Nicotiana sylvestris
ref|XP_009598340.1|  PREDICTED: EH domain-containing protein 1-li...    432   3e-147   Nicotiana tomentosiformis
ref|XP_009770776.1|  PREDICTED: EH domain-containing protein 1-li...    434   5e-147   Nicotiana sylvestris
ref|XP_002885363.1|  calcium-binding EF hand family protein             434   6e-147   
ref|XP_009779278.1|  PREDICTED: EH domain-containing protein 1-li...    434   7e-147   Nicotiana sylvestris
ref|NP_001058410.1|  Os06g0687800                                       434   8e-147   
ref|XP_006646902.1|  PREDICTED: EH domain-containing protein 1-like     434   8e-147   Oryza brachyantha
dbj|BAB02809.1|  unnamed protein product                                433   1e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252585.1|  PREDICTED: EH domain-containing protein 1-li...    433   1e-146   Nelumbo nucifera [Indian lotus]
ref|XP_002264320.1|  PREDICTED: EH domain-containing protein 3-like     433   1e-146   Vitis vinifera
ref|NP_566657.1|  EPS15 homology domain 1 protein                       433   2e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406402.1|  hypothetical protein EUTSA_v10020459mg             429   2e-146   
ref|XP_003563453.1|  PREDICTED: EH domain-containing protein 1-like     433   2e-146   Brachypodium distachyon [annual false brome]
gb|EAZ02155.1|  hypothetical protein OsI_24244                          433   2e-146   Oryza sativa Indica Group [Indian rice]
ref|XP_009348303.1|  PREDICTED: EH domain-containing protein 1-like     433   2e-146   Pyrus x bretschneideri [bai li]
ref|XP_009334157.1|  PREDICTED: EH domain-containing protein 1-like     433   2e-146   Pyrus x bretschneideri [bai li]
ref|NP_001045954.1|  Os02g0158100                                       432   2e-146   
ref|XP_008359253.1|  PREDICTED: EH domain-containing protein 1-like     432   3e-146   
ref|XP_010313928.1|  PREDICTED: EH domain-containing protein 3-like     432   3e-146   Solanum lycopersicum
ref|XP_006344871.1|  PREDICTED: EH domain-containing protein 1-like     432   3e-146   Solanum tuberosum [potatoes]
emb|CBI35707.3|  unnamed protein product                                433   4e-146   Vitis vinifera
gb|KJB13767.1|  hypothetical protein B456_002G093200                    431   4e-146   Gossypium raimondii
ref|XP_009598337.1|  PREDICTED: EH domain-containing protein 1-li...    432   4e-146   Nicotiana tomentosiformis
ref|XP_009776638.1|  PREDICTED: EH domain-containing protein 1 is...    432   4e-146   Nicotiana sylvestris
dbj|BAJ95881.1|  predicted protein                                      432   5e-146   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009776639.1|  PREDICTED: EH domain-containing protein 1 is...    432   5e-146   Nicotiana sylvestris
ref|XP_009598338.1|  PREDICTED: EH domain-containing protein 1-li...    432   5e-146   Nicotiana tomentosiformis
gb|KJB13765.1|  hypothetical protein B456_002G093200                    432   5e-146   Gossypium raimondii
ref|XP_008226997.1|  PREDICTED: EH domain-containing protein 1          432   6e-146   Prunus mume [ume]
ref|XP_006296699.1|  hypothetical protein CARUB_v10013398mg             432   6e-146   Capsella rubella
ref|XP_007213895.1|  hypothetical protein PRUPE_ppa003834mg             431   6e-146   Prunus persica
gb|KJB13766.1|  hypothetical protein B456_002G093200                    431   7e-146   Gossypium raimondii
ref|XP_006352528.1|  PREDICTED: EH domain-containing protein 1-li...    431   9e-146   
ref|XP_002453335.1|  hypothetical protein SORBIDRAFT_04g004020          431   1e-145   Sorghum bicolor [broomcorn]
ref|XP_006352527.1|  PREDICTED: EH domain-containing protein 1-li...    431   1e-145   
ref|XP_010508763.1|  PREDICTED: EH domain-containing protein 1-like     431   1e-145   Camelina sativa [gold-of-pleasure]
ref|XP_006657273.1|  PREDICTED: EH domain-containing protein 1-like     430   2e-145   Oryza brachyantha
ref|XP_004951833.1|  PREDICTED: EH domain-containing protein 1-like     432   2e-145   Setaria italica
ref|XP_003574764.1|  PREDICTED: EH domain-containing protein 1-like     430   3e-145   Brachypodium distachyon [annual false brome]
ref|XP_006406401.1|  hypothetical protein EUTSA_v10020459mg             430   3e-145   Eutrema salsugineum [saltwater cress]
ref|XP_008458980.1|  PREDICTED: EH domain-containing protein 1          429   4e-145   Cucumis melo [Oriental melon]
ref|XP_004157728.1|  PREDICTED: EH domain-containing protein 1-like     429   5e-145   
gb|KGN56098.1|  hypothetical protein Csa_3G073890                       430   5e-145   Cucumis sativus [cucumbers]
ref|XP_010324305.1|  PREDICTED: EH domain-containing protein 1-li...    429   6e-145   Solanum lycopersicum
ref|XP_004145425.1|  PREDICTED: EH domain-containing protein 1-like     429   6e-145   
ref|XP_010324304.1|  PREDICTED: EH domain-containing protein 1-li...    429   6e-145   Solanum lycopersicum
ref|XP_006346193.1|  PREDICTED: EH domain-containing protein 1-like     429   1e-144   Solanum tuberosum [potatoes]
ref|XP_010544277.1|  PREDICTED: EH domain-containing protein 1          428   1e-144   Tarenaya hassleriana [spider flower]
gb|EMT05303.1|  EH domain-containing protein 1                          428   1e-144   
gb|EMS68080.1|  EH domain-containing protein 1                          428   2e-144   Triticum urartu
emb|CDY50093.1|  BnaC01g32680D                                          427   2e-144   Brassica napus [oilseed rape]
ref|XP_002531194.1|  EH-domain-containing protein, putative             427   2e-144   Ricinus communis
ref|XP_004294399.1|  PREDICTED: EH domain-containing protein 1 is...    427   3e-144   Fragaria vesca subsp. vesca
ref|XP_009111206.1|  PREDICTED: EH domain-containing protein 1-li...    425   3e-144   Brassica rapa
emb|CDY50090.1|  BnaC01g32650D                                          428   3e-144   Brassica napus [oilseed rape]
ref|XP_011461076.1|  PREDICTED: EH domain-containing protein 1 is...    427   3e-144   Fragaria vesca subsp. vesca
gb|EMT01492.1|  EH domain-containing protein 1                          427   3e-144   
ref|XP_010422242.1|  PREDICTED: EH domain-containing protein 1-like     423   3e-144   
ref|XP_010665753.1|  PREDICTED: EH domain-containing protein 1-like     426   6e-144   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001140588.1|  uncharacterized protein LOC100272658               427   6e-144   Zea mays [maize]
gb|KHN38249.1|  EH domain-containing protein 1                          426   6e-144   Glycine soja [wild soybean]
ref|XP_003519595.1|  PREDICTED: EH domain-containing protein 1-like     426   8e-144   Glycine max [soybeans]
ref|XP_010052899.1|  PREDICTED: EH domain-containing protein 1-li...    426   1e-143   Eucalyptus grandis [rose gum]
ref|XP_006287437.1|  hypothetical protein CARUB_v10000641mg             426   1e-143   Capsella rubella
dbj|BAJ86819.1|  predicted protein                                      426   1e-143   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008224739.1|  PREDICTED: EH domain-containing protein 1-like     425   1e-143   Prunus mume [ume]
ref|NP_001266688.1|  EH-domain-containing protein 1                     425   2e-143   
ref|XP_010327191.1|  PREDICTED: EH domain-containing protein 1-like     425   3e-143   
ref|XP_003529656.1|  PREDICTED: EH domain-containing protein 1-like     425   3e-143   Glycine max [soybeans]
ref|XP_009361045.1|  PREDICTED: EH domain-containing protein 1-like     425   3e-143   Pyrus x bretschneideri [bai li]
ref|XP_009111201.1|  PREDICTED: EH domain-containing protein 1-li...    425   3e-143   Brassica rapa
ref|XP_007142331.1|  hypothetical protein PHAVU_008G271300g             424   4e-143   Phaseolus vulgaris [French bean]
ref|XP_010455719.1|  PREDICTED: EH domain-containing protein 1-li...    424   5e-143   Camelina sativa [gold-of-pleasure]
ref|XP_010455720.1|  PREDICTED: EH domain-containing protein 1-li...    424   5e-143   Camelina sativa [gold-of-pleasure]
ref|XP_011097835.1|  PREDICTED: EH domain-containing protein 1-li...    424   6e-143   Sesamum indicum [beniseed]
ref|XP_011097837.1|  PREDICTED: EH domain-containing protein 1-li...    424   6e-143   
ref|XP_009357511.1|  PREDICTED: EH domain-containing protein 1-li...    422   6e-143   Pyrus x bretschneideri [bai li]
ref|XP_008799457.1|  PREDICTED: EH domain-containing protein 1-like     424   6e-143   Phoenix dactylifera
ref|XP_007211540.1|  hypothetical protein PRUPE_ppa003972mg             424   7e-143   Prunus persica
gb|EYU33672.1|  hypothetical protein MIMGU_mgv1a004199mg                423   9e-143   Erythranthe guttata [common monkey flower]
gb|KDP20684.1|  hypothetical protein JCGZ_21155                         424   9e-143   Jatropha curcas
ref|XP_002874791.1|  calcium-binding EF hand family protein             423   9e-143   Arabidopsis lyrata subsp. lyrata
ref|XP_010928404.1|  PREDICTED: EH domain-containing protein 1-like     423   1e-142   Elaeis guineensis
ref|XP_010433120.1|  PREDICTED: EH domain-containing protein 1-li...    423   1e-142   Camelina sativa [gold-of-pleasure]
ref|XP_010433113.1|  PREDICTED: EH domain-containing protein 1-li...    423   1e-142   Camelina sativa [gold-of-pleasure]
ref|XP_003617631.1|  EH-domain-containing protein                       423   1e-142   Medicago truncatula
ref|XP_007026226.1|  EPS15 domain 2 isoform 2                           423   2e-142   
ref|XP_003550477.1|  PREDICTED: EH domain-containing protein 1-like     423   2e-142   Glycine max [soybeans]
ref|NP_567299.2|  EPS15 homology domain 2 protein                       423   2e-142   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974517.1|  EPS15 homology domain 2 protein                       423   2e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007026225.1|  EPS15 domain 2 isoform 1                           422   2e-142   
ref|XP_007026228.1|  EPS15 domain 2 isoform 4                           422   2e-142   
ref|XP_007154000.1|  hypothetical protein PHAVU_003G082600g             422   3e-142   Phaseolus vulgaris [French bean]
ref|XP_008384122.1|  PREDICTED: EH domain-containing protein 1-like     422   3e-142   
ref|XP_004491428.1|  PREDICTED: EH domain-containing protein 3-like     422   3e-142   Cicer arietinum [garbanzo]
ref|XP_009357509.1|  PREDICTED: EH domain-containing protein 1-li...    422   4e-142   Pyrus x bretschneideri [bai li]
gb|KHN03510.1|  EH domain-containing protein 1                          422   4e-142   Glycine soja [wild soybean]
emb|CDY29816.1|  BnaC05g31740D                                          421   4e-142   Brassica napus [oilseed rape]
gb|EPS68571.1|  hypothetical protein M569_06192                         422   4e-142   Genlisea aurea
ref|XP_010466211.1|  PREDICTED: EH domain-containing protein 1-like     422   5e-142   Camelina sativa [gold-of-pleasure]
gb|AFK42442.1|  unknown                                                 421   1e-141   Medicago truncatula
ref|XP_004486203.1|  PREDICTED: EH domain-containing protein 1-like     419   3e-141   Cicer arietinum [garbanzo]
gb|KFK39351.1|  hypothetical protein AALP_AA3G233100                    419   3e-141   Arabis alpina [alpine rockcress]
emb|CDY25408.1|  BnaA05g18760D                                          418   5e-141   Brassica napus [oilseed rape]
ref|XP_006396726.1|  hypothetical protein EUTSA_v10028561mg             418   9e-141   Eutrema salsugineum [saltwater cress]
gb|KHN28769.1|  EH domain-containing protein 1                          426   2e-140   Glycine soja [wild soybean]
ref|XP_009145649.1|  PREDICTED: EH domain-containing protein 1 is...    417   2e-140   
ref|XP_009145651.1|  PREDICTED: EH domain-containing protein 1 is...    417   2e-140   
ref|XP_011000650.1|  PREDICTED: EH domain-containing protein 1-like     417   2e-140   Populus euphratica
ref|XP_009145648.1|  PREDICTED: EH domain-containing protein 1 is...    417   2e-140   Brassica rapa
ref|XP_002316591.2|  calcium-binding EF hand family protein             417   2e-140   
ref|XP_009145650.1|  PREDICTED: EH domain-containing protein 1 is...    417   2e-140   Brassica rapa
ref|XP_002518408.1|  EH-domain-containing protein, putative             417   2e-140   Ricinus communis
ref|XP_010538746.1|  PREDICTED: EH domain-containing protein 1 is...    417   3e-140   Tarenaya hassleriana [spider flower]
ref|XP_010538744.1|  PREDICTED: EH domain-containing protein 1 is...    417   3e-140   Tarenaya hassleriana [spider flower]
emb|CDX94536.1|  BnaC09g23000D                                          417   4e-140   
ref|XP_009390978.1|  PREDICTED: EH domain-containing protein 1-li...    417   4e-140   
ref|XP_004293342.1|  PREDICTED: EH domain-containing protein 1-like     417   4e-140   Fragaria vesca subsp. vesca
gb|KDO78396.1|  hypothetical protein CISIN_1g008954mg                   417   4e-140   Citrus sinensis [apfelsine]
ref|XP_009114592.1|  PREDICTED: EH domain-containing protein 1 is...    417   4e-140   Brassica rapa
ref|XP_009114593.1|  PREDICTED: EH domain-containing protein 1 is...    417   5e-140   
ref|XP_009390977.1|  PREDICTED: EH domain-containing protein 1-li...    417   5e-140   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390979.1|  PREDICTED: EH domain-containing protein 1-li...    416   5e-140   
emb|CDY16689.1|  BnaA09g20670D                                          416   5e-140   Brassica napus [oilseed rape]
gb|KFK32206.1|  hypothetical protein AALP_AA6G211000                    416   8e-140   Arabis alpina [alpine rockcress]
ref|XP_004507655.1|  PREDICTED: EH domain-containing protein 1-li...    416   8e-140   Cicer arietinum [garbanzo]
ref|XP_003594167.1|  EH-domain-containing protein                       416   1e-139   Medicago truncatula
ref|XP_003610495.1|  EH-domain-containing protein                       416   1e-139   Medicago truncatula
ref|XP_006467361.1|  PREDICTED: EH domain-containing protein 1-like     415   2e-139   Citrus sinensis [apfelsine]
ref|XP_006449830.1|  hypothetical protein CICLE_v10014814mg             415   3e-139   Citrus clementina [clementine]
ref|XP_003547274.1|  PREDICTED: EH domain-containing protein 1-like     414   4e-139   Glycine max [soybeans]
ref|XP_009776640.1|  PREDICTED: EH domain-containing protein 1 is...    414   4e-139   Nicotiana sylvestris
ref|XP_007147670.1|  hypothetical protein PHAVU_006G144500g             414   5e-139   Phaseolus vulgaris [French bean]
ref|XP_009598339.1|  PREDICTED: EH domain-containing protein 1-li...    414   5e-139   Nicotiana tomentosiformis
ref|XP_009401415.1|  PREDICTED: EH domain-containing protein 1-like     414   6e-139   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP04464.1|  unnamed protein product                                415   7e-139   Coffea canephora [robusta coffee]
ref|XP_001772546.1|  predicted protein                                  411   6e-138   
gb|AEV41063.1|  putative EH-domain-containing protein 1                 410   9e-138   Oryza minuta
gb|AEV41109.1|  putative EH-domain-containing protein 1                 410   9e-138   Oryza officinalis
ref|XP_010675784.1|  PREDICTED: EH domain-containing protein 1-like     410   1e-137   Beta vulgaris subsp. vulgaris [field beet]
gb|AEV40966.1|  putative EH-domain-containing protein 1                 409   2e-137   Oryza punctata
ref|XP_004500109.1|  PREDICTED: EH domain-containing protein 1-like     409   3e-137   Cicer arietinum [garbanzo]
gb|KHN40844.1|  EH domain-containing protein 1                          409   3e-137   Glycine soja [wild soybean]
ref|XP_006586764.1|  PREDICTED: EH domain-containing protein 1-like     409   3e-137   Glycine max [soybeans]
ref|XP_002447292.1|  hypothetical protein SORBIDRAFT_06g032210          409   6e-137   Sorghum bicolor [broomcorn]
tpg|DAA35457.1|  TPA: hypothetical protein ZEAMMB73_021494              408   8e-137   
ref|NP_001167939.1|  uncharacterized protein LOC100381653               408   1e-136   Zea mays [maize]
ref|XP_001784382.1|  predicted protein                                  407   1e-136   
ref|XP_007026227.1|  EPS15 domain 2 isoform 3                           409   1e-136   
gb|AEV41016.1|  putative EH-domain-containing protein 1                 407   2e-136   Oryza minuta
ref|XP_006602183.1|  PREDICTED: EH domain-containing protein 1-like     406   4e-136   Glycine max [soybeans]
gb|AIE88276.1|  hypothetical protein OG_BBa0063K01.7                    404   4e-136   Oryza glaberrima
ref|XP_002985283.1|  hypothetical protein SELMODRAFT_121714             406   1e-135   
ref|XP_002970092.1|  hypothetical protein SELMODRAFT_92582              405   1e-135   Selaginella moellendorffii
gb|KHG01502.1|  EH domain-containing 1                                  403   1e-135   Gossypium arboreum [tree cotton]
ref|NP_001054202.1|  Os04g0669300                                       405   1e-135   
ref|XP_011096032.1|  PREDICTED: EH domain-containing protein 1-like     405   2e-135   
ref|XP_006652990.1|  PREDICTED: EH domain-containing protein 1-like     404   3e-135   Oryza brachyantha
gb|KJB45560.1|  hypothetical protein B456_007G312100                    402   9e-135   Gossypium raimondii
gb|KEH33921.1|  EPS15-like domain protein                               402   3e-134   Medicago truncatula
ref|XP_004507654.1|  PREDICTED: EH domain-containing protein 1-li...    402   4e-134   
ref|XP_009334827.1|  PREDICTED: EH domain-containing protein 1-li...    401   5e-134   Pyrus x bretschneideri [bai li]
ref|XP_009334826.1|  PREDICTED: EH domain-containing protein 1-li...    402   9e-134   Pyrus x bretschneideri [bai li]
ref|XP_009334825.1|  PREDICTED: EH domain-containing protein 1-li...    402   1e-133   Pyrus x bretschneideri [bai li]
ref|XP_008370549.1|  PREDICTED: EH domain-containing protein 1-like     394   5e-132   
ref|XP_009398680.1|  PREDICTED: EH domain-containing protein 1-like     395   6e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675794.1|  PREDICTED: EH domain-containing protein 1-like     392   1e-131   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010487999.1|  PREDICTED: EH domain-containing protein 1-like     395   1e-131   Camelina sativa [gold-of-pleasure]
ref|XP_009352442.1|  PREDICTED: EH domain-containing protein 1-like     395   1e-131   Pyrus x bretschneideri [bai li]
ref|XP_003579456.1|  PREDICTED: EH domain-containing protein 1-like     392   3e-130   
gb|KHG30640.1|  EH domain-containing 1                                  390   8e-130   Gossypium arboreum [tree cotton]
ref|XP_007145728.1|  hypothetical protein PHAVU_007G262900g             389   1e-129   Phaseolus vulgaris [French bean]
gb|EYU27756.1|  hypothetical protein MIMGU_mgv1a004743mg                388   2e-129   Erythranthe guttata [common monkey flower]
ref|XP_009626939.1|  PREDICTED: EH domain-containing protein 1-like     389   2e-129   Nicotiana tomentosiformis
gb|KJB69208.1|  hypothetical protein B456_011G010900                    389   3e-129   Gossypium raimondii
gb|KJB69209.1|  hypothetical protein B456_011G010900                    389   4e-129   Gossypium raimondii
ref|XP_009769722.1|  PREDICTED: EH domain-containing protein 1-like     387   1e-128   Nicotiana sylvestris
gb|KEH33927.1|  calcium-binding EF hand protein                         382   4e-128   Medicago truncatula
emb|CAJ86083.1|  H0818H01.5                                             386   5e-128   Oryza sativa [red rice]
ref|XP_004250246.1|  PREDICTED: EH domain-containing protein 1-like     382   1e-126   Solanum lycopersicum
ref|XP_007145730.1|  hypothetical protein PHAVU_007G263100g             381   3e-126   Phaseolus vulgaris [French bean]
ref|XP_006352380.1|  PREDICTED: EH domain-containing protein 1-like     381   3e-126   Solanum tuberosum [potatoes]
ref|XP_002985697.1|  hypothetical protein SELMODRAFT_122705             379   4e-125   
ref|XP_002974220.1|  hypothetical protein SELMODRAFT_414547             377   2e-124   Selaginella moellendorffii
emb|CDO98110.1|  unnamed protein product                                366   1e-120   Coffea canephora [robusta coffee]
gb|KCW77036.1|  hypothetical protein EUGRSUZ_D01382                     361   2e-119   Eucalyptus grandis [rose gum]
ref|XP_010054613.1|  PREDICTED: EH domain-containing protein 1-like     361   1e-118   
ref|XP_002298819.2|  hypothetical protein POPTR_0001s36630g             358   7e-118   
ref|NP_001170407.1|  uncharacterized protein LOC100384394               337   5e-114   
ref|XP_007026229.1|  EPS15 domain 2 isoform 5                           348   9e-114   
ref|XP_009779289.1|  PREDICTED: EH domain-containing protein 1-like     335   2e-113   Nicotiana sylvestris
ref|XP_010042271.1|  PREDICTED: EH domain-containing protein 1-like     333   1e-110   Eucalyptus grandis [rose gum]
gb|EMT24958.1|  EH domain-containing protein 1                          338   2e-110   
ref|XP_005643284.1|  hypothetical protein COCSUDRAFT_38543              324   5e-104   Coccomyxa subellipsoidea C-169
gb|ABR16762.1|  unknown                                                 311   6e-104   Picea sitchensis
ref|XP_009402015.1|  PREDICTED: EH domain-containing protein 1-like     310   8e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD48968.1|AF147263_10  contains similarity to Pfam family PF0...    305   7e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002978188.1|  hypothetical protein SELMODRAFT_108442             298   8e-96    
ref|XP_002966377.1|  hypothetical protein SELMODRAFT_85478              298   1e-95    
gb|KDD73486.1|  hypothetical protein H632_c2126p0                       280   9e-89    Helicosporidium sp. ATCC 50920
gb|KIZ06387.1|  EH domain-containing protein 4                          284   1e-88    Monoraphidium neglectum
ref|XP_002499973.1|  predicted protein                                  280   3e-88    Micromonas commoda
ref|XP_011402336.1|  EH domain-containing protein 1                     285   4e-88    Auxenochlorella protothecoides
ref|XP_004365433.1|  hypothetical protein CAOG_00562                    278   2e-86    Capsaspora owczarzaki ATCC 30864
ref|XP_003055188.1|  predicted protein                                  274   9e-85    Micromonas pusilla CCMP1545
gb|ABI13180.1|  hypothetical protein                                    265   1e-82    Emiliania huxleyi
gb|KFQ44554.1|  EH domain-containing protein 4                          263   2e-81    Nestor notabilis
ref|XP_010016866.1|  PREDICTED: EH domain-containing protein 4          263   2e-81    Nestor notabilis
ref|XP_005780580.1|  RME1A, RME-1/EHD family protein                    265   6e-81    Emiliania huxleyi CCMP1516
emb|CCI42136.1|  unnamed protein product                                265   6e-81    Albugo candida
ref|XP_005143974.1|  PREDICTED: EH domain-containing protein 4          264   6e-81    Melopsittacus undulatus
ref|XP_010078610.1|  PREDICTED: EH domain-containing protein 4          260   7e-81    Pterocles gutturalis
gb|KFV12676.1|  EH domain-containing protein 4                          260   8e-81    Pterocles gutturalis
ref|XP_007115392.1|  PREDICTED: EH domain-containing protein 4          259   1e-80    
ref|XP_009997919.1|  PREDICTED: EH domain-containing protein 4          261   1e-80    Chaetura pelagica
gb|KFU91131.1|  EH domain-containing protein 4                          261   1e-80    Chaetura pelagica
ref|XP_007055830.1|  PREDICTED: EH domain-containing protein 4          261   2e-80    
gb|KFQ19842.1|  EH domain-containing protein 4                          259   2e-80    Merops nubicus
ref|XP_008943007.1|  PREDICTED: EH domain-containing protein 4          259   2e-80    Merops nubicus
gb|KFP29463.1|  EH domain-containing protein 4                          261   3e-80    Colius striatus
ref|XP_005860350.1|  PREDICTED: EH domain-containing protein 4          260   3e-80    
ref|XP_010194597.1|  PREDICTED: EH domain-containing protein 4          261   3e-80    Colius striatus
ref|XP_005438833.1|  PREDICTED: EH domain-containing protein 4          260   4e-80    
ref|XP_004481540.1|  PREDICTED: EH domain-containing protein 4          262   4e-80    Dasypus novemcinctus
ref|XP_006130426.1|  PREDICTED: EH domain-containing protein 4          261   5e-80    
gb|KFV40206.1|  EH domain-containing protein 4                          259   5e-80    Gavia stellata
ref|XP_003480447.1|  PREDICTED: EH domain-containing protein 4          257   6e-80    
ref|XP_009819162.1|  PREDICTED: EH domain-containing protein 4          259   6e-80    Gavia stellata
gb|KGL79408.1|  EH domain-containing protein 4                          259   6e-80    Tinamus guttatus
ref|XP_010987578.1|  PREDICTED: EH domain-containing protein 4          259   7e-80    Camelus dromedarius [camel]
gb|KFR09569.1|  EH domain-containing protein 4                          259   7e-80    Opisthocomus hoazin [hoatzin]
ref|XP_010160386.1|  PREDICTED: EH domain-containing protein 4          259   7e-80    Antrostomus carolinensis
gb|KFZ52861.1|  EH domain-containing protein 4                          259   7e-80    Antrostomus carolinensis
ref|XP_009931465.1|  PREDICTED: EH domain-containing protein 4          259   8e-80    Opisthocomus hoazin [hoatzin]
ref|XP_009708214.1|  PREDICTED: EH domain-containing protein 4          259   1e-79    Cariama cristata
gb|KFP61900.1|  EH domain-containing protein 4                          259   1e-79    Cariama cristata
ref|XP_010285892.1|  PREDICTED: EH domain-containing protein 4          259   1e-79    Phaethon lepturus
gb|KFQ75454.1|  EH domain-containing protein 4                          259   1e-79    Phaethon lepturus
ref|XP_008498509.1|  PREDICTED: EH domain-containing protein 4          259   1e-79    Calypte anna
ref|XP_006178915.1|  PREDICTED: EH domain-containing protein 4          259   1e-79    Camelus ferus
gb|KFQ06632.1|  EH domain-containing protein 4                          259   1e-79    
gb|KFP17185.1|  EH domain-containing protein 4                          259   1e-79    
ref|XP_007536541.1|  PREDICTED: EH domain-containing protein 4          261   2e-79    
ref|XP_009638548.1|  PREDICTED: EH domain-containing protein 4          258   2e-79    
ref|XP_009944909.1|  PREDICTED: EH domain-containing protein 4          258   2e-79    
ref|XP_005284662.1|  PREDICTED: EH domain-containing protein 4          261   2e-79    
ref|XP_009275888.1|  PREDICTED: EH domain-containing protein 4          258   2e-79    
gb|KFR07234.1|  EH domain-containing protein 4                          258   2e-79    
gb|KFQ58277.1|  EH domain-containing protein 4                          258   2e-79    
ref|XP_005685580.1|  PREDICTED: EH domain-containing protein 4          260   2e-79    
ref|XP_009491400.1|  PREDICTED: EH domain-containing protein 4          258   2e-79    
ref|XP_008141256.1|  PREDICTED: EH domain-containing protein 4          260   2e-79    
ref|XP_006093124.1|  PREDICTED: EH domain-containing protein 4          260   2e-79    
gb|KFM06361.1|  EH domain-containing protein 4                          258   2e-79    
gb|ELT99462.1|  hypothetical protein CAPTEDRAFT_108382                  260   2e-79    
gb|KFW63762.1|  EH domain-containing protein 4                          258   2e-79    
gb|KFO88536.1|  EH domain-containing protein 4                          255   3e-79    
gb|EIE86499.1|  hypothetical protein RO3G_11210                         260   3e-79    
ref|XP_010132463.1|  PREDICTED: EH domain-containing protein 4          255   3e-79    
ref|XP_009926813.1|  PREDICTED: EH domain-containing protein 4          258   3e-79    
ref|XP_004056086.1|  PREDICTED: EH domain-containing protein 4-like     255   3e-79    
gb|KFP54845.1|  EH domain-containing protein 4                          258   3e-79    
ref|XP_004609647.1|  PREDICTED: EH domain-containing protein 4          260   3e-79    
ref|XP_005502466.1|  PREDICTED: EH domain-containing protein 4          258   3e-79    
gb|KFO12378.1|  EH domain-containing protein 4                          258   3e-79    
gb|KFQ11660.1|  EH domain-containing protein 4                          258   3e-79    
ref|XP_010303846.1|  PREDICTED: EH domain-containing protein 4          258   3e-79    
ref|XP_005978480.1|  PREDICTED: EH domain-containing protein 4          260   3e-79    
gb|KFP05853.1|  EH domain-containing protein 4                          259   3e-79    
ref|XP_004010522.1|  PREDICTED: EH domain-containing protein 4          260   3e-79    
ref|XP_010187051.1|  PREDICTED: EH domain-containing protein 4          258   3e-79    
ref|NP_001178982.1|  EH domain-containing protein 4                     260   3e-79    
gb|KFQ38745.1|  EH domain-containing protein 4                          258   3e-79    
gb|KFW03891.1|  EH domain-containing protein 4                          258   4e-79    
ref|XP_009472149.1|  PREDICTED: EH domain-containing protein 4          258   4e-79    
gb|KFV66207.1|  EH domain-containing protein 4                          258   4e-79    
gb|KFZ65648.1|  EH domain-containing protein 4                          258   4e-79    
ref|XP_004709424.1|  PREDICTED: EH domain-containing protein 4          259   4e-79    
ref|XP_009574894.1|  PREDICTED: EH domain-containing protein 4          258   4e-79    
gb|KGL95706.1|  EH domain-containing protein 4                          258   4e-79    
ref|XP_010578501.1|  PREDICTED: EH domain-containing protein 4          258   4e-79    
ref|XP_009317530.1|  PREDICTED: EH domain-containing protein 4          258   4e-79    
ref|XP_009897284.1|  PREDICTED: EH domain-containing protein 4          258   5e-79    
ref|XP_005231616.1|  PREDICTED: EH domain-containing protein 4          260   5e-79    
ref|XP_003791796.1|  PREDICTED: EH domain-containing protein 4          259   6e-79    
ref|XP_008046657.1|  PREDICTED: EH domain-containing protein 4          259   6e-79    
ref|XP_004400455.1|  PREDICTED: EH domain-containing protein 4          259   6e-79    
ref|XP_004687941.1|  PREDICTED: EH domain-containing protein 4          259   7e-79    
ref|XP_010963486.1|  PREDICTED: EH domain-containing protein 4          259   7e-79    
ref|XP_004321137.1|  PREDICTED: EH domain-containing protein 4          259   7e-79    
emb|CEJ02932.1|  hypothetical protein RMCBS344292_16924                 254   7e-79    
ref|XP_006736705.1|  PREDICTED: EH domain-containing protein 4          258   7e-79    
ref|XP_008585669.1|  PREDICTED: EH domain-containing protein 4 is...    257   7e-79    
ref|XP_003987301.1|  PREDICTED: EH domain-containing protein 4          259   8e-79    
ref|XP_007081848.1|  PREDICTED: EH domain-containing protein 4          259   9e-79    
ref|XP_002913248.1|  PREDICTED: EH domain-containing protein 4          259   9e-79    
gb|EPB88290.1|  hypothetical protein HMPREF1544_04874                   258   9e-79    
ref|XP_004274008.1|  PREDICTED: EH domain-containing protein 4          258   1e-78    
ref|XP_003641397.2|  PREDICTED: EH domain-containing protein 4          257   1e-78    
ref|XP_009071493.1|  PREDICTED: EH domain-containing protein 4          254   1e-78    
emb|CDQ83634.1|  unnamed protein product                                254   1e-78    
ref|XP_005047071.1|  PREDICTED: EH domain-containing protein 4          257   1e-78    
ref|XP_009970978.1|  PREDICTED: EH domain-containing protein 4          256   1e-78    
gb|KFW74974.1|  EH domain-containing protein 4                          256   1e-78    
gb|KFV43089.1|  EH domain-containing protein 4                          256   1e-78    
ref|XP_010216053.1|  PREDICTED: EH domain-containing protein 4          259   1e-78    
ref|XP_005381377.1|  PREDICTED: EH domain-containing protein 4          256   1e-78    
ref|XP_004623435.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    258   1e-78    
gb|KFP78973.1|  EH domain-containing protein 4                          254   1e-78    
gb|KFV93705.1|  EH domain-containing protein 4                          256   1e-78    
ref|XP_009886277.1|  PREDICTED: EH domain-containing protein 4          258   1e-78    
emb|CEG64411.1|  hypothetical protein RMATCC62417_01389                 258   1e-78    
ref|XP_010151488.1|  PREDICTED: EH domain-containing protein 4          256   2e-78    
ref|XP_001362234.1|  PREDICTED: EH domain-containing protein 4          258   2e-78    
ref|XP_004751230.1|  PREDICTED: EH domain-containing protein 4          258   2e-78    
ref|XP_007658871.1|  PREDICTED: EH domain-containing protein 4          258   2e-78    
gb|AAF40472.1|AF181265_1  EH domain containing 4                        256   2e-78    
gb|EHH27240.1|  PAST-like protein 4                                     256   2e-78    
ref|XP_005030493.1|  PREDICTED: EH domain-containing protein 4          258   2e-78    
ref|XP_004660949.1|  PREDICTED: EH domain-containing protein 4          258   2e-78    
ref|XP_008700443.1|  PREDICTED: EH domain-containing protein 4          258   2e-78    
ref|XP_002718009.2|  PREDICTED: EH domain-containing protein 4          258   2e-78    
ref|XP_010596668.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    255   2e-78    
gb|KFO63593.1|  EH domain-containing protein 4                          256   2e-78    
ref|XP_004421511.1|  PREDICTED: EH domain-containing protein 4          258   2e-78    
gb|AAG28784.1|AF307137_1  EH domain-containing protein FKSG7            257   3e-78    
ref|XP_008925583.1|  PREDICTED: EH domain-containing protein 4          257   3e-78    
ref|NP_001080707.1|  EH-domain containing 4                             257   3e-78    
ref|NP_647540.1|  EH domain-containing protein 4                        257   3e-78    
emb|CEP19302.1|  hypothetical protein                                   257   3e-78    
gb|KFV86317.1|  EH domain-containing protein 4                          255   4e-78    
ref|XP_009976813.1|  PREDICTED: EH domain-containing protein 4          255   4e-78    
ref|XP_008049496.1|  PREDICTED: EH domain-containing protein 1          252   4e-78    
gb|KFV09622.1|  EH domain-containing protein 4                          255   4e-78    
ref|XP_004578211.1|  PREDICTED: EH domain-containing protein 4          257   4e-78    
ref|XP_008637914.1|  PREDICTED: EH domain-containing protein 4          255   4e-78    
gb|KDO25885.1|  hypothetical protein SPRG_08827                         256   5e-78    
ref|XP_851017.1|  PREDICTED: EH domain-containing protein 4             257   5e-78    
ref|XP_008845031.1|  PREDICTED: EH domain-containing protein 4          257   5e-78    
ref|XP_010120632.1|  PREDICTED: EH domain-containing protein 4          254   5e-78    
ref|XP_003935732.1|  PREDICTED: EH domain-containing protein 4          257   5e-78    
gb|KFP42875.1|  EH domain-containing protein 4                          254   5e-78    
ref|XP_006991300.1|  PREDICTED: EH domain-containing protein 4          257   5e-78    
ref|XP_009682975.1|  PREDICTED: EH domain-containing protein 4          255   6e-78    
ref|XP_008870165.1|  hypothetical protein H310_06767                    256   6e-78    
ref|XP_010395897.1|  PREDICTED: EH domain-containing protein 4          256   6e-78    
ref|XP_004380712.1|  PREDICTED: EH domain-containing protein 4          256   6e-78    
dbj|BAE35217.1|  unnamed protein product                                256   7e-78    
ref|NP_598599.2|  EH domain-containing protein 4                        256   7e-78    
ref|XP_001918265.2|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    257   8e-78    
dbj|BAE93881.1|  EH-domain containing 4                                 256   8e-78    
ref|XP_002825386.1|  PREDICTED: EH domain-containing protein 4          256   8e-78    
ref|XP_003266806.1|  PREDICTED: EH domain-containing protein 4          256   8e-78    
ref|NP_001245064.1|  EH domain-containing protein 4                     256   8e-78    
ref|XP_010367370.1|  PREDICTED: EH domain-containing protein 4          256   8e-78    
ref|XP_510639.2|  PREDICTED: EH domain-containing protein 4             256   9e-78    
dbj|GAN04397.1|  past-1                                                 259   9e-78    
ref|NP_644670.1|  EH domain-containing protein 4                        256   9e-78    
ref|XP_006920525.1|  PREDICTED: EH domain-containing protein 4          256   9e-78    
ref|XP_008015119.1|  PREDICTED: EH domain-containing protein 4          256   9e-78    
dbj|BAF85323.1|  unnamed protein product                                256   9e-78    
ref|XP_006104388.1|  PREDICTED: EH domain-containing protein 1          252   9e-78    
gb|KFO32966.1|  EH domain-containing protein 4                          254   1e-77    
ref|XP_006883045.1|  PREDICTED: EH domain-containing protein 4          256   1e-77    
ref|XP_003774169.1|  PREDICTED: EH domain-containing protein 1          253   1e-77    
ref|XP_007933480.1|  PREDICTED: EH domain-containing protein 4          256   1e-77    
ref|XP_005316504.1|  PREDICTED: EH domain-containing protein 4          256   1e-77    
ref|XP_006158780.1|  PREDICTED: EH domain-containing protein 4          258   1e-77    
ref|XP_010623348.1|  PREDICTED: EH domain-containing protein 4          254   1e-77    
gb|ERE70803.1|  EH domain-containing protein 4                          254   1e-77    
ref|XP_007180877.1|  PREDICTED: EH domain-containing protein 4          256   1e-77    
ref|XP_008618010.1|  hypothetical protein SDRG_13692                    256   1e-77    
gb|EHB10335.1|  EH domain-containing protein 4                          253   1e-77    
ref|NP_001096442.2|  EH-domain containing 4                             255   2e-77    
ref|XP_003498135.1|  PREDICTED: EH domain-containing protein 4 is...    254   2e-77    
ref|XP_009568342.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    253   2e-77    
ref|XP_009100301.1|  PREDICTED: EH domain-containing protein 4          253   2e-77    
ref|XP_006831806.1|  PREDICTED: EH domain-containing protein 4          255   2e-77    
ref|XP_007610691.1|  PREDICTED: EH domain-containing protein 4 is...    254   3e-77    
gb|EGW10710.1|  EH domain-containing protein 1                          251   3e-77    
ref|XP_005064759.1|  PREDICTED: EH domain-containing protein 4          255   3e-77    
ref|XP_004896291.1|  PREDICTED: EH domain-containing protein 4          253   3e-77    
ref|XP_005419595.1|  PREDICTED: EH domain-containing protein 4          253   4e-77    
ref|XP_005364351.1|  PREDICTED: EH domain-containing protein 4          254   4e-77    
ref|XP_009822927.1|  hypothetical protein H257_01428                    253   4e-77    
ref|XP_005480269.1|  PREDICTED: EH domain-containing protein 4          252   5e-77    
ref|XP_006911196.1|  PREDICTED: EH domain-containing protein 1          254   5e-77    
emb|CEJ00342.1|  hypothetical protein RMCBS344292_14400                 254   5e-77    
gb|KFM71674.1|  EH domain-containing protein 1                          254   5e-77    
ref|XP_008157310.1|  PREDICTED: EH domain-containing protein 1          254   6e-77    
ref|XP_005990842.1|  PREDICTED: EH domain-containing protein 4          254   1e-76    
gb|AEG42345.1|  EH-domain containing protein                            253   1e-76    
ref|XP_004861692.1|  PREDICTED: EH domain-containing protein 4          253   1e-76    
gb|AAH12272.1|  EH-domain containing 4                                  253   1e-76    
dbj|GAM18969.1|  hypothetical protein SAMD00019534_021440               253   1e-76    
ref|XP_005522550.1|  PREDICTED: EH domain-containing protein 4          253   1e-76    
emb|CEG72115.1|  hypothetical protein RMATCC62417_07727                 253   1e-76    
ref|XP_004174503.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    253   1e-76    
dbj|BAE01936.1|  unnamed protein product                                250   1e-76    
ref|XP_005894142.1|  PREDICTED: EH domain-containing protein 1          249   1e-76    
gb|ELR57574.1|  EH domain-containing protein 1                          249   1e-76    
dbj|BAE93882.1|  EH-domain containing 4-KJR                             253   2e-76    
ref|XP_003214618.1|  PREDICTED: EH domain-containing protein 4          253   2e-76    
gb|EGV97249.1|  EH domain-containing protein 4                          255   2e-76    
ref|XP_008418633.1|  PREDICTED: EH domain-containing protein 1-li...    249   2e-76    
ref|XP_005864512.1|  PREDICTED: EH domain-containing protein 1          252   2e-76    
ref|XP_011219918.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    253   2e-76    
ref|XP_008311021.1|  PREDICTED: EH domain-containing protein 3          253   2e-76    
ref|XP_002736717.1|  PREDICTED: EH domain-containing protein 1-like     253   2e-76    
ref|XP_004713576.1|  PREDICTED: EH domain-containing protein 1          248   2e-76    
ref|XP_004618455.1|  PREDICTED: EH domain-containing protein 1          252   2e-76    
dbj|BAE41953.1|  unnamed protein product                                251   2e-76    
ref|XP_007515068.1|  unnamed protein product                            253   2e-76    
gb|ACQ62995.1|  EH-domain containing 1 (predicted)                      252   3e-76    
ref|XP_004073212.1|  PREDICTED: EH domain-containing protein 1-like     252   3e-76    
ref|XP_005598506.1|  PREDICTED: EH domain-containing protein 1          249   3e-76    
ref|XP_005700037.1|  PREDICTED: EH domain-containing protein 1          249   3e-76    
gb|EMP39598.1|  Spectrin beta chain, brain 4                            264   3e-76    
emb|CEG64412.1|  hypothetical protein RMATCC62417_01389                 248   3e-76    
ref|XP_003475486.1|  PREDICTED: EH domain-containing protein 4          253   3e-76    
ref|XP_008530738.1|  PREDICTED: EH domain-containing protein 1          249   3e-76    
dbj|BAG60021.1|  unnamed protein product                                250   3e-76    
gb|KGG52837.1|  hypothetical protein DI09_12p50                         251   4e-76    
dbj|BAC11147.1|  unnamed protein product                                248   4e-76    
dbj|BAE43123.1|  unnamed protein product                                251   4e-76    
dbj|BAG61156.1|  unnamed protein product                                251   4e-76    
ref|XP_004656697.1|  PREDICTED: EH domain-containing protein 1          251   4e-76    
ref|XP_006771666.1|  PREDICTED: EH domain-containing protein 1          251   5e-76    
dbj|BAE35852.1|  unnamed protein product                                251   5e-76    
ref|NP_034249.1|  EH domain-containing protein 1                        251   5e-76    
dbj|BAE39763.1|  unnamed protein product                                251   5e-76    
ref|XP_004061115.1|  PREDICTED: EH domain-containing protein 2 is...    248   6e-76    
ref|XP_006034137.1|  PREDICTED: EH domain-containing protein 4          251   6e-76    
ref|XP_001748021.1|  hypothetical protein                               251   6e-76    
ref|XP_005900985.1|  PREDICTED: EH domain-containing protein 2 is...    248   6e-76    
dbj|GAA28369.2|  EH domain-containing protein 4                         253   6e-76    
ref|XP_005808390.1|  PREDICTED: EH domain-containing protein 3-like     251   6e-76    
ref|XP_010709709.1|  PREDICTED: EH domain-containing protein 4          259   7e-76    
ref|XP_007070469.1|  PREDICTED: EH domain-containing protein 1          251   7e-76    
gb|ACJ76619.1|  EH-domain containing 1 (predicted)                      248   8e-76    
ref|XP_007535704.1|  PREDICTED: EH domain-containing protein 2          251   8e-76    
emb|CDQ69117.1|  unnamed protein product                                246   8e-76    
ref|XP_009006688.1|  PREDICTED: EH domain-containing protein 1 is...    251   8e-76    
ref|XP_003440675.1|  PREDICTED: EH domain-containing protein 3-like     251   8e-76    
ref|XP_010773995.1|  PREDICTED: EH domain-containing protein 3          250   9e-76    
ref|XP_006270383.1|  PREDICTED: EH domain-containing protein 4          251   9e-76    
ref|XP_003510772.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    250   9e-76    
ref|XP_005988942.1|  PREDICTED: EH domain-containing protein 1-like     251   9e-76    
gb|AAI60908.1|  Ehd1 protein                                            251   9e-76    
ref|XP_002755558.3|  PREDICTED: EH domain-containing protein 1 is...    251   1e-75    
gb|AAH37094.1|  EH-domain containing 1                                  251   1e-75    
emb|CAH91525.1|  hypothetical protein                                   247   1e-75    
ref|XP_003805663.1|  PREDICTED: EH domain-containing protein 4          251   1e-75    
ref|XP_006793144.1|  PREDICTED: EH domain-containing protein 3-like     251   1e-75    
gb|AAH27084.1|  Ehd2 protein                                            248   1e-75    
gb|AAB81204.1|  Hpast                                                   250   1e-75    
ref|XP_009492794.1|  hypothetical protein H696_00638                    251   1e-75    
ref|XP_011448866.1|  PREDICTED: EH domain-containing protein 3-like     250   1e-75    
ref|XP_003798673.1|  PREDICTED: EH domain-containing protein 1          250   1e-75    
dbj|BAG62076.1|  unnamed protein product                                250   1e-75    
gb|EIE85679.1|  hypothetical protein RO3G_10389                         250   1e-75    



>ref|XP_011095452.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
Length=544

 Score =   449 bits (1156),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 213/228 (93%), Positives = 223/228 (98%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE A+GP+GKELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPINEAASGPIGKELFEKEQDDLLADLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQQRLIDNL DEFAKVQREHHLPAGDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQQRLIDNLPDEFAKVQREHHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYSIDKFEKLKPKM+Q+VDDMLGYDIP+LLKNFRNPYD
Sbjct  497  NVEHFREVLGGYSIDKFEKLKPKMIQSVDDMLGYDIPELLKNFRNPYD  544



>ref|XP_010270065.1| PREDICTED: EH domain-containing protein 1 [Nelumbo nucifera]
Length=544

 Score =   444 bits (1143),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 211/228 (93%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE A GP+GKELFEKEQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPVNEAAVGPIGKELFEKEQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA++ISHL+KEMPAMMGKAK QQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  437  NEFVKRARAAKIHAYVISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+HFREILSGYSIDKFE+LKPKM+QAVDDMLGYDIP+LLKNFRNPYD
Sbjct  497  NVDHFREILSGYSIDKFERLKPKMIQAVDDMLGYDIPELLKNFRNPYD  544



>gb|EYU27376.1| hypothetical protein MIMGU_mgv1a004087mg [Erythranthe guttata]
Length=544

 Score =   444 bits (1143),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  ASKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPINE A GPLG+ELFEKEQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVNRVYIGSFNDKPINEAAAGPLGRELFEKEQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQ+LIDNL DEFAKVQREHHLPAGDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQKLIDNLPDEFAKVQREHHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYS+D+FEKLKPKM+Q+VDDMLGYDIPDLLKNFRNPYD
Sbjct  497  NVEHFREVLSGYSLDRFEKLKPKMIQSVDDMLGYDIPDLLKNFRNPYD  544



>ref|XP_010063047.1| PREDICTED: EH domain-containing protein 1 [Eucalyptus grandis]
Length=545

 Score =   443 bits (1140),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV+NTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVINTPEVMRVYIGSFNDKPVNEAATGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQQRLIDNL DEFAKVQRE HLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQQRLIDNLEDEFAKVQREFHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE LSGY++DKFEKLKPKM+QAVDDMLGYDIPDLLK+FRNPYD
Sbjct  498  NVEHFRERLSGYNLDKFEKLKPKMIQAVDDMLGYDIPDLLKHFRNPYD  545



>ref|XP_009603511.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=467

 Score =   440 bits (1131),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  240  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMW  299

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+IPKKACDRRI
Sbjct  300  SLGKVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNIPKKACDRRI  359

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQ+RLIDNL DEF K+Q+EHHLPAGDFP
Sbjct  360  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQKRLIDNLEDEFVKIQKEHHLPAGDFP  419

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNFRNPYD
Sbjct  420  NVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFRNPYD  467



>ref|XP_006452453.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
 gb|ESR65693.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
Length=438

 Score =   438 bits (1127),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  211  AAKCDLILLLFDPHKLDISDEFKRVITSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  270

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE+A GPLGKELFEKEQDDLLSDLKDIPKKACD RI
Sbjct  271  SLGKVLNTPEVVRVYIGSFNDKPVNESAFGPLGKELFEKEQDDLLSDLKDIPKKACDLRI  330

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAMMGKAKTQQ+LIDNLA+EF KVQ+E HLP GDFP
Sbjct  331  NEFVKRARAAKIHAYIISHLRKEMPAMMGKAKTQQKLIDNLAEEFGKVQKEFHLPPGDFP  390

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+EILSGYS DKFEKLKPKM+Q VDDMLGYDIPDLLKNFRNPYD
Sbjct  391  NVEHFKEILSGYSFDKFEKLKPKMIQVVDDMLGYDIPDLLKNFRNPYD  438



>gb|KDP39189.1| hypothetical protein JCGZ_00946 [Jatropha curcas]
Length=545

 Score =   442 bits (1137),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV+NTPEV+RVYIGSFNDKP+NE A GP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVVNTPEVVRVYIGSFNDKPVNEAAVGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQQRLID+LADEF KVQRE HLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQQRLIDSLADEFGKVQREFHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGY+IDKFEKLKPKM+QAVDDMLGYDIPDLLKNFRNPYD
Sbjct  498  NVEHFREVLSGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKNFRNPYD  545



>ref|XP_006829517.1| hypothetical protein AMTR_s00074p00139810 [Amborella trichopoda]
 gb|ERM96933.1| hypothetical protein AMTR_s00074p00139810 [Amborella trichopoda]
Length=543

 Score =   441 bits (1134),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPINE A GP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  376  SLGKVLNTPEVNRVYIGSFNDKPINEGAIGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIH++IISHLRKEMPAM+GKAKTQQRLIDNL DEFAKVQREHHLPAGDFP
Sbjct  436  NEFVKRARAAKIHSYIISHLRKEMPAMLGKAKTQQRLIDNLEDEFAKVQREHHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+E+LSGYSIDKFEKL+PKM+Q VDDMLGYDIP+LLKNFRNPY+
Sbjct  496  NVEHFKEVLSGYSIDKFEKLRPKMIQNVDDMLGYDIPELLKNFRNPYE  543



>emb|CDP13787.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   441 bits (1135),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPINE ATGP+GKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  378  SLGKVLNTPEVTRVYIGSFNDKPINEVATGPIGKELFEKEQDDLLADLKNIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQQRL+DNL  EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQQRLVDNLEVEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPKM+Q+VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEHFREVLSGYSIDKFEKLKPKMIQSVDDMLGYDIPELLKNFRNPYD  545



>gb|KDO62119.1| hypothetical protein CISIN_1g009050mg [Citrus sinensis]
Length=545

 Score =   441 bits (1133),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 221/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVITSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE+A GPLGKELFEKEQDDLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPVNESAFGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAMMGKAKTQQ+LIDNLA+EF KVQ+E HLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLRKEMPAMMGKAKTQQKLIDNLAEEFGKVQKEFHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+EILSGYS DKFEKLKPKM+Q VDDMLGYDIPDLLKNFRNPYD
Sbjct  498  NVEHFKEILSGYSFDKFEKLKPKMIQVVDDMLGYDIPDLLKNFRNPYD  545



>gb|KCW70227.1| hypothetical protein EUGRSUZ_F03500 [Eucalyptus grandis]
Length=613

 Score =   443 bits (1139),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  386  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  445

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV+NTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  446  SLGKVINTPEVMRVYIGSFNDKPVNEAATGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  505

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQQRLIDNL DEFAKVQRE HLP GDFP
Sbjct  506  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQQRLIDNLEDEFAKVQREFHLPPGDFP  565

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE LSGY++DKFEKLKPKM+QAVDDMLGYDIPDLLK+FRNPYD
Sbjct  566  NVEHFRERLSGYNLDKFEKLKPKMIQAVDDMLGYDIPDLLKHFRNPYD  613



>ref|XP_009393691.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   441 bits (1133),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 208/228 (91%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNK+DQVDTQQLMRVYGALMW
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKSDQVDTQQLMRVYGALMW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE A GPLGKELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  375  SLGKVLNTPEVMRVYIGSFNDKPINEAAVGPLGKELFEREQDDLLSDLKDIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIH++IISHLR EMPAM+GKAK QQRLIDNL DEFAKVQRE+HLPAGDFP
Sbjct  435  NEFVKRARAAKIHSYIISHLRNEMPAMLGKAKAQQRLIDNLEDEFAKVQREYHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFREIL GYSIDKFEKLKPKM+QAVDDML YDIP+LL+NFRNPY+
Sbjct  495  NVEHFREILGGYSIDKFEKLKPKMIQAVDDMLAYDIPELLRNFRNPYE  542



>ref|XP_009603507.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603508.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603509.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603510.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=543

 Score =   439 bits (1130),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+IPKKACDRRI
Sbjct  376  SLGKVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQ+RLIDNL DEF K+Q+EHHLPAGDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQKRLIDNLEDEFVKIQKEHHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNFRNPYD
Sbjct  496  NVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFRNPYD  543



>ref|XP_004149345.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
 ref|XP_004167751.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=547

 Score =   439 bits (1130),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE  TGPLGK+LFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPVNEAVTGPLGKDLFEKEQEDLLSDLKDIPKKACDRRI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMP M+GKAKTQQRLIDNLADEF KVQRE+HLPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIISHLRKEMPTMIGKAKTQQRLIDNLADEFGKVQREYHLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE LSGY+ DKFEKLKPKM+Q+VDDMLGYD+PDLLKNFRNPYD
Sbjct  500  NVEQFRETLSGYNFDKFEKLKPKMIQSVDDMLGYDVPDLLKNFRNPYD  547



>ref|XP_006475006.1| PREDICTED: EH domain-containing protein 3-like [Citrus sinensis]
Length=545

 Score =   439 bits (1129),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 210/228 (92%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVITSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP NE+A GPLGKELFEKEQDDLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPANESAFGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAMMGKAKTQQ+LIDNLA+EF KVQ+E HLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLRKEMPAMMGKAKTQQKLIDNLAEEFGKVQKEFHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+EILSGYS DKFEKLKPKM+Q VDDMLGYDIPDLLKNFRNPYD
Sbjct  498  NVEHFKEILSGYSFDKFEKLKPKMIQVVDDMLGYDIPDLLKNFRNPYD  545



>ref|XP_002277794.1| PREDICTED: EH domain-containing protein 1 [Vitis vinifera]
 emb|CBI26690.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   439 bits (1129),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE A GP+GKELFEKEQ++LLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPVNEAAVGPIGKELFEKEQENLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMP MMGKAKTQQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPTMMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+HFRE+LSGYSIDKFE+LKPKM+Q VDDMLGYDIP+LLK+FRNPYD
Sbjct  498  NVDHFREVLSGYSIDKFERLKPKMIQTVDDMLGYDIPELLKSFRNPYD  545



>ref|XP_008449138.1| PREDICTED: EH domain-containing protein 1 [Cucumis melo]
Length=547

 Score =   439 bits (1128),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 207/228 (91%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE ATGPLGK+LFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPVNEAATGPLGKDLFEKEQEDLLSDLKDIPKKACDRRI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAM+GKAKTQQRLIDNLADEF KVQRE+HLPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIISHLRKEMPAMIGKAKTQQRLIDNLADEFGKVQREYHLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE L GY+ DKFEKLKPKM+Q+VDDMLGYD+P LLKNFRNPYD
Sbjct  500  NVEQFRETLGGYNFDKFEKLKPKMIQSVDDMLGYDVPQLLKNFRNPYD  547



>ref|XP_010096102.1| EH domain-containing protein 1 [Morus notabilis]
 gb|EXB63267.1| EH domain-containing protein 1 [Morus notabilis]
Length=542

 Score =   438 bits (1127),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  315  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV+NTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLL+DLKDIPKKACDRRI
Sbjct  375  SLGKVINTPEVMRVYIGSFNDKPVNEAATGPIGKELFEKEQEDLLADLKDIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKR RAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNLADEF KVQRE HLP GDFP
Sbjct  435  NEFVKRTRAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLADEFGKVQREFHLPPGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE+L GY+ DKFEKLKPKM+QAVDDMLGYDIPDLLKNFRNPYD
Sbjct  495  NVEQFREVLRGYNFDKFEKLKPKMIQAVDDMLGYDIPDLLKNFRNPYD  542



>ref|XP_009589164.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009589165.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=469

 Score =   436 bits (1120),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  242  ASKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  301

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPINE ATGP+GKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  302  SLGKVLNTPEVSRVYIGSFNDKPINEAATGPVGKELFEKEQDDLLTDLKNIPKKACDRRI  361

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIH++IISHL+KEMPAM+GKAKTQQ+LIDNL D+F KVQ+EHHLP GDFP
Sbjct  362  NEFVKRARAAKIHSYIISHLKKEMPAMIGKAKTQQKLIDNLEDQFVKVQKEHHLPPGDFP  421

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGY+IDKFEKLKPK++Q+VDDMLGYDIP+LLKNFRNPYD
Sbjct  422  NVEHFREVLSGYNIDKFEKLKPKLIQSVDDMLGYDIPELLKNFRNPYD  469



>ref|XP_010913401.1| PREDICTED: EH domain-containing protein 1-like [Elaeis guineensis]
Length=543

 Score =   438 bits (1126),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNK+DQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKSDQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE A GP+GKELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  376  SLGKVLNTPEVMRVYIGSFNDKPINEAAVGPIGKELFEREQDDLLSDLKDIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAM+GKAK QQRLIDNL DEF KVQRE HLPAGDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLRKEMPAMIGKAKAQQRLIDNLEDEFPKVQREFHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+E+LSGYSIDKFEKLKPKM+Q VDDMLGYDIP+LL++FRNPY+
Sbjct  496  NVEHFKEVLSGYSIDKFEKLKPKMIQTVDDMLGYDIPELLRSFRNPYE  543



>emb|CAN67909.1| hypothetical protein VITISV_034695 [Vitis vinifera]
Length=546

 Score =   438 bits (1126),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE A GP+GKELFEKEQ++LLSDLKDIPKKACDRRI
Sbjct  379  SLGKVLNTPEVMRVYIGSFNDKPVNEAAVGPIGKELFEKEQENLLSDLKDIPKKACDRRI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMP MMGKAKTQQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  439  NEFVKRARAAKIHAYIISHLKKEMPTMMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+HFRE+LSGYSIDKFE+LKPKM+Q VDDMLGYDIP+LLK+FRNPYD
Sbjct  499  NVDHFREVLSGYSIDKFERLKPKMIQTVDDMLGYDIPELLKSFRNPYD  546



>ref|XP_011046717.1| PREDICTED: EH domain-containing protein 3 [Populus euphratica]
Length=545

 Score =   437 bits (1124),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE A GP+GKELFEKEQ+DLLSDLK+IPKKACDRRI
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPVNEAAVGPIGKELFEKEQEDLLSDLKNIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAMMGKAK QQRL+DNLA+EF KVQRE HLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLRKEMPAMMGKAKAQQRLLDNLAEEFGKVQREFHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE+LSGY+ DKFEKLKPKM+QAVDDMLGYDIPDLLKNFRNPYD
Sbjct  498  NVEQFREVLSGYNFDKFEKLKPKMIQAVDDMLGYDIPDLLKNFRNPYD  545



>ref|XP_006452452.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
 gb|ESR65692.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
Length=563

 Score =   438 bits (1126),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 209/228 (92%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  336  AAKCDLILLLFDPHKLDISDEFKRVITSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  395

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE+A GPLGKELFEKEQDDLLSDLKDIPKKACD RI
Sbjct  396  SLGKVLNTPEVVRVYIGSFNDKPVNESAFGPLGKELFEKEQDDLLSDLKDIPKKACDLRI  455

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAMMGKAKTQQ+LIDNLA+EF KVQ+E HLP GDFP
Sbjct  456  NEFVKRARAAKIHAYIISHLRKEMPAMMGKAKTQQKLIDNLAEEFGKVQKEFHLPPGDFP  515

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+EILSGYS DKFEKLKPKM+Q VDDMLGYDIPDLLKNFRNPYD
Sbjct  516  NVEHFKEILSGYSFDKFEKLKPKMIQVVDDMLGYDIPDLLKNFRNPYD  563



>ref|XP_009779286.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009779287.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009779288.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
Length=436

 Score =   433 bits (1113),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  209  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMW  268

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+VLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+IPKKACDRRI
Sbjct  269  SLGRVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNIPKKACDRRI  328

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK Q+RLIDNL DEF K+Q+EHHLPAGDFP
Sbjct  329  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFP  388

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNF NPYD
Sbjct  389  NVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  436



>ref|XP_004966283.1| PREDICTED: EH domain-containing protein 1-like [Setaria italica]
Length=544

 Score =   437 bits (1123),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE+A GPLGKELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVSRVYIGSFNDKPVNESAVGPLGKELFEREQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMP MMGKAK QQRLIDNL DEFAKVQRE+HLPAGDFP
Sbjct  437  NEFVKRARAAKIHAYIIGHLKKEMPTMMGKAKAQQRLIDNLQDEFAKVQREYHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+E+LSGYS DKFEK+KPKM+QAVDDMLGYDIP+LLKNFRNPY+
Sbjct  497  YVEHFKEVLSGYSFDKFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  544



>ref|XP_009770779.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=467

 Score =   434 bits (1116),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  240  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMW  299

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+VLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+IPKKACDRRI
Sbjct  300  SLGRVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNIPKKACDRRI  359

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK Q+RLIDNL DEF K+Q+EHHLPAGDFP
Sbjct  360  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFP  419

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNF NPYD
Sbjct  420  NVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  467



>ref|XP_009779284.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009779285.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=467

 Score =   434 bits (1116),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  240  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMW  299

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+VLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+IPKKACDRRI
Sbjct  300  SLGRVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNIPKKACDRRI  359

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK Q+RLIDNL DEF K+Q+EHHLPAGDFP
Sbjct  360  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFP  419

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNF NPYD
Sbjct  420  NVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  467



>ref|XP_009770780.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
Length=436

 Score =   432 bits (1112),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  209  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMW  268

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+VLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+IPKKACDRRI
Sbjct  269  SLGRVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNIPKKACDRRI  328

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK Q+RLIDNL DEF K+Q+EHHLPAGDFP
Sbjct  329  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFP  388

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNF NPYD
Sbjct  389  NVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  436



>ref|XP_008644157.1| PREDICTED: uncharacterized protein LOC100384394 isoform X1 [Zea 
mays]
 ref|XP_008644158.1| PREDICTED: uncharacterized protein LOC100384394 isoform X1 [Zea 
mays]
 gb|AFW69172.1| hypothetical protein ZEAMMB73_263235 [Zea mays]
Length=544

 Score =   436 bits (1122),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE+A GPLGKELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVSRVYIGSFNDKPVNESAVGPLGKELFEREQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMP MMGKAK QQRLIDNL DEFAKVQRE+HLP+GDFP
Sbjct  437  NEFVKRARAAKIHAYIIGHLKKEMPTMMGKAKAQQRLIDNLPDEFAKVQREYHLPSGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+E+LSGYS DKFEK+KPKMVQAVDDMLGYDIP+LLKNFRNPY+
Sbjct  497  YVEHFKEVLSGYSFDKFEKVKPKMVQAVDDMLGYDIPELLKNFRNPYE  544



>ref|XP_007020711.1| EPS15 domain 1 [Theobroma cacao]
 gb|EOY12236.1| EPS15 domain 1 [Theobroma cacao]
Length=547

 Score =   436 bits (1122),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDVSDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLL+DLKDIPKKACDRRI
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPVNEAATGPIGKELFEKEQEDLLADLKDIPKKACDRRI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA II HLRKEMP MMGKAKTQQRLIDNLADEF KVQR+HHLP GDFP
Sbjct  440  NEFVKRARAAKIHAHIIGHLRKEMPTMMGKAKTQQRLIDNLADEFGKVQRDHHLPPGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGY+ DKFEKLKPKM+QAVDDMLGYDIP+LLK FRNPYD
Sbjct  500  NVEHFREVLSGYNFDKFEKLKPKMIQAVDDMLGYDIPELLKTFRNPYD  547



>gb|KHG22957.1| EH domain-containing 1 [Gossypium arboreum]
Length=452

 Score =   433 bits (1113),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  225  AAKCDLILLLFDPHKLDVSDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  284

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  285  SLGKVLNTPEVVRVYIGSFNDKPVNEAATGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  344

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II+HL+KEMPAM+GKAKTQQRLIDNL  EF KVQR+HHLP GDFP
Sbjct  345  NEFVKRARAAKIHAYIIAHLKKEMPAMIGKAKTQQRLIDNLEGEFGKVQRDHHLPPGDFP  404

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+EILSGY+ DKFEKLKPKM+QAVDDMLGYDIP+LLK FRNPYD
Sbjct  405  NVEHFKEILSGYNFDKFEKLKPKMIQAVDDMLGYDIPELLKTFRNPYD  452



>ref|XP_010252586.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=450

 Score =   432 bits (1112),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL G+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  223  AAKCDLILLLFDPHKLDISDEFKRVIGSLHGNDDKIRVVLNKADQVDTQQLMRVYGALMW  282

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  283  SLGKVLNTPEVMRVYIGSFNDKPVNEVATGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  342

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRL+DNL DEF+KVQ+E HLPAGDFP
Sbjct  343  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKVQQRLLDNLEDEFSKVQKEFHLPAGDFP  402

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            ++E FREILSGY+IDKFEKLKPKM++AVDDMLGYDIP+LLKNFRNPY+
Sbjct  403  NIEQFREILSGYNIDKFEKLKPKMIKAVDDMLGYDIPELLKNFRNPYE  450



>ref|XP_002437485.1| hypothetical protein SORBIDRAFT_10g027960 [Sorghum bicolor]
 gb|EER88852.1| hypothetical protein SORBIDRAFT_10g027960 [Sorghum bicolor]
Length=544

 Score =   436 bits (1120),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE+A GPLGKELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVSRVYIGSFNDKPVNESAVGPLGKELFEREQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMP MMGKAK QQRLIDNL DEFAKVQRE+HLP+GDFP
Sbjct  437  NEFVKRARAAKIHAYIIGHLKKEMPTMMGKAKAQQRLIDNLPDEFAKVQREYHLPSGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+E+LSGYS DKFEK+KPKM+QAVDDMLGYDIP+LLKNFRNPY+
Sbjct  497  YVEHFKEVLSGYSFDKFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  544



>ref|XP_009589162.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=545

 Score =   435 bits (1119),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPINE ATGP+GKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  378  SLGKVLNTPEVSRVYIGSFNDKPINEAATGPVGKELFEKEQDDLLTDLKNIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIH++IISHL+KEMPAM+GKAKTQQ+LIDNL D+F KVQ+EHHLP GDFP
Sbjct  438  NEFVKRARAAKIHSYIISHLKKEMPAMIGKAKTQQKLIDNLEDQFVKVQKEHHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGY+IDKFEKLKPK++Q+VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEHFREVLSGYNIDKFEKLKPKLIQSVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_008805595.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=544

 Score =   435 bits (1119),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE A GP+G+ELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPINEAAVGPIGRELFEREQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAM+GKAK QQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPAMIGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+E+LSGYSIDKFEKLKPKM+Q VDDMLGY+IP+LL++F+NPY+
Sbjct  497  NVEHFKEVLSGYSIDKFEKLKPKMIQTVDDMLGYEIPELLRSFKNPYE  544



>ref|XP_009770782.1| PREDICTED: EH domain-containing protein 1-like isoform X4 [Nicotiana 
sylvestris]
Length=543

 Score =   435 bits (1119),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+IPKKACDRRI
Sbjct  376  SLGKVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK Q+RLIDNL DEF K+Q+EHHLPAGDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNF NPYD
Sbjct  496  NVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  543



>ref|XP_008805596.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Phoenix 
dactylifera]
Length=549

 Score =   436 bits (1120),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  322  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  381

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE A GP+G+ELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  382  SLGKVLNTPEVMRVYIGSFNDKPINEAAVGPIGRELFEREQDDLLSDLKDIPKKACDRRI  441

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAM+GKAK QQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  442  NEFVKRARAAKIHAYIISHLKKEMPAMIGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFP  501

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+E+LSGYSIDKFEKLKPKM+Q VDDMLGY+IP+LL++F+NPY+
Sbjct  502  NVEHFKEVLSGYSIDKFEKLKPKMIQTVDDMLGYEIPELLRSFKNPYE  549



>ref|XP_008805597.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Phoenix 
dactylifera]
Length=544

 Score =   435 bits (1119),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE A GP+G+ELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPINEAAVGPIGRELFEREQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAM+GKAK QQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPAMIGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+E+LSGYSIDKFEKLKPKM+Q VDDMLGY+IP+LL++F+NPY+
Sbjct  497  NVEHFKEVLSGYSIDKFEKLKPKMIQTVDDMLGYEIPELLRSFKNPYE  544



>ref|XP_010090952.1| EH domain-containing protein 1 [Morus notabilis]
 gb|EXB41537.1| EH domain-containing protein 1 [Morus notabilis]
Length=510

 Score =   434 bits (1116),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  283  AAKCDLILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  342

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+G +LFEKEQDDLL+DL DIPKKACDRRI
Sbjct  343  SLGKVLNTPEVVRVYIGSFNDKPINEAAVGPIGLDLFEKEQDDLLADLVDIPKKACDRRI  402

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQQRLIDNL +EFAKVQRE HLPAGDFP
Sbjct  403  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQQRLIDNLEEEFAKVQREFHLPAGDFP  462

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+GYSIDKFEKLKPK++Q VDDMLGY+IP+LLKNFRNPYD
Sbjct  463  NVEHFREVLNGYSIDKFEKLKPKLIQTVDDMLGYEIPELLKNFRNPYD  510



>ref|XP_009776641.1| PREDICTED: EH domain-containing protein 1 isoform X4 [Nicotiana 
sylvestris]
Length=470

 Score =   432 bits (1112),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  243  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  302

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE ATGPLGKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  303  SLGKVLNTPEVARVYIGSFNDKPMNEAATGPLGKELFEKEQDDLLTDLKNIPKKACDRRI  362

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  363  NEFVKRARAAKIHAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  422

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  423  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  470



>ref|XP_009598340.1| PREDICTED: EH domain-containing protein 1-like isoform X4 [Nicotiana 
tomentosiformis]
Length=470

 Score =   432 bits (1112),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  243  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  302

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE ATGPLGKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  303  SLGKVLNTPEVARVYIGSFNDKPMNEAATGPLGKELFEKEQDDLLTDLKNIPKKACDRRI  362

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  363  NEFVKRARAAKIHAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  422

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  423  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  470



>ref|XP_009770776.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009770777.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009770778.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=543

 Score =   434 bits (1117),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+VLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+IPKKACDRRI
Sbjct  376  SLGRVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK Q+RLIDNL DEF K+Q+EHHLPAGDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNF NPYD
Sbjct  496  NVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  543



>ref|XP_002885363.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61622.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   434 bits (1117),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  323  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  382

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  383  SLGKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  442

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+LIDNL DEF KVQREHHLP GDFP
Sbjct  443  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLIDNLEDEFGKVQREHHLPKGDFP  502

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+HFRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  503  NVDHFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  550



>ref|XP_009779278.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779279.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779280.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779281.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779282.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779283.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=543

 Score =   434 bits (1116),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+VLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+IPKKACDRRI
Sbjct  376  SLGRVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK Q+RLIDNL DEF K+Q+EHHLPAGDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKEHHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNF NPYD
Sbjct  496  NVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  543



>ref|NP_001058410.1| Os06g0687800 [Oryza sativa Japonica Group]
 dbj|BAD45606.1| putative receptor-mediated endocytosis 1 isoform I [Oryza sativa 
Japonica Group]
 dbj|BAD46062.1| putative receptor-mediated endocytosis 1 isoform I [Oryza sativa 
Japonica Group]
 dbj|BAF20324.1| Os06g0687800 [Oryza sativa Japonica Group]
 gb|EAZ38080.1| hypothetical protein OsJ_22427 [Oryza sativa Japonica Group]
 dbj|BAG93051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=544

 Score =   434 bits (1115),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE+A GP+GKELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVARVYIGSFNDKPVNESAVGPIGKELFEREQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA II HL+KEMPAMMGKAK QQRLIDNL +EFAKVQRE HLPAGDFP
Sbjct  437  NEFVKRARAAKIHAHIIGHLKKEMPAMMGKAKAQQRLIDNLENEFAKVQREQHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFR++L GYSIDKFEK+KPKMVQAVDDMLGYDIP+LLKNFRNPY+
Sbjct  497  YVEHFRDVLGGYSIDKFEKIKPKMVQAVDDMLGYDIPELLKNFRNPYE  544



>ref|XP_006646902.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=542

 Score =   434 bits (1115),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE+A GP+GK+LFEKEQ+DLL DLKDIPKKACDRR+
Sbjct  375  SLGKVLNTPEVARVYIGSFNDKPVNESAVGPIGKDLFEKEQEDLLCDLKDIPKKACDRRV  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMPAMMGKAK QQRLIDNL DEFAKVQRE+HLPAGDFP
Sbjct  435  NEFVKRARAAKIHAYIIGHLKKEMPAMMGKAKAQQRLIDNLGDEFAKVQREYHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+E+L GYSIDKFEK+KPK+VQAVDDML YDIP+LLKNFRNPY+
Sbjct  495  EVEHFKEVLGGYSIDKFEKMKPKLVQAVDDMLAYDIPELLKNFRNPYE  542



>dbj|BAB02809.1| unnamed protein product [Arabidopsis thaliana]
Length=524

 Score =   433 bits (1113),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  297  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  356

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  357  SLGKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  416

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+LIDNL DEF KVQREHHLP GDFP
Sbjct  417  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLIDNLEDEFGKVQREHHLPKGDFP  476

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+HFRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNF+NPYD
Sbjct  477  NVDHFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  524



>ref|XP_010252585.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=536

 Score =   433 bits (1113),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL G+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  309  AAKCDLILLLFDPHKLDISDEFKRVIGSLHGNDDKIRVVLNKADQVDTQQLMRVYGALMW  368

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  369  SLGKVLNTPEVMRVYIGSFNDKPVNEVATGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  428

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRL+DNL DEF+KVQ+E HLPAGDFP
Sbjct  429  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKVQQRLLDNLEDEFSKVQKEFHLPAGDFP  488

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            ++E FREILSGY+IDKFEKLKPKM++AVDDMLGYDIP+LLKNFRNPY+
Sbjct  489  NIEQFREILSGYNIDKFEKLKPKMIKAVDDMLGYDIPELLKNFRNPYE  536



>ref|XP_002264320.1| PREDICTED: EH domain-containing protein 3-like [Vitis vinifera]
Length=545

 Score =   433 bits (1114),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE A GP+GK+LFEKEQDDLL+DL DIPKKACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPVNEAAVGPIGKDLFEKEQDDLLADLIDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRL DNL DEFAK+QRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLTDNLEDEFAKIQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+GYSIDKFEKLKPKM+QAVDDMLGYDIP+LLKNFRNPY+
Sbjct  498  NVEHFREVLNGYSIDKFEKLKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>ref|NP_566657.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 ref|NP_001030731.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 sp|Q94CF0.1|EHD1_ARATH RecName: Full=EH domain-containing protein 1; Short=AtEHD1 [Arabidopsis 
thaliana]
 gb|AAK59418.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42408.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19984.1| AT3G20290 [Arabidopsis thaliana]
 gb|AEE76359.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 gb|AEE76360.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
Length=545

 Score =   433 bits (1114),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+LIDNL DEF KVQREHHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLIDNLEDEFGKVQREHHLPKGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+HFRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNF+NPYD
Sbjct  498  NVDHFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  545



>ref|XP_006406402.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
 gb|ESQ47855.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
Length=443

 Score =   429 bits (1104),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  216  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  275

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSF+DKPINE ATGP+G+ELFE EQDDLLSDLKDIPKKACDRRI
Sbjct  276  SLGKVLNTPEVVRVYIGSFSDKPINEAATGPIGRELFEMEQDDLLSDLKDIPKKACDRRI  335

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+LIDNL D F KVQREHHLP GDFP
Sbjct  336  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFP  395

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  396  NVEHFREVLIGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  443



>ref|XP_003563453.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=545

 Score =   433 bits (1113),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE+A GP+GKELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVSRVYIGSFNDKPVNESAVGPIGKELFEREQDDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+ +MP MMGKAK QQRLIDNL DEFAKVQREHHLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIIGHLKNQMPTMMGKAKAQQRLIDNLQDEFAKVQREHHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+++L GYSIDKFEK+KPKM+QAVDDMLGYDIP+LLKNFRNPY+
Sbjct  498  YVEHFKDVLGGYSIDKFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>gb|EAZ02155.1| hypothetical protein OsI_24244 [Oryza sativa Indica Group]
Length=544

 Score =   433 bits (1113),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 206/228 (90%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE+A GP+GKELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVARVYIGSFNDKPVNESAVGPIGKELFEREQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA II HL+KEMPAMMGKAK QQRLIDNL  EFAKVQRE HLPAGDFP
Sbjct  437  NEFVKRARAAKIHAHIIGHLKKEMPAMMGKAKAQQRLIDNLETEFAKVQREQHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFR++L GYSIDKFEK+KPKMVQAVDDMLGYDIP+LLKNFRNPY+
Sbjct  497  YVEHFRDVLGGYSIDKFEKIKPKMVQAVDDMLGYDIPELLKNFRNPYE  544



>ref|XP_009348303.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=547

 Score =   433 bits (1113),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLL+DLKDIPKKACDRRI
Sbjct  379  SLGKVLNTPEVMRVYIGSFNDKPVNEAATGPVGKELFEKEQEDLLADLKDIPKKACDRRI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA++GKAK QQRLIDNL DEF KVQREHHLP GDFP
Sbjct  439  NEFVKRARAAKIHAYIISHLKKEMPAILGKAKAQQRLIDNLEDEFKKVQREHHLPPGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V+HFR+ILSGYSID FEKLKPKM+ AVD+MLGYDIP+LLKNFRNPYD
Sbjct  499  DVDHFRDILSGYSIDNFEKLKPKMIDAVDEMLGYDIPELLKNFRNPYD  546



>ref|XP_009334157.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=547

 Score =   433 bits (1113),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLL+DLKDIPKKACDRRI
Sbjct  379  SLGKVLNTPEVMRVYIGSFNDKPVNEAATGPVGKELFEKEQEDLLADLKDIPKKACDRRI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA++GKAK QQRLIDNL DEF KVQREHHLP GDFP
Sbjct  439  NEFVKRARAAKIHAYIISHLKKEMPAILGKAKAQQRLIDNLEDEFKKVQREHHLPPGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V+HFR+ILSGYSID FEKLKPKM+ AVD+MLGYDIP+LLKNFRNPYD
Sbjct  499  DVDHFRDILSGYSIDNFEKLKPKMIDAVDEMLGYDIPELLKNFRNPYD  546



>ref|NP_001045954.1| Os02g0158100 [Oryza sativa Japonica Group]
 dbj|BAD28029.1| putative receptor Mediated Endocytosis RME-1 [Oryza sativa Japonica 
Group]
 dbj|BAD28174.1| putative receptor Mediated Endocytosis RME-1 [Oryza sativa Japonica 
Group]
 dbj|BAF07868.1| Os02g0158100 [Oryza sativa Japonica Group]
 gb|EEC72529.1| hypothetical protein OsI_05922 [Oryza sativa Indica Group]
 gb|EEE56343.1| hypothetical protein OsJ_05448 [Oryza sativa Japonica Group]
Length=543

 Score =   432 bits (1112),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE+A GP+GK+LFEKEQDDLL DLKDIPKKACDRR+
Sbjct  376  SLGKVLNTPEVARVYIGSFNDKPVNESAVGPIGKDLFEKEQDDLLCDLKDIPKKACDRRV  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMPAMMGKAK QQRLIDNL DEFAKVQRE+HLPAGDFP
Sbjct  436  NEFVKRARAAKIHAYIIGHLKKEMPAMMGKAKAQQRLIDNLGDEFAKVQREYHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+E+L GY+IDKFEK+KPK+VQAVDDML YDIP+LLKNFRNPY+
Sbjct  496  DVEHFKEVLGGYNIDKFEKMKPKLVQAVDDMLAYDIPELLKNFRNPYE  543



>ref|XP_008359253.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=546

 Score =   432 bits (1112),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLL+DLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPVNEAATGPVGKELFEKEQEDLLADLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA++GKAK QQRLIDNL DEF KVQREHHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAILGKAKAQQRLIDNLEDEFKKVQREHHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V+HFR+ILSGYSID FEKLKPKM+ AVD+MLGYDIP+LLKNFRNPYD
Sbjct  498  DVDHFRDILSGYSIDNFEKLKPKMIDAVDEMLGYDIPELLKNFRNPYD  545



>ref|XP_010313928.1| PREDICTED: EH domain-containing protein 3-like [Solanum lycopersicum]
Length=545

 Score =   432 bits (1112),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPIN+ A GP+GKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  378  SLGKVLNTPEVARVYIGSFNDKPINDAAIGPIGKELFEKEQDDLLTDLKNIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIH++IISHL+KEMPAM+GKAKTQQ+LIDNL D+F KVQ+EHHLPAGDFP
Sbjct  438  NEFVKRARAAKIHSYIISHLKKEMPAMIGKAKTQQKLIDNLEDQFMKVQKEHHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            ++EHFRE+LSGY+IDKFEKLKPK++Q+VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NIEHFREVLSGYNIDKFEKLKPKLIQSVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_006344871.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=545

 Score =   432 bits (1111),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 222/228 (97%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFND+PINE A GP+GKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  378  SLGKVLNTPEVARVYIGSFNDEPINEAAIGPIGKELFEKEQDDLLTDLKNIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIH++IISHL+KEMPAM+GKAKTQQ+L+DNL D+F KVQ+EHHLPAGDFP
Sbjct  438  NEFVKRARAAKIHSYIISHLKKEMPAMIGKAKTQQKLVDNLEDQFMKVQKEHHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGY+IDKFEKLKPK++Q+VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEHFREVLSGYNIDKFEKLKPKLIQSVDDMLGYDIPELLKNFRNPYD  545



>emb|CBI35707.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   433 bits (1114),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  348  AAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  407

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE A GP+GK+LFEKEQDDLL+DL DIPKKACDRRI
Sbjct  408  SLGKVLNTPEVVRVYIGSFNDKPVNEAAVGPIGKDLFEKEQDDLLADLIDIPKKACDRRI  467

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRL DNL DEFAK+QRE HLPAGDFP
Sbjct  468  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLTDNLEDEFAKIQREFHLPAGDFP  527

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+GYSIDKFEKLKPKM+QAVDDMLGYDIP+LLKNFRNPY+
Sbjct  528  NVEHFREVLNGYSIDKFEKLKPKMIQAVDDMLGYDIPELLKNFRNPYE  575



>gb|KJB13767.1| hypothetical protein B456_002G093200 [Gossypium raimondii]
Length=529

 Score =   431 bits (1109),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  302  AAKCDLILLLFDPHKLDVSDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  361

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  362  SLGKVLNTPEVVRVYIGSFNDKPVNEAATGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  421

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II+HL+KEMP+M+GKAKTQQRLIDNL  EF KVQR+HHLP GDFP
Sbjct  422  NEFVKRARAAKIHAYIIAHLKKEMPSMIGKAKTQQRLIDNLEGEFGKVQRDHHLPPGDFP  481

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+EILSGY+ DKFEKLKPKM+QAVDDMLGYDIP+LLK FRNPYD
Sbjct  482  NVEHFKEILSGYNFDKFEKLKPKMIQAVDDMLGYDIPELLKTFRNPYD  529



>ref|XP_009598337.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=546

 Score =   432 bits (1111),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE ATGPLGKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  379  SLGKVLNTPEVARVYIGSFNDKPMNEAATGPLGKELFEKEQDDLLTDLKNIPKKACDRRI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  439  NEFVKRARAAKIHAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  499  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  546



>ref|XP_009776638.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Nicotiana 
sylvestris]
Length=546

 Score =   432 bits (1111),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE ATGPLGKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  379  SLGKVLNTPEVARVYIGSFNDKPMNEAATGPLGKELFEKEQDDLLTDLKNIPKKACDRRI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  439  NEFVKRARAAKIHAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  499  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  546



>dbj|BAJ95881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   432 bits (1110),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+ E+A GP+GKELFEKEQDDLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVSRVYIGSFNDKPVKESAVGPIGKELFEKEQDDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+ +MP+MMGKAK QQ+LIDNL DEFAKVQREHHLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIIGHLKNQMPSMMGKAKAQQKLIDNLEDEFAKVQREHHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE L GYSIDKFEK+KPKM+QAVDDMLGYDIP+LLKNFRNPY+
Sbjct  498  YVEHFREALGGYSIDKFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>ref|XP_009776639.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=545

 Score =   432 bits (1110),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE ATGPLGKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  378  SLGKVLNTPEVARVYIGSFNDKPMNEAATGPLGKELFEKEQDDLLTDLKNIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_009598338.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   432 bits (1110),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE ATGPLGKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  378  SLGKVLNTPEVARVYIGSFNDKPMNEAATGPLGKELFEKEQDDLLTDLKNIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  545



>gb|KJB13765.1| hypothetical protein B456_002G093200 [Gossypium raimondii]
 gb|KJB13768.1| hypothetical protein B456_002G093200 [Gossypium raimondii]
Length=545

 Score =   432 bits (1110),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPVNEAATGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II+HL+KEMP+M+GKAKTQQRLIDNL  EF KVQR+HHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIIAHLKKEMPSMIGKAKTQQRLIDNLEGEFGKVQRDHHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+EILSGY+ DKFEKLKPKM+QAVDDMLGYDIP+LLK FRNPYD
Sbjct  498  NVEHFKEILSGYNFDKFEKLKPKMIQAVDDMLGYDIPELLKTFRNPYD  545



>ref|XP_008226997.1| PREDICTED: EH domain-containing protein 1 [Prunus mume]
Length=545

 Score =   432 bits (1110),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 202/227 (89%), Positives = 219/227 (96%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLL+DLKDIPKK+CDRRI
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPVNEAATGPVGKELFEKEQEDLLADLKDIPKKSCDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAM+GKAKTQQRLIDNL DEF KVQRE HLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAMLGKAKTQQRLIDNLEDEFGKVQREFHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
             V+HFR+ILSGY+IDKFEKLKPKM++AVD+MLGYDIP+LLKNFRNPY
Sbjct  498  DVDHFRDILSGYNIDKFEKLKPKMIEAVDEMLGYDIPELLKNFRNPY  544



>ref|XP_006296699.1| hypothetical protein CARUB_v10013398mg [Capsella rubella]
 gb|EOA29597.1| hypothetical protein CARUB_v10013398mg [Capsella rubella]
Length=545

 Score =   432 bits (1110),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVCRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA++GKAK QQ+LIDNL D F KVQREHHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAIIGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEHFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_007213895.1| hypothetical protein PRUPE_ppa003834mg [Prunus persica]
 gb|EMJ15094.1| hypothetical protein PRUPE_ppa003834mg [Prunus persica]
Length=545

 Score =   431 bits (1109),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 202/227 (89%), Positives = 219/227 (96%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLL+DLKDIPKK+CDRRI
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPVNEAATGPVGKELFEKEQEDLLADLKDIPKKSCDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAM+GKAKTQQRLIDNL DEF KVQRE HLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAMLGKAKTQQRLIDNLEDEFGKVQREFHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
             V+HFR+ILSGY+IDKFEKLKPKM++AVD+MLGYDIP+LLKNFRNPY
Sbjct  498  DVDHFRDILSGYNIDKFEKLKPKMIEAVDEMLGYDIPELLKNFRNPY  544



>gb|KJB13766.1| hypothetical protein B456_002G093200 [Gossypium raimondii]
Length=544

 Score =   431 bits (1109),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDVSDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE ATGP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVVRVYIGSFNDKPVNEAATGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II+HL+KEMP+M+GKAKTQQRLIDNL  EF KVQR+HHLP GDFP
Sbjct  437  NEFVKRARAAKIHAYIIAHLKKEMPSMIGKAKTQQRLIDNLEGEFGKVQRDHHLPPGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHF+EILSGY+ DKFEKLKPKM+QAVDDMLGYDIP+LLK FRNPYD
Sbjct  497  NVEHFKEILSGYNFDKFEKLKPKMIQAVDDMLGYDIPELLKTFRNPYD  544



>ref|XP_006352528.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Solanum 
tuberosum]
Length=541

 Score =   431 bits (1108),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKAD+VDTQQLMRVYGALMW
Sbjct  314  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADKVDTQQLMRVYGALMW  373

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV NTPEV RVYIGSFND PINE  TGPLGKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  374  SLGKVQNTPEVSRVYIGSFNDSPINEDLTGPLGKELFEKEQDDLLTDLKNIPKKACDRRI  433

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK+HA+IISHL+KEMPAMMGK+KTQ+RLIDNLADEF K+Q+EHHLPAGDFP
Sbjct  434  NEFVKRARAAKVHAYIISHLKKEMPAMMGKSKTQKRLIDNLADEFVKIQKEHHLPAGDFP  493

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFREILSGY+IDKFEKLKPK++QAVDDMLGYDIP+LLKNF+NPY+
Sbjct  494  DVEHFREILSGYNIDKFEKLKPKLIQAVDDMLGYDIPELLKNFKNPYE  541



>ref|XP_002453335.1| hypothetical protein SORBIDRAFT_04g004020 [Sorghum bicolor]
 gb|EES06311.1| hypothetical protein SORBIDRAFT_04g004020 [Sorghum bicolor]
Length=547

 Score =   431 bits (1108),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+N++A GP+GK+LFE+EQDDLL DLKDIPKKACDRR+
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPVNDSAVGPIGKDLFEREQDDLLCDLKDIPKKACDRRV  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMPAMMGKAK QQRLIDNL +EFAKVQRE+HLPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIIGHLKKEMPAMMGKAKAQQRLIDNLGEEFAKVQREYHLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+++L GYSIDKFEKLKPKMVQAVDDML +DIP+LLKNFRNPY+
Sbjct  500  DVEHFKQVLGGYSIDKFEKLKPKMVQAVDDMLAHDIPELLKNFRNPYE  547



>ref|XP_006352527.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Solanum 
tuberosum]
Length=543

 Score =   431 bits (1108),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKAD+VDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADKVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV NTPEV RVYIGSFND PINE  TGPLGKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  376  SLGKVQNTPEVSRVYIGSFNDSPINEDLTGPLGKELFEKEQDDLLTDLKNIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK+HA+IISHL+KEMPAMMGK+KTQ+RLIDNLADEF K+Q+EHHLPAGDFP
Sbjct  436  NEFVKRARAAKVHAYIISHLKKEMPAMMGKSKTQKRLIDNLADEFVKIQKEHHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFREILSGY+IDKFEKLKPK++QAVDDMLGYDIP+LLKNF+NPY+
Sbjct  496  DVEHFREILSGYNIDKFEKLKPKLIQAVDDMLGYDIPELLKNFKNPYE  543



>ref|XP_010508763.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=563

 Score =   431 bits (1109),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  336  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  395

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  396  SLGKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  455

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+LIDNL D F KVQREHHLP GDFP
Sbjct  456  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFP  515

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP+LLK+FRNPYD
Sbjct  516  NVEHFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKSFRNPYD  563



>ref|XP_006657273.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=545

 Score =   430 bits (1106),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE+A GP+GKELFE+EQDDLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVARVYIGSFNDKPVNESAVGPIGKELFEREQDDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA II HL+KEMPAMMGKAK QQRLIDNL  EFAKVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAHIIGHLKKEMPAMMGKAKAQQRLIDNLETEFAKVQREQHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEH++++L GYSIDKFEK+KPKMVQAVDDMLGYDIP++LKNFRNPY+
Sbjct  498  YVEHYKDVLGGYSIDKFEKIKPKMVQAVDDMLGYDIPEVLKNFRNPYE  545



>ref|XP_004951833.1| PREDICTED: EH domain-containing protein 1-like [Setaria italica]
Length=597

 Score =   432 bits (1111),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  370  AAKCDLILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  429

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NETA GP+GK+LFE+EQDDLL DLKDIPKKACDR++
Sbjct  430  SLGKVLNTPEVVRVYIGSFNDKPVNETAVGPIGKDLFEREQDDLLCDLKDIPKKACDRQV  489

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMPAMMGKAK QQRLIDNL DEFAKVQRE+HLPAGDFP
Sbjct  490  NEFVKRARAAKIHAYIIGHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQREYHLPAGDFP  549

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+++L GY+IDKFEKLKPKMVQAVDDML YDIP+LLKNF+NPY+
Sbjct  550  DVEHFKQVLGGYNIDKFEKLKPKMVQAVDDMLAYDIPELLKNFKNPYE  597



>ref|XP_003574764.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=545

 Score =   430 bits (1105),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 201/227 (89%), Positives = 216/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE+A GP+GK+LFEKEQ+DLL+DLKDIPKKACDRR+
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPVNESAVGPIGKDLFEKEQEDLLADLKDIPKKACDRRV  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMPA+MGKAK QQRLIDNL DEFAKVQRE+HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIIGHLKKEMPAVMGKAKAQQRLIDNLQDEFAKVQREYHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
              EHF+E+L GYSIDKFEK+KPKMVQAVDDML YDIP+LLKN  NPY
Sbjct  498  DAEHFKEVLGGYSIDKFEKMKPKMVQAVDDMLAYDIPELLKNLSNPY  544



>ref|XP_006406401.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
 gb|ESQ47854.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
Length=545

 Score =   430 bits (1105),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSF+DKPINE ATGP+G+ELFE EQDDLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFSDKPINEAATGPIGRELFEMEQDDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+LIDNL D F KVQREHHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEHFREVLIGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_008458980.1| PREDICTED: EH domain-containing protein 1 [Cucumis melo]
Length=545

 Score =   429 bits (1104),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRG DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGQDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE + GP+G++LF KEQDDLL+DL DIPKKACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPVNEASVGPIGRDLFVKEQDDLLADLIDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+SHL+KEMPAMMGKAKTQQRLIDNL DEF KVQRE+HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIMSHLKKEMPAMMGKAKTQQRLIDNLEDEFGKVQREYHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+GYSIDKFEKLKPKM+QAVDDMLGYDIP+LLKNF+NPY+
Sbjct  498  NVEHFREVLNGYSIDKFEKLKPKMIQAVDDMLGYDIPELLKNFKNPYE  545



>ref|XP_004157728.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=545

 Score =   429 bits (1104),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRG DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGQDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE + GP+G++LF KEQDDLL+DL DIPKKACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPVNEASVGPIGRDLFVKEQDDLLADLIDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+SHL+KEMPAMMGKAKTQQRLIDNL DEF KVQRE+HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIMSHLKKEMPAMMGKAKTQQRLIDNLEDEFGKVQREYHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+GYSIDKFEKLKPKM+QAVDDMLGYDIP+LLKNF+NPY+
Sbjct  498  NVEHFREVLNGYSIDKFEKLKPKMIQAVDDMLGYDIPELLKNFKNPYE  545



>gb|KGN56098.1| hypothetical protein Csa_3G073890 [Cucumis sativus]
Length=562

 Score =   430 bits (1105),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 207/243 (85%), Positives = 220/243 (91%), Gaps = 15/243 (6%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRR-  358
            SLGKVLNTPEV+RVYIGSFNDKP+NE  TGPLGK+LFEKEQ+DLLSDLKDIPKKACDRR 
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPVNEAVTGPLGKDLFEKEQEDLLSDLKDIPKKACDRRV  439

Query  357  --------------INEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEF  220
                          INEFVKRARAAKIHA+IISHLRKEMP M+GKAKTQQRLIDNLADEF
Sbjct  440  SFPSLTILIFLIEMINEFVKRARAAKIHAYIISHLRKEMPTMIGKAKTQQRLIDNLADEF  499

Query  219  AKVQREHHLPAGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRN  40
             KVQRE+HLPAGDFP+VE FRE LSGY+ DKFEKLKPKM+Q+VDDMLGYD+PDLLKNFRN
Sbjct  500  GKVQREYHLPAGDFPNVEQFRETLSGYNFDKFEKLKPKMIQSVDDMLGYDVPDLLKNFRN  559

Query  39   PYD  31
            PYD
Sbjct  560  PYD  562



>ref|XP_010324305.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Solanum 
lycopersicum]
Length=545

 Score =   429 bits (1103),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+ E A GPLGKELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVARVYIGSFNDKPMREAAAGPLGKELFEKEQDDLLTDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_004145425.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=545

 Score =   429 bits (1103),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRG DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGQDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE + GP+G++LF KEQDDLL+DL DIPKKACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPVNEASVGPIGRDLFVKEQDDLLADLIDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+SHL+KEMPAMMGKAKTQQRLIDNL DEF KVQRE+HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIMSHLKKEMPAMMGKAKTQQRLIDNLEDEFGKVQREYHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+GYSIDKFEKLKPKM+QAVDDMLGYDIP+LLKNF+NPY+
Sbjct  498  NVEHFREVLNGYSIDKFEKLKPKMIQAVDDMLGYDIPELLKNFKNPYE  545



>ref|XP_010324304.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Solanum 
lycopersicum]
Length=554

 Score =   429 bits (1104),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  327  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  386

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+ E A GPLGKELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  387  SLGKVLNTPEVARVYIGSFNDKPMREAAAGPLGKELFEKEQDDLLTDLKDIPKKACDRRI  446

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  447  NEFVKRARAAKIHAYIISHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  506

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  507  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  554



>ref|XP_006346193.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=545

 Score =   429 bits (1102),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+ E A GPLGKELFEKEQDDLL+DLK+IPKKACDRRI
Sbjct  378  SLGKVLNTPEVARVYIGSFNDKPMREAAAGPLGKELFEKEQDDLLTDLKNIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_010544277.1| PREDICTED: EH domain-containing protein 1 [Tarenaya hassleriana]
Length=548

 Score =   428 bits (1101),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  321  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  380

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSF+DKPI+E  TGP+GKELFEKEQ+DLL+DLKDIPKKACDRRI
Sbjct  381  SLGKVLNTPEVVRVYIGSFSDKPIDEAFTGPIGKELFEKEQEDLLADLKDIPKKACDRRI  440

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+LIDNL D F KVQREHHLP GDFP
Sbjct  441  NEFVKRARAAKIHAYIISHLKKEMPALMGKAKVQQKLIDNLEDVFGKVQREHHLPRGDFP  500

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE+L+GY+IDKFEKLKPK++QAVDDMLGYDIP+LLKNFRNPYD
Sbjct  501  NVEQFREVLTGYNIDKFEKLKPKLIQAVDDMLGYDIPELLKNFRNPYD  548



>gb|EMT05303.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=545

 Score =   428 bits (1101),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+ E+A GP+GKELFEKEQDDLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVSRVYIGSFNDKPVKESAVGPIGKELFEKEQDDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+ +MP MMGKAK QQ+LIDNL  EFAKVQREHHLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIIGHLKNQMPTMMGKAKAQQKLIDNLEGEFAKVQREHHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE L GYSID+FEK+KPKM+QAVDDMLGYDIP+LLKNFRNPY+
Sbjct  498  YVEHFREALGGYSIDRFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>gb|EMS68080.1| EH domain-containing protein 1 [Triticum urartu]
Length=545

 Score =   428 bits (1100),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+ E+A GP+GKELFEKEQDDLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVSRVYIGSFNDKPVKESAVGPIGKELFEKEQDDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+ +MP MMGKAK QQ+LIDNL  EFAKVQREHHLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIIGHLKNQMPTMMGKAKAQQKLIDNLEGEFAKVQREHHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE L GYSID+FEK+KPKM+QAVDDMLGYDIP+LLKNFRNPY+
Sbjct  498  YVEHFREALGGYSIDRFEKVKPKMIQAVDDMLGYDIPELLKNFRNPYE  545



>emb|CDY50093.1| BnaC01g32680D [Brassica napus]
Length=531

 Score =   427 bits (1098),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  304  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  363

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  364  SLGKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  423

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA IISHL+KEMPA+MGKAK QQ+L+DNL D F KVQREHHLP GDFP
Sbjct  424  NEFVKRARAAKIHACIISHLKKEMPAIMGKAKAQQKLVDNLEDVFGKVQREHHLPKGDFP  483

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  484  NVEQFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  531



>ref|XP_002531194.1| EH-domain-containing protein, putative [Ricinus communis]
 gb|EEF31171.1| EH-domain-containing protein, putative [Ricinus communis]
Length=550

 Score =   427 bits (1099),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 203/227 (89%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  323  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  382

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  383  SLGKVLNTPEVVRVYIGSFNDKPINEDAIGPIGKELFEKEQEDLLSDLKDIPKKACDRRI  442

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+K MP M+GKAK QQRLIDNL +EF KVQ E HLP GDFP
Sbjct  443  NEFVKRARAAKIHAYIISHLKKAMPTMVGKAKAQQRLIDNLGEEFGKVQSEFHLPPGDFP  502

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VE FRE+LSGYSIDKFEKLKPKM+QAVDDMLGYDIP+LLKNFRNPY
Sbjct  503  NVEQFREVLSGYSIDKFEKLKPKMIQAVDDMLGYDIPELLKNFRNPY  549



>ref|XP_004294399.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=545

 Score =   427 bits (1099),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE A+GP+GKELFE+EQ+DLL+DLKDIPKK+CDRRI
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPVNEAASGPIGKELFEREQEDLLADLKDIPKKSCDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPA++GKAKTQQ+L DNL DEF KVQRE HLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLRKEMPALIGKAKTQQKLTDNLEDEFKKVQREFHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE LSGYS D FEKLKP M++AVDDMLGYDIP+LLKNFRNPYD
Sbjct  498  NVEQFRETLSGYSFDNFEKLKPSMIKAVDDMLGYDIPELLKNFRNPYD  545



>ref|XP_009111206.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Brassica 
rapa]
Length=470

 Score =   425 bits (1092),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  243  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  302

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  303  SLGKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  362

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA IISHL+KEMPA+MGKAK QQ+LIDNL D F KVQREHHLP G FP
Sbjct  363  NEFVKRARAAKIHACIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGVFP  422

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  423  NVEQFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  470



>emb|CDY50090.1| BnaC01g32650D [Brassica napus]
Length=570

 Score =   428 bits (1101),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  343  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  402

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  403  SLGKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  462

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA IISHL+KEMPA+MGKAK QQ+LIDNL D F KVQREHHLP GDFP
Sbjct  463  NEFVKRARAAKIHACIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFP  522

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  523  NVEQFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  570



>ref|XP_011461076.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=544

 Score =   427 bits (1098),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  317  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE A+GP+GKELFE+EQ+DLL+DLKDIPKK+CDRRI
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPVNEAASGPIGKELFEREQEDLLADLKDIPKKSCDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPA++GKAKTQQ+L DNL DEF KVQRE HLP GDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLRKEMPALIGKAKTQQKLTDNLEDEFKKVQREFHLPPGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE LSGYS D FEKLKP M++AVDDMLGYDIP+LLKNFRNPYD
Sbjct  497  NVEQFRETLSGYSFDNFEKLKPSMIKAVDDMLGYDIPELLKNFRNPYD  544



>gb|EMT01492.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=556

 Score =   427 bits (1099),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 218/227 (96%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  329  AAKCDVILLLFDPHKLDISDEFKRVISSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  388

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE+A GP+GKELFEKEQ+DLL+DLKDIPKKACDRR+
Sbjct  389  SLGKVLNTPEVMRVYIGSFNDKPVNESAVGPIGKELFEKEQEDLLADLKDIPKKACDRRV  448

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II  L+KEMPAMMGKAK QQRLIDNL DEFAKVQRE+HLPAGDFP
Sbjct  449  NEFVKRARAAKIHAYIIGQLKKEMPAMMGKAKAQQRLIDNLQDEFAKVQREYHLPAGDFP  508

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
             VEHF+++L+GYSIDKFEK+KPKMVQAVDDML +DIPDLLKNF NPY
Sbjct  509  DVEHFKQVLAGYSIDKFEKMKPKMVQAVDDMLAHDIPDLLKNFSNPY  555



>ref|XP_010422242.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=428

 Score =   423 bits (1087),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  201  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  260

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL DIPKKACDR+I
Sbjct  261  SLGKVLNTPEVVRVYIGSFNDKPINEAAVGPIGKELFEKEQNDLLADLMDIPKKACDRKI  320

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHLRKEMPAMMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  321  NEFVKRARAAKINAYIMSHLRKEMPAMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFP  380

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPYD
Sbjct  381  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  428



>ref|XP_010665753.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   426 bits (1096),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPI+  A GP+G++LFE+EQ+DLL+DLKDIPKKACDRRI
Sbjct  376  SLGKVLNTPEVSRVYIGSFNDKPIDAEAVGPMGRDLFEREQNDLLNDLKDIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NE+VKRARAAKIHA+IISHL+KEMP+MMGKAK QQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  436  NEYVKRARAAKIHAYIISHLKKEMPSMMGKAKAQQRLIDNLEDEFAKVQREFHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             +EHFRE+L GYSIDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRNPY+
Sbjct  496  YLEHFREVLGGYSIDKFEKLKPKMIQNVDDMLGYDIPELLKNFRNPYE  543



>ref|NP_001140588.1| uncharacterized protein LOC100272658 [Zea mays]
 gb|ACF84132.1| unknown [Zea mays]
 gb|AFW66483.1| EH-domain-containing protein 1 [Zea mays]
Length=547

 Score =   427 bits (1097),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+N++A GP+GK+LFE+EQDDLL DLKDIPKKACDRR+
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPVNDSAVGPIGKDLFEREQDDLLCDLKDIPKKACDRRV  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMPAMMGKAK QQRLIDNL +EFAKVQRE+HLPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIIGHLKKEMPAMMGKAKAQQRLIDNLDEEFAKVQREYHLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+++L GYSIDKFEKLKPKMVQAVDDML +DIP+LLKN RNPY+
Sbjct  500  DVEHFKQVLGGYSIDKFEKLKPKMVQAVDDMLAHDIPELLKNLRNPYE  547



>gb|KHN38249.1| EH domain-containing protein 1 [Glycine soja]
Length=546

 Score =   426 bits (1096),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVL TPEVMRVYIGSFNDKP+N+ ATGPLGKELFEKEQDDLLSDLKD+PK ACDRRI
Sbjct  379  SLGKVLKTPEVMRVYIGSFNDKPVNDAATGPLGKELFEKEQDDLLSDLKDVPKAACDRRI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAM+GKAK QQ+LIDNLA EF KVQRE HLP GDFP
Sbjct  439  NEFVKRARAAKIHAYIISHLKKEMPAMIGKAKAQQKLIDNLAAEFGKVQREFHLPPGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE LSGY+IDKFEKLKPKM QAVDDML YDIP+LLKNFRNPYD
Sbjct  499  NVEFFRERLSGYNIDKFEKLKPKMTQAVDDMLAYDIPNLLKNFRNPYD  546



>ref|XP_003519595.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=543

 Score =   426 bits (1095),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVL TPEVMRVYIGSFNDKP+N+ ATGPLGKELFEKEQDDLLSDLKD+PK ACDRRI
Sbjct  376  SLGKVLKTPEVMRVYIGSFNDKPVNDAATGPLGKELFEKEQDDLLSDLKDVPKAACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAM+GKAK QQ+LIDNLA EF KVQRE HLP GDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMIGKAKAQQKLIDNLAAEFGKVQREFHLPPGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE LSGY+IDKFEKLKPKM QAVDDML YDIP+LLKNFRNPYD
Sbjct  496  NVEFFRERLSGYNIDKFEKLKPKMTQAVDDMLAYDIPNLLKNFRNPYD  543



>ref|XP_010052899.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW77035.1| hypothetical protein EUGRSUZ_D01381 [Eucalyptus grandis]
Length=547

 Score =   426 bits (1095),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 220/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+N+   GP+G++LFEKEQDDLL+DL DIPKKACDRRI
Sbjct  380  SLGKVLNTPEVARVYIGSFNDKPVNDGIVGPIGRDLFEKEQDDLLADLIDIPKKACDRRI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL DEFAKVQR++HLPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQRDYHLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SV+HFRE+LSGY+IDKFEKLKPKM+QAVDDMLGY+IP+LLKNFRNPY+
Sbjct  500  SVDHFREVLSGYNIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  547



>ref|XP_006287437.1| hypothetical protein CARUB_v10000641mg [Capsella rubella]
 gb|EOA20335.1| hypothetical protein CARUB_v10000641mg [Capsella rubella]
Length=545

 Score =   426 bits (1094),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL DIPKKACDR+I
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPINEAAVGPIGKELFEKEQNDLLADLMDIPKKACDRKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL +EF KVQRE+HLPAGDFP
Sbjct  438  NEFVKRARAAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQREYHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPYD
Sbjct  498  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  545



>dbj|BAJ86819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score =   426 bits (1095),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 199/227 (88%), Positives = 218/227 (96%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDVILLLFDPHKLDISDEFKRVISSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE+A GP+GKELFEKEQ+DLL+DLKDIPKKACDRR+
Sbjct  380  SLGKVLNTPEVMRVYIGSFNDKPVNESAVGPIGKELFEKEQEDLLADLKDIPKKACDRRV  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II  L+KEMPAM+GKAK QQRLIDNL DEFAKVQRE+HLPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIIGQLKKEMPAMIGKAKAQQRLIDNLQDEFAKVQREYHLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
             VEHF+++L+GYSIDKFEK+KPKMVQAVDDML +DIPDLLKNF NPY
Sbjct  500  DVEHFKQVLAGYSIDKFEKIKPKMVQAVDDMLAHDIPDLLKNFSNPY  546



>ref|XP_008224739.1| PREDICTED: EH domain-containing protein 1-like [Prunus mume]
 ref|XP_008224740.1| PREDICTED: EH domain-containing protein 1-like [Prunus mume]
Length=537

 Score =   425 bits (1093),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  310  AAKCDVILLLFDPHKLDISDEFKRVITSLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  369

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE+A GP+GKELFEKEQ+DLL+DL DIPKKACDRRI
Sbjct  370  SLGKVLNTPEVVRVYIGSFNDKPVNESAVGPMGKELFEKEQNDLLADLVDIPKKACDRRI  429

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK HA+IISHL+KEMPAMMGK KTQQRL+DNL DEFAKVQR+ HLPAGDFP
Sbjct  430  NEFVKRARAAKTHAYIISHLKKEMPAMMGKTKTQQRLMDNLEDEFAKVQRDFHLPAGDFP  489

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+L GY+IDKFEKLKPKM+QAVDDMLG +IP+LLKNFRNPYD
Sbjct  490  DVEHFREVLKGYNIDKFEKLKPKMIQAVDDMLGREIPELLKNFRNPYD  537



>ref|NP_001266688.1| EH-domain-containing protein 1 [Zea mays]
 gb|ACG43126.1| EH-domain-containing protein 1 [Zea mays]
Length=547

 Score =   425 bits (1093),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+N++A GP+GK+LFE+EQDDLL DLKDIPKKACDRR+
Sbjct  380  SLGKVLNTPEVARVYIGSFNDKPVNDSAVGPIGKDLFEREQDDLLCDLKDIPKKACDRRV  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HL+KEMPA+MGKAK QQRLIDNL +EFAKVQRE+HLPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIIGHLKKEMPAVMGKAKAQQRLIDNLEEEFAKVQREYHLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+++L GYSIDKFEKLKPKMVQAVDDML +DIP+LLKN RNPY+
Sbjct  500  DVEHFKQVLGGYSIDKFEKLKPKMVQAVDDMLAHDIPELLKNLRNPYE  547



>ref|XP_010327191.1| PREDICTED: EH domain-containing protein 1-like [Solanum lycopersicum]
Length=547

 Score =   425 bits (1092),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKAD+VDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVIASLQGHDDKIRVVLNKADKVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV NTPEV RVYIGSFND PINE  TGPLGKELFEKEQDDLL+DLK+IPKKACDRR+
Sbjct  380  SLGKVQNTPEVSRVYIGSFNDSPINEDLTGPLGKELFEKEQDDLLTDLKNIPKKACDRRV  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK+HA+I SHL+KEMPAMMGK+KTQ+RLIDNLADEF K+Q+EHHLP GDFP
Sbjct  440  NEFVKRARAAKVHAYITSHLKKEMPAMMGKSKTQKRLIDNLADEFVKIQKEHHLPPGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V+HFREILSGY+IDKFEKLKPK++QAVDDMLGYDIP+LLKNF+NPY+
Sbjct  500  DVQHFREILSGYNIDKFEKLKPKLIQAVDDMLGYDIPELLKNFKNPYE  547



>ref|XP_003529656.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=545

 Score =   425 bits (1092),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFN KPINE   GPLG+ELFEKEQ+DLL+DL DIP+KACD RI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNVKPINEGFVGPLGQELFEKEQNDLLADLVDIPRKACDSRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHLR EMPAMMGKAKTQQRLIDNL DEF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARSAKIHAYIISHLRNEMPAMMGKAKTQQRLIDNLEDEFRKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPKM+QAVDDMLGY+IP+LLK FRNPYD
Sbjct  498  NVEHFREVLSGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  545



>ref|XP_009361045.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=546

 Score =   425 bits (1092),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 219/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE ATGP+G+ELFE+EQ+DLL+DLKDIPKKACDRRI
Sbjct  379  SLGKVLNTPEVMRVYIGSFNDKPVNEAATGPVGRELFEREQEDLLADLKDIPKKACDRRI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMPAM+GK+K Q++LIDNL +EF KVQREHHLP GDFP
Sbjct  439  NEFVKRARAAKIHAYIISHLRKEMPAMLGKSKAQRKLIDNLENEFKKVQREHHLPPGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+H++EIL+GYSIDK E+LKPKM+ AVD+MLGYDIP+LLK FRNPYD
Sbjct  499  NVDHYKEILTGYSIDKLERLKPKMIDAVDEMLGYDIPELLKKFRNPYD  546



>ref|XP_009111201.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Brassica 
rapa]
Length=546

 Score =   425 bits (1092),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  319  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  379  SLGKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA IISHL+KEMPA+MGKAK QQ+LIDNL D F KVQREHHLP G FP
Sbjct  439  NEFVKRARAAKIHACIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGVFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  499  NVEQFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD  546



>ref|XP_007142331.1| hypothetical protein PHAVU_008G271300g [Phaseolus vulgaris]
 gb|ESW14325.1| hypothetical protein PHAVU_008G271300g [Phaseolus vulgaris]
Length=543

 Score =   424 bits (1091),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVL TPEVMRVYIGSF+D P+N+ ATGPLGKELFEKEQDDLLSDLKDIPK ACDRRI
Sbjct  376  SLGKVLKTPEVMRVYIGSFSDNPVNDAATGPLGKELFEKEQDDLLSDLKDIPKAACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAM+GK+K QQ+LIDNLA EF KVQRE HLPAGDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMIGKSKAQQKLIDNLAAEFGKVQREFHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE+FRE LSGY+IDKFEKLKPKM+QAVDDML YDIP+LLK+FRNPYD
Sbjct  496  NVEYFRERLSGYNIDKFEKLKPKMIQAVDDMLAYDIPNLLKSFRNPYD  543



>ref|XP_010455719.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=545

 Score =   424 bits (1090),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL DIPKKACDR+I
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPINEAAVGPIGKELFEKEQNDLLADLMDIPKKACDRKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPYD
Sbjct  498  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  545



>ref|XP_010455720.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=544

 Score =   424 bits (1090),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL DIPKKACDR+I
Sbjct  377  SLGKVLNTPEVVRVYIGSFNDKPINEAAVGPIGKELFEKEQNDLLADLMDIPKKACDRKI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  437  NEFVKRARAAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPYD
Sbjct  497  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  544



>ref|XP_011097835.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Sesamum 
indicum]
Length=538

 Score =   424 bits (1089),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  311  ASKCDLILLLFDPHKLDISDEFKRVIESLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  370

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI E   GP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  371  SLGKVLNTPEVMRVYIGSFNDKPIREGVGGPMGKELFEKEQEDLLSDLKDIPKKACDRRI  430

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLR EMP M+GKAKTQ+RLID+L DEFAKVQREHHLPAGDFP
Sbjct  431  NEFVKRARAAKIHAYIIGHLRNEMPTMIGKAKTQKRLIDDLGDEFAKVQREHHLPAGDFP  490

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+LSGYSID+FE+LKPKM+Q+VDDML +DIP LL+ FRNPYD
Sbjct  491  DVEHFRELLSGYSIDRFERLKPKMIQSVDDMLAHDIPQLLQKFRNPYD  538



>ref|XP_011097837.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Sesamum 
indicum]
Length=537

 Score =   424 bits (1089),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  310  ASKCDLILLLFDPHKLDISDEFKRVIESLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  369

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI E   GP+GKELFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  370  SLGKVLNTPEVMRVYIGSFNDKPIREGVGGPMGKELFEKEQEDLLSDLKDIPKKACDRRI  429

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLR EMP M+GKAKTQ+RLID+L DEFAKVQREHHLPAGDFP
Sbjct  430  NEFVKRARAAKIHAYIIGHLRNEMPTMIGKAKTQKRLIDDLGDEFAKVQREHHLPAGDFP  489

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+LSGYSID+FE+LKPKM+Q+VDDML +DIP LL+ FRNPYD
Sbjct  490  DVEHFRELLSGYSIDRFERLKPKMIQSVDDMLAHDIPQLLQKFRNPYD  537



>ref|XP_009357511.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=481

 Score =   422 bits (1084),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  254  AAKCDVILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  313

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE   GP+GKELFEKEQDDLLSDL DIPKKACDRRI
Sbjct  314  SLGKVLNTPEVVRVYIGSFNDKPVNEGVVGPIGKELFEKEQDDLLSDLVDIPKKACDRRI  373

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+SHL+KEMPA+MGK+K Q++LIDNL +EFAKVQR+ HLPAGDFP
Sbjct  374  NEFVKRARAAKIHAYIMSHLKKEMPAVMGKSKAQRKLIDNLEEEFAKVQRDFHLPAGDFP  433

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+L GYSIDKF+KLKPKM+QAVDDMLGYDIP+LLK FRNPY+
Sbjct  434  DVEHFREVLGGYSIDKFDKLKPKMIQAVDDMLGYDIPELLKKFRNPYN  481



>ref|XP_008799457.1| PREDICTED: EH domain-containing protein 1-like [Phoenix dactylifera]
Length=544

 Score =   424 bits (1089),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDL+LLLFDPHK DISDEFKRVI SL GHDDKIRV+LNKADQVDTQQLMRVYGAL+W
Sbjct  317  AAKCDLMLLLFDPHKLDISDEFKRVIGSLHGHDDKIRVILNKADQVDTQQLMRVYGALLW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMR+YIGSFNDKP+NE   GP+GKELFE+EQ+DLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVMRIYIGSFNDKPVNEAVVGPIGKELFEREQEDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQQRLID+L DEFAKVQ+E HLP GDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQQRLIDDLEDEFAKVQKEFHLPIGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+HF+E+LSGY+IDKFEKLKPKM+QAVDDML YDIPDLL+ FRNPYD
Sbjct  497  NVDHFKEVLSGYNIDKFEKLKPKMIQAVDDMLAYDIPDLLRRFRNPYD  544



>ref|XP_007211540.1| hypothetical protein PRUPE_ppa003972mg [Prunus persica]
 gb|EMJ12739.1| hypothetical protein PRUPE_ppa003972mg [Prunus persica]
Length=537

 Score =   424 bits (1089),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVI+SL GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  310  AAKCDVILLLFDPHKLDISDEFKRVITSLSGHDDKIRVVLNKADQVDTQQLMRVYGALMW  369

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE+A GP+GKELFEKEQ++LL+DL DIPKKACDRRI
Sbjct  370  SLGKVLNTPEVVRVYIGSFNDKPVNESAVGPMGKELFEKEQNNLLADLVDIPKKACDRRI  429

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK HA+IISHL+KEMPAMMGKAKTQQRL+DNL DEFAKVQR+ HLPAGDFP
Sbjct  430  NEFVKRARAAKTHAYIISHLKKEMPAMMGKAKTQQRLMDNLEDEFAKVQRDFHLPAGDFP  489

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHF+E+L GY+IDKFEKLKPKM+QAVDDMLG +IP+LLKNFRNPYD
Sbjct  490  DVEHFKEVLKGYNIDKFEKLKPKMIQAVDDMLGREIPELLKNFRNPYD  537



>gb|EYU33672.1| hypothetical protein MIMGU_mgv1a004199mg [Erythranthe guttata]
Length=539

 Score =   423 bits (1088),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  312  AAKCDLILLLFDPHKLDISDEFKRVIESLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  371

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPINE + GPLG ELFE+EQDDLL+DLKDIPKKACDRRI
Sbjct  372  SLGKVLNTPEVNRVYIGSFNDKPINEASAGPLGLELFEREQDDLLNDLKDIPKKACDRRI  431

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+SHL+ EMP+MMGKAK QQ+LIDNLADEFAKVQREHHLPAGDFP
Sbjct  432  NEFVKRARAAKIHAYIMSHLKNEMPSMMGKAKAQQKLIDNLADEFAKVQREHHLPAGDFP  491

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE F++ L+GY+IDKFE++KPKM+Q+VDDML YDIP LLKNFRNPYD
Sbjct  492  NVEQFKDKLNGYNIDKFERMKPKMIQSVDDMLAYDIPQLLKNFRNPYD  539



>gb|KDP20684.1| hypothetical protein JCGZ_21155 [Jatropha curcas]
Length=545

 Score =   424 bits (1089),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 202/227 (89%), Positives = 216/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE    P+  ELFEKEQDDLL DL DIPKKACDRRI
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPINEETVNPMFLELFEKEQDDLLMDLVDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAKTQQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +V+HF+E+L+GYSIDKFEKLKPKM+QAVDDMLGY+IP+LLKNFRNPY
Sbjct  498  NVDHFKEVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPY  544



>ref|XP_002874791.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51050.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   423 bits (1088),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL DIPKKACDR+I
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPINEDAVGPIGKELFEKEQNDLLADLMDIPKKACDRKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPYD
Sbjct  498  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  545



>ref|XP_010928404.1| PREDICTED: EH domain-containing protein 1-like [Elaeis guineensis]
Length=545

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL GHDDKIRVVLNKADQVDTQQLMRVYGAL+W
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLHGHDDKIRVVLNKADQVDTQQLMRVYGALLW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDK +NE A GP+GKELFE+EQ+DLLSDLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKLVNEAAVGPVGKELFEREQEDLLSDLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAKTQQRLID+L DEFAKVQRE HLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKTQQRLIDDLEDEFAKVQREFHLPIGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            + +HFRE+LSGY+IDKFEKLKPKM+QAVDDML YDIP+LL+ FRNPYD
Sbjct  498  NADHFREVLSGYNIDKFEKLKPKMIQAVDDMLAYDIPELLQRFRNPYD  545



>ref|XP_010433120.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=544

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL DIPKKACDR+I
Sbjct  377  SLGKVLNTPEVVRVYIGSFNDKPINEAAVGPIGKELFEKEQNDLLADLMDIPKKACDRKI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMP MMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  437  NEFVKRARAAKINAYIMSHLKKEMPTMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKMVQAVDDMLGYDIPDLLK FRNPYD
Sbjct  497  SVEHFREVLGGYNIDKFEKLKPKMVQAVDDMLGYDIPDLLKKFRNPYD  544



>ref|XP_010433113.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=545

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/228 (87%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL DIPKKACDR+I
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPINEAAVGPIGKELFEKEQNDLLADLMDIPKKACDRKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMP MMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKINAYIMSHLKKEMPTMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKMVQAVDDMLGYDIPDLLK FRNPYD
Sbjct  498  SVEHFREVLGGYNIDKFEKLKPKMVQAVDDMLGYDIPDLLKKFRNPYD  545



>ref|XP_003617631.1| EH-domain-containing protein [Medicago truncatula]
 gb|AET00590.1| calcium-binding EF hand protein [Medicago truncatula]
Length=543

 Score =   423 bits (1087),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+N+  +GP+GKELFEKEQ+DLLSDLKDIPK ACDRRI
Sbjct  376  SLGKVLNTPEVTRVYIGSFNDKPVNDAVSGPIGKELFEKEQEDLLSDLKDIPKAACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQ+LIDNLA EF KVQRE HLP GDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQKLIDNLAGEFGKVQREFHLPPGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE LSGY+IDKFEKLKPKM+Q VDDML YDIP+LLKNF+NPYD
Sbjct  496  NVEHFRESLSGYNIDKFEKLKPKMLQVVDDMLAYDIPNLLKNFKNPYD  543



>ref|XP_007026226.1| EPS15 domain 2 isoform 2 [Theobroma cacao]
 gb|EOY28848.1| EPS15 domain 2 isoform 2 [Theobroma cacao]
Length=544

 Score =   423 bits (1087),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDK +NE A GPLG++LFEKEQDDLL DL DIP+KACDRRI
Sbjct  377  SLGKVLNTPEVVRVYIGSFNDKLLNEAAIGPLGQDLFEKEQDDLLKDLIDIPRKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL DEF KVQR+ HLPAGDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVQRDFHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEH+RE+L+GYSIDKFEKLKPKM+QAVDDMLGY+IP+LLKNFRNPY+
Sbjct  497  SVEHYREVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  544



>ref|XP_003550477.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=545

 Score =   423 bits (1087),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL GHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPIN+   GPLG+ELFEKEQ+DLL+DL DIP+KACD RI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPINKGFVGPLGQELFEKEQNDLLADLVDIPRKACDSRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHLR EMPAMMGKAKTQQRLIDNL DEF KVQRE+HLPAGDFP
Sbjct  438  NEFVKRARSAKIHAYIISHLRNEMPAMMGKAKTQQRLIDNLEDEFRKVQREYHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VEHFRE+LSGYSIDKFEKLKPKM+QAVDDMLGY+IP+LLK FRNPY
Sbjct  498  NVEHFREVLSGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPY  544



>ref|NP_567299.2| EPS15 homology domain 2 protein [Arabidopsis thaliana]
 sp|B3LF48.1|EHD2_ARATH RecName: Full=EH domain-containing protein 2; Short=AtEHD2 [Arabidopsis 
thaliana]
 gb|ACE79044.1| At4g05520 [Arabidopsis thaliana]
 gb|AEE82529.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
Length=546

 Score =   423 bits (1087),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL D+PKKACDR+I
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPINEVAVGPIGKELFEKEQNDLLADLMDVPKKACDRKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARSAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPYD
Sbjct  498  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  545



>ref|NP_974517.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
 gb|AEE82530.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
Length=545

 Score =   423 bits (1087),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL D+PKKACDR+I
Sbjct  377  SLGKVLNTPEVVRVYIGSFNDKPINEVAVGPIGKELFEKEQNDLLADLMDVPKKACDRKI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  437  NEFVKRARSAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVQREFHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPYD
Sbjct  497  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  544



>ref|XP_007026225.1| EPS15 domain 2 isoform 1 [Theobroma cacao]
 gb|EOY28847.1| EPS15 domain 2 isoform 1 [Theobroma cacao]
Length=545

 Score =   422 bits (1086),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDK +NE A GPLG++LFEKEQDDLL DL DIP+KACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKLLNEAAIGPLGQDLFEKEQDDLLKDLIDIPRKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL DEF KVQR+ HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVQRDFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEH+RE+L+GYSIDKFEKLKPKM+QAVDDMLGY+IP+LLKNFRNPY+
Sbjct  498  SVEHYREVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  545



>ref|XP_007026228.1| EPS15 domain 2 isoform 4 [Theobroma cacao]
 gb|EOY28850.1| EPS15 domain 2 isoform 4 [Theobroma cacao]
Length=546

 Score =   422 bits (1086),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDK +NE A GPLG++LFEKEQDDLL DL DIP+KACDRRI
Sbjct  379  SLGKVLNTPEVVRVYIGSFNDKLLNEAAIGPLGQDLFEKEQDDLLKDLIDIPRKACDRRI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL DEF KVQR+ HLPAGDFP
Sbjct  439  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVQRDFHLPAGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEH+RE+L+GYSIDKFEKLKPKM+QAVDDMLGY+IP+LLKNFRNPY+
Sbjct  499  SVEHYREVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  546



>ref|XP_007154000.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
 gb|ESW25994.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
Length=543

 Score =   422 bits (1085),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI +L GHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIGALHGHDDKIRVVLNKADQIDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE   GP G+ELFEKEQ+DLL+DL DIP+KACD RI
Sbjct  376  SLGKVLNTPEVMRVYIGSFNDKPINEGFVGPFGQELFEKEQNDLLADLVDIPRKACDSRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHLR EMPAMMGKAK QQRLI+NL DEF KVQRE HLPAGDFP
Sbjct  436  NEFVKRARSAKIHAYIISHLRNEMPAMMGKAKAQQRLIENLEDEFRKVQREFHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPKM+QAVDDMLGY+IP+LLK FRNPYD
Sbjct  496  NVEHFREVLSGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  543



>ref|XP_008384122.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=541

 Score =   422 bits (1085),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  314  AAKCDVILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  373

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE   GP+GKELFEKEQDDLLSDL DIPKKACDRRI
Sbjct  374  SLGKVLNTPEVVRVYIGSFNDKPVNEGVVGPIGKELFEKEQDDLLSDLVDIPKKACDRRI  433

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+SHL+KEMPA+MGK+K Q++LIDNL +EFAKVQR+ HLPAGDFP
Sbjct  434  NEFVKRARAAKIHAYIMSHLKKEMPAVMGKSKAQRKLIDNLEEEFAKVQRDFHLPAGDFP  493

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+L GYSIDKF+KLKPKM+QAVDDMLGYDIP+LLK FRNPY+
Sbjct  494  DVEHFREVLGGYSIDKFDKLKPKMIQAVDDMLGYDIPELLKKFRNPYN  541



>ref|XP_004491428.1| PREDICTED: EH domain-containing protein 3-like [Cicer arietinum]
Length=543

 Score =   422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+N   +GP+GKELFEKEQ+DLLSDLKDIPK ACDRRI
Sbjct  376  SLGKVLNTPEVIRVYIGSFNDKPVNNAVSGPIGKELFEKEQEDLLSDLKDIPKAACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQ+LIDNLA EF KVQRE HLP GDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQKLIDNLAGEFGKVQREFHLPPGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE L GY+IDKFEKLKPKM+Q VDDML YDIP+LLKNF+NPYD
Sbjct  496  NVEHFRESLRGYNIDKFEKLKPKMIQVVDDMLAYDIPNLLKNFKNPYD  543



>ref|XP_009357509.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=541

 Score =   422 bits (1084),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  314  AAKCDVILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  373

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE   GP+GKELFEKEQDDLLSDL DIPKKACDRRI
Sbjct  374  SLGKVLNTPEVVRVYIGSFNDKPVNEGVVGPIGKELFEKEQDDLLSDLVDIPKKACDRRI  433

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+SHL+KEMPA+MGK+K Q++LIDNL +EFAKVQR+ HLPAGDFP
Sbjct  434  NEFVKRARAAKIHAYIMSHLKKEMPAVMGKSKAQRKLIDNLEEEFAKVQRDFHLPAGDFP  493

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+L GYSIDKF+KLKPKM+QAVDDMLGYDIP+LLK FRNPY+
Sbjct  494  DVEHFREVLGGYSIDKFDKLKPKMIQAVDDMLGYDIPELLKKFRNPYN  541



>gb|KHN03510.1| EH domain-containing protein 1 [Glycine soja]
Length=545

 Score =   422 bits (1084),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 199/227 (88%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL GHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIGSLHGHDDKIRVVLNKADQIDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+VLNTPEV+RVYIGSFNDKPIN+   GPLG+ELFEKEQ+DLL+DL DIP+KACD RI
Sbjct  378  SLGRVLNTPEVVRVYIGSFNDKPINKGFVGPLGQELFEKEQNDLLADLVDIPRKACDSRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHLR EMPAMMGKAKTQQRLIDNL DEF KVQRE+HLPAGDFP
Sbjct  438  NEFVKRARSAKIHAYIISHLRNEMPAMMGKAKTQQRLIDNLEDEFRKVQREYHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VEHFRE+LSGYSIDKFEKLKPKM+QAVDDMLGY+IP+LLK FRNPY
Sbjct  498  NVEHFREVLSGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPY  544



>emb|CDY29816.1| BnaC05g31740D [Brassica napus]
Length=526

 Score =   421 bits (1082),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  299  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  358

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE +TGP+G+ELFE EQ+DLLSDLK+IPKKACDRRI
Sbjct  359  SLGKVLNTPEVARVYIGSFSDKPINEVSTGPIGRELFEMEQEDLLSDLKNIPKKACDRRI  418

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+L+DNL D F KVQREHHLP GDFP
Sbjct  419  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLMDNLEDVFGKVQREHHLPKGDFP  478

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+HFRE+LSGY+ DKFEKLKPKM+Q VDDMLGYDIP+LLKNF+NPYD
Sbjct  479  NVDHFREVLSGYNFDKFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  526



>gb|EPS68571.1| hypothetical protein M569_06192, partial [Genlisea aurea]
Length=541

 Score =   422 bits (1084),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 201/225 (89%), Positives = 211/225 (94%), Gaps = 0/225 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPIN    GPLG +LFEKEQ+DLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPINVNVVGPLGGDLFEKEQEDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA IISHL+K MPAMMGKAK QQ+LIDNLADEFAKVQREHHLP GDFP
Sbjct  437  NEFVKRARAAKIHACIISHLKKAMPAMMGKAKAQQKLIDNLADEFAKVQREHHLPVGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRN  40
            ++EHFR+ L GY+IDKFEKLKPKM+Q VDDMLGYDIP+LLKNFRN
Sbjct  497  NMEHFRDTLGGYNIDKFEKLKPKMIQTVDDMLGYDIPELLKNFRN  541



>ref|XP_010466211.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=545

 Score =   422 bits (1084),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFD HK D+SDEFKRVISSLRGHDDK RVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDLILLLFDRHKLDVSDEFKRVISSLRGHDDKSRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  378  SLGKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMP +MGKAK QQ+LIDNL D F KVQREHHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPTLMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP LLK+F+NPYD
Sbjct  498  NVEHFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPQLLKSFKNPYD  545



>gb|AFK42442.1| unknown [Medicago truncatula]
Length=543

 Score =   421 bits (1081),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEF RVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFNRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+N+  +GP+GKELFEKEQ+DLLSDLKDIPK ACDRRI
Sbjct  376  SLGKVLNTPEVTRVYIGSFNDKPVNDAVSGPIGKELFEKEQEDLLSDLKDIPKAACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQ+LIDNLA EF KVQRE HLP  DFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQKLIDNLAGEFGKVQREFHLPPSDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE LSGY+IDKFEKLKPKM+Q VDDML YDIP+LLKNF+NPYD
Sbjct  496  NVEHFRESLSGYNIDKFEKLKPKMLQVVDDMLAYDIPNLLKNFKNPYD  543



>ref|XP_004486203.1| PREDICTED: EH domain-containing protein 1-like [Cicer arietinum]
Length=542

 Score =   419 bits (1078),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 199/228 (87%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVISSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP +E   GPLGK LFEKEQ+DLL+DL DIPKKACDRRI
Sbjct  375  SLGKVLNTPEVARVYIGSFNDKPTDEGFVGPLGKNLFEKEQNDLLTDLLDIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHL+KEMPA+MGKAKTQQ+LIDNL  EFAKV+RE HLPAGDFP
Sbjct  435  NEFVKRARSAKIHAYIISHLKKEMPAIMGKAKTQQKLIDNLDSEFAKVKREFHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHF+E+LSGYSIDKFEKLKPKM+QA+DDMLGY+IP+LLK FRNPYD
Sbjct  495  SVEHFKEVLSGYSIDKFEKLKPKMIQAIDDMLGYEIPELLKKFRNPYD  542



>gb|KFK39351.1| hypothetical protein AALP_AA3G233100 [Arabis alpina]
Length=543

 Score =   419 bits (1078),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 198/227 (87%), Positives = 216/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSF+DKPIN++ TGP+G+ELFE EQDDLLSDLKDIPKKACDRRI
Sbjct  376  SLGKVLNTPEVVRVYIGSFSDKPINKSLTGPIGRELFEMEQDDLLSDLKDIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRA+AAKIHA IISHL+KEMPA+MGKAK QQ+LIDNL D FAKVQREHHLP GDFP
Sbjct  436  NEFVKRAKAAKIHACIISHLKKEMPAIMGKAKAQQKLIDNLEDVFAKVQREHHLPKGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VEHFRE+LSGY+IDKFEKLKPKM+Q VD+MLGYDIP+LLK F NPY
Sbjct  496  NVEHFREVLSGYNIDKFEKLKPKMLQTVDEMLGYDIPELLKTFGNPY  542



>emb|CDY25408.1| BnaA05g18760D [Brassica napus]
Length=525

 Score =   418 bits (1075),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  298  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  357

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE +TGP+G+ELFE EQ+DLLSDLK+IPKKACDRRI
Sbjct  358  SLGKVLNTPEVARVYIGSFSDKPINEASTGPIGRELFEMEQEDLLSDLKNIPKKACDRRI  417

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+L+DNL D F KVQREHHLP GDFP
Sbjct  418  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLMDNLEDVFGKVQREHHLPKGDFP  477

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+ FRE+LSGY+ DKFEKLKPKM+Q VDDMLGYDIP+LLKNF+NPYD
Sbjct  478  NVDQFREVLSGYNFDKFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  525



>ref|XP_006396726.1| hypothetical protein EUTSA_v10028561mg [Eutrema salsugineum]
 gb|ESQ38179.1| hypothetical protein EUTSA_v10028561mg [Eutrema salsugineum]
Length=544

 Score =   418 bits (1075),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKAD VDTQQLMRVYGALMW
Sbjct  317  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADLVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVY+GSFNDKPINE A GP+GKELFEKEQ+DLL+DL  IPKKACDR+I
Sbjct  377  SLGKVLNTPEVVRVYVGSFNDKPINEAAVGPIGKELFEKEQNDLLADLMVIPKKACDRKI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL +EFAKVQ+E+HLPAGDFP
Sbjct  437  NEFVKRARAAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLQEEFAKVQQEYHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPYD
Sbjct  497  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYD  544



>gb|KHN28769.1| EH domain-containing protein 1 [Glycine soja]
Length=822

 Score =   426 bits (1096),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  595  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  654

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFN KPINE   GPLG+ELFEKEQ+DLL+DL DIP+KACD RI
Sbjct  655  SLGKVLNTPEVVRVYIGSFNVKPINEGFVGPLGQELFEKEQNDLLADLVDIPRKACDSRI  714

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHLR EMPAMMGKAKTQQRLIDNL DEF KVQRE HLPAGDFP
Sbjct  715  NEFVKRARSAKIHAYIISHLRNEMPAMMGKAKTQQRLIDNLEDEFRKVQREFHLPAGDFP  774

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPKM+QAVDDMLGY+IP+LLK FRNPYD
Sbjct  775  NVEHFREVLSGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  822



>ref|XP_009145649.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Brassica 
rapa]
Length=544

 Score =   417 bits (1073),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE +TGP+G+ELFE EQ+DLLSDLK+IPKKACDRRI
Sbjct  377  SLGKVLNTPEVARVYIGSFSDKPINEVSTGPIGRELFEMEQEDLLSDLKNIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+L+DNL D F KVQREHHLP GDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLLDNLEDVFGKVQREHHLPKGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+ FRE+LSGY+ D FEKLKPKM+Q VDDMLGYDIP+LLKNF+NPYD
Sbjct  497  NVDQFREVLSGYNFDNFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  544



>ref|XP_009145651.1| PREDICTED: EH domain-containing protein 1 isoform X4 [Brassica 
rapa]
Length=543

 Score =   417 bits (1073),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE +TGP+G+ELFE EQ+DLLSDLK+IPKKACDRRI
Sbjct  376  SLGKVLNTPEVARVYIGSFSDKPINEVSTGPIGRELFEMEQEDLLSDLKNIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+L+DNL D F KVQREHHLP GDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLLDNLEDVFGKVQREHHLPKGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+ FRE+LSGY+ D FEKLKPKM+Q VDDMLGYDIP+LLKNF+NPYD
Sbjct  496  NVDQFREVLSGYNFDNFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  543



>ref|XP_011000650.1| PREDICTED: EH domain-containing protein 1-like [Populus euphratica]
Length=545

 Score =   417 bits (1073),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/227 (88%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE     +  ELFEKEQ+DLL DL DIPKKACDRRI
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPINEETASQMFCELFEKEQNDLLMDLVDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK+HA+IISHL+KEMPA+MGKAKTQQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKMHAYIISHLKKEMPAIMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VEHF+E+L+GYSIDKFEKLKPKM+QAVDDMLGY+IP+LLK+FRNPY
Sbjct  498  NVEHFKEVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKSFRNPY  544



>ref|XP_009145648.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Brassica 
rapa]
Length=545

 Score =   417 bits (1073),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE +TGP+G+ELFE EQ+DLLSDLK+IPKKACDRRI
Sbjct  378  SLGKVLNTPEVARVYIGSFSDKPINEVSTGPIGRELFEMEQEDLLSDLKNIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+L+DNL D F KVQREHHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLLDNLEDVFGKVQREHHLPKGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+ FRE+LSGY+ D FEKLKPKM+Q VDDMLGYDIP+LLKNF+NPYD
Sbjct  498  NVDQFREVLSGYNFDNFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  545



>ref|XP_002316591.2| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE97203.2| calcium-binding EF hand family protein [Populus trichocarpa]
Length=525

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/227 (88%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  298  AAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  357

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE     +  ELFEKEQ+DLL DL DIPKKACDRRI
Sbjct  358  SLGKVLNTPEVMRVYIGSFNDKPINEETASQMFCELFEKEQNDLLMDLVDIPKKACDRRI  417

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK+HA+IISHL+KEMPA+MGKAKTQQRLIDNL DEFAKVQRE HLPAGDFP
Sbjct  418  NEFVKRARAAKMHAYIISHLKKEMPAIMGKAKTQQRLIDNLEDEFAKVQREFHLPAGDFP  477

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VEHF+E+L+GYSIDKFEKLKPKM+QAVDDMLGY+IP+LLK+FRNPY
Sbjct  478  NVEHFKEVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKSFRNPY  524



>ref|XP_009145650.1| PREDICTED: EH domain-containing protein 1 isoform X3 [Brassica 
rapa]
Length=544

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSF+DKPINE +TGP+G+ELFE EQ+DLLSDLK+IPKKACDRRI
Sbjct  377  SLGKVLNTPEVARVYIGSFSDKPINEVSTGPIGRELFEMEQEDLLSDLKNIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+L+DNL D F KVQREHHLP GDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLLDNLEDVFGKVQREHHLPKGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+ FRE+LSGY+ D FEKLKPKM+Q VDDMLGYDIP+LLKNF+NPYD
Sbjct  497  NVDQFREVLSGYNFDNFEKLKPKMLQTVDDMLGYDIPELLKNFKNPYD  544



>ref|XP_002518408.1| EH-domain-containing protein, putative [Ricinus communis]
 gb|EEF43795.1| EH-domain-containing protein, putative [Ricinus communis]
Length=545

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/227 (87%), Positives = 213/227 (94%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPI+E    P+ +ELFEKEQDDLL DL DIPKKACDRRI
Sbjct  378  SLGKVLNTPEVARVYIGSFNDKPIDEENVNPMFRELFEKEQDDLLMDLVDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLRKEMP ++GKAKTQQRLIDNL DEF KVQRE+HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLRKEMPTIVGKAKTQQRLIDNLEDEFGKVQREYHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VEHF+E+L+GYSIDKFEKLKPKM+QAVDDMLGY+IP LL NFRNPY
Sbjct  498  NVEHFKEVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPQLLNNFRNPY  544



>ref|XP_010538746.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=543

 Score =   417 bits (1071),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDMILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE+A GPLGK LF KEQ+DLL+DL +IPKKACDR+I
Sbjct  376  SLGKVLNTPEVVRVYIGSFNDKPINESAVGPLGKGLFVKEQNDLLADLMNIPKKACDRKI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I++HL+KEMP MMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  436  NEFVKRARAAKIHAYIMNHLKKEMPVMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFR++LSGY+IDKFE+LKPKM+QAVDDMLGYD+PDLLK FRNPYD
Sbjct  496  NVEHFRQVLSGYNIDKFERLKPKMIQAVDDMLGYDVPDLLKKFRNPYD  543



>ref|XP_010538744.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010538745.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=545

 Score =   417 bits (1072),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDMILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE+A GPLGK LF KEQ+DLL+DL +IPKKACDR+I
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPINESAVGPLGKGLFVKEQNDLLADLMNIPKKACDRKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I++HL+KEMP MMGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKIHAYIMNHLKKEMPVMMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFR++LSGY+IDKFE+LKPKM+QAVDDMLGYD+PDLLK FRNPYD
Sbjct  498  NVEHFRQVLSGYNIDKFERLKPKMIQAVDDMLGYDVPDLLKKFRNPYD  545



>emb|CDX94536.1| BnaC09g23000D [Brassica napus]
Length=547

 Score =   417 bits (1071),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE   GP+GKELFEKEQ+DL++DL  IPKKACDR+I
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPINEAVVGPIGKELFEKEQNDLITDLMTIPKKACDRKI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL  EF KVQ+E+HLPAGDFP
Sbjct  440  NEFVKRARAAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLQQEFEKVQQEYHLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPY+
Sbjct  500  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  547



>ref|XP_009390978.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   417 bits (1071),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDP+K DISDEFKRVI SL GHDDKIRVVLNKADQVDTQQLMRVYGAL+W
Sbjct  317  AAKCDLILLLFDPYKLDISDEFKRVIGSLHGHDDKIRVVLNKADQVDTQQLMRVYGALLW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE A+GP+GKELF +EQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPVNEAASGPIGKELFVREQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMP+MMGKAK QQRL+DNL DEF KVQ+E HLP GDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPSMMGKAKAQQRLVDNLEDEFVKVQKEFHLPPGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+L+GY+IDKFEKL+ KM+QAVDDML YDIP+LL  FRNPYD
Sbjct  497  DVEHFREVLNGYNIDKFEKLRHKMIQAVDDMLAYDIPELLNRFRNPYD  544



>ref|XP_004293342.1| PREDICTED: EH domain-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=543

 Score =   417 bits (1071),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE A GP+G+ELFE EQ DLL+DL DIPKKACDR+I
Sbjct  376  SLGKVLNTPEVVRVYIGSFNDKPVNEEAVGPMGRELFEMEQGDLLADLVDIPKKACDRQI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGK+KTQ+RL++NL +EFAKVQRE+HLP GDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKEMPAMMGKSKTQKRLLENLEEEFAKVQREYHLPPGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE+LS Y+IDKFEK+KPKM+QAVDDMLGY+IP+LLKN RNPYD
Sbjct  496  NVEQFREVLSNYNIDKFEKVKPKMIQAVDDMLGYEIPELLKNLRNPYD  543



>gb|KDO78396.1| hypothetical protein CISIN_1g008954mg [Citrus sinensis]
Length=547

 Score =   417 bits (1071),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPIN    GP+G+ELFEKEQDDLL DL DIPKKACDR+I
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMP MMGKAK QQRLIDNL DEFAKVQRE HLP GDFP
Sbjct  440  NEFVKRARAAKIHAYIISHLKKEMPTMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+ Y+IDKFEKLKPKM+Q VDDML Y+IP+LLKNFRNPY+
Sbjct  500  NVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE  547



>ref|XP_009114592.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Brassica 
rapa]
Length=546

 Score =   417 bits (1071),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  319  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE   GP+GKELFEKEQ+DL++DL  IPKKACDR+I
Sbjct  379  SLGKVLNTPEVVRVYIGSFNDKPINEAVVGPIGKELFEKEQNDLITDLMTIPKKACDRKI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL  EF KVQ+E+HLPAGDFP
Sbjct  439  NEFVKRARAAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLQQEFEKVQQEYHLPAGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPY+
Sbjct  499  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  546



>ref|XP_009114593.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Brassica 
rapa]
Length=545

 Score =   417 bits (1071),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE   GP+GKELFEKEQ+DL++DL  IPKKACDR+I
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPINEAVVGPIGKELFEKEQNDLITDLMTIPKKACDRKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL  EF KVQ+E+HLPAGDFP
Sbjct  438  NEFVKRARAAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLQQEFEKVQQEYHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPY+
Sbjct  498  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  545



>ref|XP_009390977.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   417 bits (1071),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDP+K DISDEFKRVI SL GHDDKIRVVLNKADQVDTQQLMRVYGAL+W
Sbjct  317  AAKCDLILLLFDPYKLDISDEFKRVIGSLHGHDDKIRVVLNKADQVDTQQLMRVYGALLW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE A+GP+GKELF +EQDDLLSDLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPVNEAASGPIGKELFVREQDDLLSDLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMP+MMGKAK QQRL+DNL DEF KVQ+E HLP GDFP
Sbjct  437  NEFVKRARAAKIHAYIISHLKKEMPSMMGKAKAQQRLVDNLEDEFVKVQKEFHLPPGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+L+GY+IDKFEKL+ KM+QAVDDML YDIP+LL  FRNPYD
Sbjct  497  DVEHFREVLNGYNIDKFEKLRHKMIQAVDDMLAYDIPELLNRFRNPYD  544



>ref|XP_009390979.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=539

 Score =   416 bits (1070),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDP+K DISDEFKRVI SL GHDDKIRVVLNKADQVDTQQLMRVYGAL+W
Sbjct  312  AAKCDLILLLFDPYKLDISDEFKRVIGSLHGHDDKIRVVLNKADQVDTQQLMRVYGALLW  371

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE A+GP+GKELF +EQDDLLSDLKDIPKKACDRRI
Sbjct  372  SLGKVLNTPEVMRVYIGSFNDKPVNEAASGPIGKELFVREQDDLLSDLKDIPKKACDRRI  431

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMP+MMGKAK QQRL+DNL DEF KVQ+E HLP GDFP
Sbjct  432  NEFVKRARAAKIHAYIISHLKKEMPSMMGKAKAQQRLVDNLEDEFVKVQKEFHLPPGDFP  491

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+L+GY+IDKFEKL+ KM+QAVDDML YDIP+LL  FRNPYD
Sbjct  492  DVEHFREVLNGYNIDKFEKLRHKMIQAVDDMLAYDIPELLNRFRNPYD  539



>emb|CDY16689.1| BnaA09g20670D [Brassica napus]
Length=546

 Score =   416 bits (1070),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  319  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE   GP+GKELFEKEQ+DL++DL  IPKKACDR+I
Sbjct  379  SLGKVLNTPEVVRVYIGSFNDKPINEAVVGPIGKELFEKEQNDLITDLMTIPKKACDRKI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL  EF KVQ+E+HLPAGDFP
Sbjct  439  NEFVKRARAAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLQQEFEKVQQEYHLPAGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPY+
Sbjct  499  SVEHFREVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  546



>gb|KFK32206.1| hypothetical protein AALP_AA6G211000 [Arabis alpina]
Length=545

 Score =   416 bits (1069),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE A GPLGK LFEKEQ+DL++DL DIPKKACDR+I
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKPINEAADGPLGKVLFEKEQNDLIADLMDIPKKACDRKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMPA+MGK+K QQRL+DNL +EF KVQRE HLPAGDFP
Sbjct  438  NEFVKRARAAKINAYIMSHLKKEMPAVMGKSKAQQRLMDNLQEEFGKVQREFHLPAGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHF+E+L GY+IDKFEKLKPKM+QAVDDMLGYDIPDLLK FRNPY+
Sbjct  498  SVEHFKEVLGGYNIDKFEKLKPKMIQAVDDMLGYDIPDLLKKFRNPYE  545



>ref|XP_004507655.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Cicer 
arietinum]
Length=542

 Score =   416 bits (1069),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 195/227 (86%), Positives = 214/227 (94%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVI+SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  315  AAKCDLILLLFDPHKLDVSDEFKRVIASLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE + GPLG+ LFEKEQ+DLL+DL DIP+KACD RI
Sbjct  375  SLGKVLNTPEVVRVYIGSFNDKPINEGSVGPLGQALFEKEQNDLLADLVDIPRKACDGRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHL+ EMPAM+GKAK QQRLIDNL DEF KVQRE HLPAGDFP
Sbjct  435  NEFVKRARSAKIHAYIISHLKMEMPAMIGKAKAQQRLIDNLEDEFKKVQREFHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +V+HFRE+L+GYSIDKFEKLKPKM+QAVDDMLGY+IPDLL  FRNPY
Sbjct  495  NVDHFREVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPDLLNKFRNPY  541



>ref|XP_003594167.1| EH-domain-containing protein [Medicago truncatula]
 gb|AES64418.1| calcium-binding EF hand protein [Medicago truncatula]
Length=540

 Score =   416 bits (1068),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSLRG++DKIRVVLNK+DQVDTQQLMRVYGALMW
Sbjct  313  AAKCDVILLLFDPHKLDISDEFKRVISSLRGNEDKIRVVLNKSDQVDTQQLMRVYGALMW  372

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP NE    PLGK LFEKEQ+DLL+DL DIPKKACDRRI
Sbjct  373  SLGKVLNTPEVARVYIGSFNDKPTNEGFADPLGKNLFEKEQNDLLADLLDIPKKACDRRI  432

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHL+KEMP MMGKAK QQ+LIDNL +EFAKV+RE+HLP GDFP
Sbjct  433  NEFVKRARSAKIHAYIISHLKKEMPTMMGKAKAQQKLIDNLDNEFAKVKREYHLPPGDFP  492

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+LSGYSIDKFEKLKPKM+QA+DDMLGY+IP+LLK FRNPYD
Sbjct  493  SVEHFREVLSGYSIDKFEKLKPKMIQAIDDMLGYEIPELLKKFRNPYD  540



>ref|XP_003610495.1| EH-domain-containing protein [Medicago truncatula]
 gb|AES92692.1| calcium-binding EF hand protein [Medicago truncatula]
Length=542

 Score =   416 bits (1068),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVIYSLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE   GPLG+ELF+KEQ+DLLSDL DIP+KACD RI
Sbjct  375  SLGKVLNTPEVVRVYIGSFNDKPINEGFVGPLGQELFKKEQNDLLSDLVDIPRKACDGRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+I+SHL+ EMPAMMGKAK QQRLIDNL DEF KVQRE HLPAGDFP
Sbjct  435  NEFVKRARSAKIHAYIVSHLKMEMPAMMGKAKVQQRLIDNLEDEFKKVQREFHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +++HFRE+LS YSIDKF+KLKPKM+QAVDDMLGY+IP+LLK FRNPYD
Sbjct  495  NIDHFREVLSSYSIDKFDKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  542



>ref|XP_006467361.1| PREDICTED: EH domain-containing protein 1-like [Citrus sinensis]
Length=547

 Score =   415 bits (1066),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPIN    GP+ +ELFEKEQDDLL DL DIPKKACDR+I
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIEQELFEKEQDDLLMDLIDIPKKACDRQI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL DEFAKVQRE HLP GDFP
Sbjct  440  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+ Y+IDKFEKLKPKM+Q VDDML Y+IP+LLKNFRNPY+
Sbjct  500  NVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE  547



>ref|XP_006449830.1| hypothetical protein CICLE_v10014814mg [Citrus clementina]
 gb|ESR63070.1| hypothetical protein CICLE_v10014814mg [Citrus clementina]
Length=547

 Score =   415 bits (1066),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAK DLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKSDLILLLFDPHKLDISDEFKRVIASLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPIN    GP+G+ELFEKEQDDLL DL DIPKKACDR+I
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPINGEVVGPIGQELFEKEQDDLLMDLIDIPKKACDRQI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL DEFAKVQRE HLP GDFP
Sbjct  440  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQREFHLPGGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+ Y+IDKFEKLKPKM+Q VDDML Y+IP+LLKNFRNPY+
Sbjct  500  NVEHFREVLNSYNIDKFEKLKPKMIQVVDDMLAYEIPELLKNFRNPYE  547



>ref|XP_003547274.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
 gb|KHN32982.1| EH domain-containing protein 1 [Glycine soja]
Length=539

 Score =   414 bits (1064),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 195/228 (86%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+ LRG+DDKIRVVLNKADQV+TQQLMRVYGALMW
Sbjct  312  AAKCDLILLLFDPHKLDISDEFKRVIACLRGNDDKIRVVLNKADQVNTQQLMRVYGALMW  371

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP++E    PLG++LFEKEQ++LL+DL DIPKKACDRRI
Sbjct  372  SLGKVLNTPEVTRVYIGSFNDKPMDEGFVSPLGQDLFEKEQNNLLADLMDIPKKACDRRI  431

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHL+KEMPA+MGKAK QQRL+DNL +EFAKVQRE HLPAGDFP
Sbjct  432  NEFVKRARSAKIHAYIISHLKKEMPAIMGKAKAQQRLLDNLEEEFAKVQREFHLPAGDFP  491

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGYSIDKFEKLKPKM+QAVDDMLGY+IP+LLK FRNPYD
Sbjct  492  NVEHFREVLSGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  539



>ref|XP_009776640.1| PREDICTED: EH domain-containing protein 1 isoform X3 [Nicotiana 
sylvestris]
Length=541

 Score =   414 bits (1064),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 212/228 (93%), Gaps = 5/228 (2%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE ATGPLGKELFEKEQDDLL+DLK+IPKK     I
Sbjct  379  SLGKVLNTPEVARVYIGSFNDKPMNEAATGPLGKELFEKEQDDLLTDLKNIPKK-----I  433

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  434  NEFVKRARAAKIHAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  493

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  494  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  541



>ref|XP_007147670.1| hypothetical protein PHAVU_006G144500g [Phaseolus vulgaris]
 gb|ESW19664.1| hypothetical protein PHAVU_006G144500g [Phaseolus vulgaris]
Length=535

 Score =   414 bits (1063),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  308  AAKCDLILLLFDPHKLDISDEFKRVITSLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  367

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKPI+E    PLG++LFEKEQ++LL+DL DIPKKACDRRI
Sbjct  368  SLGKVLNTPEVSRVYIGSFNDKPIDEGFVSPLGQDLFEKEQNNLLADLIDIPKKACDRRI  427

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHL+KEMPA+MGKAK QQRL DNL +EFAKVQRE HLPAGDFP
Sbjct  428  NEFVKRARSAKIHAYIISHLKKEMPAIMGKAKAQQRLTDNLEEEFAKVQREFHLPAGDFP  487

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+ YSIDKFEKLKPKM+QAVDDMLGY+IP+LLK FRNPYD
Sbjct  488  NVEHFREVLNSYSIDKFEKLKPKMIQAVDDMLGYEIPELLKKFRNPYD  535



>ref|XP_009598339.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=541

 Score =   414 bits (1064),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 200/228 (88%), Positives = 212/228 (93%), Gaps = 5/228 (2%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  319  AAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE ATGPLGKELFEKEQDDLL+DLK+IPKK     I
Sbjct  379  SLGKVLNTPEVARVYIGSFNDKPMNEAATGPLGKELFEKEQDDLLTDLKNIPKK-----I  433

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+II HLRKEMPAM+GKAKTQQRLID L +EF KVQRE HLPAGDFP
Sbjct  434  NEFVKRARAAKIHAYIIGHLRKEMPAMIGKAKTQQRLIDELENEFGKVQREFHLPAGDFP  493

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GYS D+FEKLKPKM+Q VDDMLGYDIP+LLKNFRNPYD
Sbjct  494  NVEHFREVLGGYSFDRFEKLKPKMIQDVDDMLGYDIPELLKNFRNPYD  541



>ref|XP_009401415.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=541

 Score =   414 bits (1063),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 193/227 (85%), Positives = 212/227 (93%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAK DLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQ+DTQQLMRVYGAL W
Sbjct  313  AAKSDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQIDTQQLMRVYGALTW  372

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+N  A GP+GKELFEKEQDDLLSDLKDIPKKACDR+I
Sbjct  373  SLGKVLNTPEVMRVYIGSFNDKPVNSMAVGPVGKELFEKEQDDLLSDLKDIPKKACDRKI  432

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHLR +MPAM+GK K QQRLI+NL +EFAKVQR++HLP GDFP
Sbjct  433  NEFVKRARAAKIHAYIISHLRNQMPAMLGKTKAQQRLINNLENEFAKVQRDYHLPPGDFP  492

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
             V+HF+E+LSGY+IDKFEKLKPKM+QAVDDML +DIP+LL+ FRNPY
Sbjct  493  DVQHFKEVLSGYNIDKFEKLKPKMIQAVDDMLAFDIPELLRKFRNPY  539



>emb|CDP04464.1| unnamed protein product [Coffea canephora]
Length=581

 Score =   415 bits (1066),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 195/229 (85%), Positives = 217/229 (95%), Gaps = 1/229 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  353  AAKCDMILLLFDPHKLDISDEFKRVISSLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  412

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGK+LNTPEV+RVYIGSFNDKP+NE A GP+GK+LFEKEQDDLL DL DIPKKACDR+I
Sbjct  413  SLGKILNTPEVVRVYIGSFNDKPVNEEAVGPIGKDLFEKEQDDLLVDLMDIPKKACDRQI  472

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NE VKRARAAKIHA+I+SHL+KEMP++MGKAKTQQRLIDNL D F+KVQ+E HLPAGDFP
Sbjct  473  NELVKRARAAKIHAYIMSHLKKEMPSLMGKAKTQQRLIDNLEDVFSKVQKEFHLPAGDFP  532

Query  174  SVEHFREIL-SGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEHFRE+L SGY ID FEK+KPK++QAVDDMLGYDIP+LL+NFRNPY+
Sbjct  533  SVEHFREVLKSGYKIDDFEKIKPKLIQAVDDMLGYDIPELLRNFRNPYE  581



>ref|XP_001772546.1| predicted protein [Physcomitrella patens]
 gb|EDQ62588.1| predicted protein [Physcomitrella patens]
Length=547

 Score =   411 bits (1057),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 214/228 (94%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK DISDEFKRVI+SLRG+ DKIR+VLNKADQVDTQQLMRVYGALMW
Sbjct  319  ASKCDLILLLFDPHKLDISDEFKRVITSLRGNTDKIRIVLNKADQVDTQQLMRVYGALMW  378

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFND+PI+ET  GP+GK+LFE+EQ+DLLSDLKDIP+KACDR+I
Sbjct  379  SLGKVLNTPEVMRVYIGSFNDRPIDETKLGPIGKDLFEREQEDLLSDLKDIPRKACDRKI  438

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR AKIHA+II  L+KEMPAMMGK+K QQRLIDNL D+FAKVQRE HLP GDFP
Sbjct  439  NEFVKRARQAKIHAYIIGQLKKEMPAMMGKSKAQQRLIDNLEDQFAKVQREFHLPPGDFP  498

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEH+RE L+GY+ DKFEKLKPKM+QAVDDMLGYDIP+LLK FRNPYD
Sbjct  499  SVEHYRERLAGYNFDKFEKLKPKMLQAVDDMLGYDIPELLKKFRNPYD  546



>gb|AEV41063.1| putative EH-domain-containing protein 1 [Oryza minuta]
Length=542

 Score =   410 bits (1055),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ETA GPLG ELFEKEQDDLLSDL DIPKKACDRRI
Sbjct  375  SLGKVLNTPEVMRVYIGSFNDKPIRETAAGPLGTELFEKEQDDLLSDLNDIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKR+R+AK+HA IISHL+KEMPA+MGKAK QQRL+D+L ++FAKVQ+E HLPAGDFP
Sbjct  435  NEFVKRSRSAKVHAHIISHLKKEMPALMGKAKAQQRLLDSLDEQFAKVQKELHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVE +RE LS Y+ DKFEKLKPK+VQ VDDML YDIPDLLK+FRNPY+
Sbjct  495  SVEEYRETLSAYNFDKFEKLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>gb|AEV41109.1| putative EH-domain-containing protein 1 [Oryza officinalis]
Length=542

 Score =   410 bits (1055),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ETA GPLG ELFEKEQDDLLSDL DIPKKACDRRI
Sbjct  375  SLGKVLNTPEVMRVYIGSFNDKPIRETAAGPLGTELFEKEQDDLLSDLNDIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKR+R+AK+HA IISHL+KEMPA+MGKAK QQRL+D+L ++FAKVQ+E HLPAGDFP
Sbjct  435  NEFVKRSRSAKVHAHIISHLKKEMPALMGKAKAQQRLLDSLDEQFAKVQKELHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVE +RE LS Y+ DKFEKLKPK+VQ VDDML YDIPDLLK+FRNPY+
Sbjct  495  SVEEYRETLSAYNFDKFEKLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>ref|XP_010675784.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=544

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDVSDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFND+  NE   GP+G+ELFEKE DDL++DLKDIPKKACDRRI
Sbjct  377  SLGKVLNTPEVTRVYIGSFNDRTSNEAIDGPIGRELFEKEHDDLIADLKDIPKKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NE+VKRARAAKIHA+II HL+KEMPAM+GKAK QQRLIDNL DEF KVQRE HLPAGDFP
Sbjct  437  NEYVKRARAAKIHAYIIGHLKKEMPAMIGKAKAQQRLIDNLEDEFRKVQREFHLPAGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L GY+ DKFEKLKP+ VQAVDDMLGYDIP+LL++F+NPYD
Sbjct  497  NVEHFREVLRGYNFDKFEKLKPQKVQAVDDMLGYDIPELLRSFKNPYD  544



>gb|AEV40966.1| putative EH-domain-containing protein 1 [Oryza punctata]
Length=542

 Score =   409 bits (1052),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ETA GPLG ELFEKEQDDLLSDL DIPKKACDRRI
Sbjct  375  SLGKVLNTPEVMRVYIGSFNDKPIRETAAGPLGTELFEKEQDDLLSDLNDIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKR+R+AK+HA IISHL+KEMPA+MGKAK QQRL+D+L ++FAKVQ+E HLPAGDFP
Sbjct  435  NEFVKRSRSAKVHAHIISHLKKEMPALMGKAKAQQRLLDSLDEQFAKVQKELHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVE +RE LS Y+ DKFE+LKPK+VQ VDDML YDIPDLLK+FRNPY+
Sbjct  495  SVEEYRETLSAYNFDKFERLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>ref|XP_004500109.1| PREDICTED: EH domain-containing protein 1-like [Cicer arietinum]
Length=542

 Score =   409 bits (1051),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 193/227 (85%), Positives = 213/227 (94%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAK DLILLLFDPHK DISDEFKRVISSLRGHDDKIRVVLNK+DQVDTQQLMR+YGALMW
Sbjct  315  AAKSDLILLLFDPHKLDISDEFKRVISSLRGHDDKIRVVLNKSDQVDTQQLMRIYGALMW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLN PEVMRVYIGSFNDKP+N+ A G LG ELFE+EQDDLLSDLKDIPKKACDR+I
Sbjct  375  SLGKVLNIPEVMRVYIGSFNDKPVNDRANGLLGNELFEREQDDLLSDLKDIPKKACDRKI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+K+MP MMGKAK QQ+LIDNL  EFAKVQRE+HLP GDFP
Sbjct  435  NEFVKRARAAKIHAYIISHLKKQMPTMMGKAKAQQKLIDNLEGEFAKVQREYHLPPGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +V+HF+E+LSGY+IDKFEKLKPK +QAVDDML +DIP+LLK+FRNPY
Sbjct  495  NVDHFKEVLSGYNIDKFEKLKPKAIQAVDDMLAHDIPNLLKSFRNPY  541



>gb|KHN40844.1| EH domain-containing protein 1 [Glycine soja]
Length=541

 Score =   409 bits (1051),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL G+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  314  AAKCDLILLLFDPHKLDISDEFKRVIASLHGNDDKIRVVLNKADQVDTQQLMRVYGALMW  373

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP++E    PLG++LFEKEQ++LL+DL DIPKKACDRRI
Sbjct  374  SLGKVLNTPEVTRVYIGSFNDKPMDEGFVSPLGQDLFEKEQNNLLADLMDIPKKACDRRI  433

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHL+KEMPA+MGKAK +QRL+DNL +EFAKVQRE HLPAGDFP
Sbjct  434  NEFVKRARSAKIHAYIISHLKKEMPAIMGKAKARQRLLDNLEEEFAKVQREFHLPAGDFP  493

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+GY+IDKFEKLKPKM+QAVDDMLG++IP+LLK FRNPYD
Sbjct  494  NVEHFREVLNGYNIDKFEKLKPKMIQAVDDMLGFEIPELLKKFRNPYD  541



>ref|XP_006586764.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=539

 Score =   409 bits (1051),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI+SL G+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  312  AAKCDLILLLFDPHKLDISDEFKRVIASLHGNDDKIRVVLNKADQVDTQQLMRVYGALMW  371

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP++E    PLG++LFEKEQ++LL+DL DIPKKACDRRI
Sbjct  372  SLGKVLNTPEVTRVYIGSFNDKPMDEGFVSPLGQDLFEKEQNNLLADLMDIPKKACDRRI  431

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AKIHA+IISHL+KEMPA+MGKAK +QRL+DNL +EFAKVQRE HLPAGDFP
Sbjct  432  NEFVKRARSAKIHAYIISHLKKEMPAIMGKAKARQRLLDNLEEEFAKVQREFHLPAGDFP  491

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+L+GY+IDKFEKLKPKM+QAVDDMLG++IP+LLK FRNPYD
Sbjct  492  NVEHFREVLNGYNIDKFEKLKPKMIQAVDDMLGFEIPELLKKFRNPYD  539



>ref|XP_002447292.1| hypothetical protein SORBIDRAFT_06g032210 [Sorghum bicolor]
 gb|EES11620.1| hypothetical protein SORBIDRAFT_06g032210 [Sorghum bicolor]
Length=542

 Score =   409 bits (1050),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ETA GPLG ELF+KEQDDLLSDL DIPKKACDRRI
Sbjct  375  SLGKVLNTPEVMRVYIGSFNDKPIRETAAGPLGMELFQKEQDDLLSDLNDIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK+HA IISHL+KEMPA+MGKAK QQ+L+D+L D FAKVQ+E HLP GDFP
Sbjct  435  NEFVKRARAAKVHAHIISHLKKEMPALMGKAKAQQKLLDSLDDHFAKVQKELHLPPGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVE +RE+LS Y+ D+FE+L+PKMVQ VDDML YDIPDLLK FRNPYD
Sbjct  495  SVEEYRELLSAYNFDRFERLRPKMVQGVDDMLAYDIPDLLKKFRNPYD  542



>tpg|DAA35457.1| TPA: hypothetical protein ZEAMMB73_021494 [Zea mays]
Length=541

 Score =   408 bits (1049),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  314  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLW  373

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ETA GPLG ELF+KEQDDLLSDL DIPKKACDRRI
Sbjct  374  SLGKVLNTPEVMRVYIGSFNDKPIRETAAGPLGMELFQKEQDDLLSDLNDIPKKACDRRI  433

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK+HA IISHL+KEMPA+MGKAK QQ+L+D L  +FAKVQ+E HLP GDFP
Sbjct  434  NEFVKRARAAKVHAHIISHLKKEMPALMGKAKAQQKLLDGLDQQFAKVQKELHLPPGDFP  493

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVE +RE+LS Y+ D+FEKL+PKMVQ VDDML YDIPDLLK FRNPYD
Sbjct  494  SVEEYRELLSAYNFDRFEKLRPKMVQGVDDMLAYDIPDLLKKFRNPYD  541



>ref|NP_001167939.1| uncharacterized protein LOC100381653 [Zea mays]
 gb|ACN26585.1| unknown [Zea mays]
 tpg|DAA35458.1| TPA: hypothetical protein ZEAMMB73_021494 [Zea mays]
Length=543

 Score =   408 bits (1048),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ETA GPLG ELF+KEQDDLLSDL DIPKKACDRRI
Sbjct  376  SLGKVLNTPEVMRVYIGSFNDKPIRETAAGPLGMELFQKEQDDLLSDLNDIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK+HA IISHL+KEMPA+MGKAK QQ+L+D L  +FAKVQ+E HLP GDFP
Sbjct  436  NEFVKRARAAKVHAHIISHLKKEMPALMGKAKAQQKLLDGLDQQFAKVQKELHLPPGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVE +RE+LS Y+ D+FEKL+PKMVQ VDDML YDIPDLLK FRNPYD
Sbjct  496  SVEEYRELLSAYNFDRFEKLRPKMVQGVDDMLAYDIPDLLKKFRNPYD  543



>ref|XP_001784382.1| predicted protein [Physcomitrella patens]
 gb|EDQ50787.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK DISDEFKRVI+SLRGHDDKIR+VLNKADQVDTQQLMRVYGALMW
Sbjct  294  ASKCDLILLLFDPHKLDISDEFKRVITSLRGHDDKIRIVLNKADQVDTQQLMRVYGALMW  353

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFND+PI+E   GP+GK+LFEKEQ+DLL+DLKDIP+KACDRRI
Sbjct  354  SLGKVLNTPEVNRVYIGSFNDRPIDEDKVGPIGKDLFEKEQEDLLADLKDIPRKACDRRI  413

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR AKIHA+II  L+KEMPAM+GK K QQRLIDNL DEF KVQRE HLPAGDFP
Sbjct  414  NEFVKRARQAKIHAYIIGQLKKEMPAMIGKVKAQQRLIDNLEDEFGKVQREFHLPAGDFP  473

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEH+RE L+GY+ DKFEKLKPKM+Q +DDMLGYDIP+LLK FRNPY+
Sbjct  474  SVEHYRERLAGYNFDKFEKLKPKMLQTIDDMLGYDIPELLKKFRNPYE  521



>ref|XP_007026227.1| EPS15 domain 2 isoform 3 [Theobroma cacao]
 gb|EOY28849.1| EPS15 domain 2 isoform 3 [Theobroma cacao]
Length=574

 Score =   409 bits (1051),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/257 (78%), Positives = 217/257 (84%), Gaps = 29/257 (11%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDK +NE A GPLG++LFEKEQDDLL DL DIP+KACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKLLNEAAIGPLGQDLFEKEQDDLLKDLIDIPRKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAK-------------  214
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL DEF K             
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVLLCFISLSSHLF  497

Query  213  ----------------VQREHHLPAGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDM  82
                            VQR+ HLPAGDFPSVEH+RE+L+GYSIDKFEKLKPKM+QAVDDM
Sbjct  498  PFIFIRFSLLVLARKQVQRDFHLPAGDFPSVEHYREVLNGYSIDKFEKLKPKMIQAVDDM  557

Query  81   LGYDIPDLLKNFRNPYD  31
            LGY+IP+LLKNFRNPY+
Sbjct  558  LGYEIPELLKNFRNPYE  574



>gb|AEV41016.1| putative EH-domain-containing protein 1 [Oryza minuta]
Length=542

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 211/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRG+DDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGYDDKIRIVLNKADQVDAQQLMRVYGALLW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ETA GPLG ELFEKEQDDLLSDL DIPKKACDRRI
Sbjct  375  SLGKVLNTPEVMRVYIGSFNDKPIRETAAGPLGTELFEKEQDDLLSDLNDIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKR+R+AK+HA IISHL+KEMPA+MGKAK QQRL+D+L ++FAKVQ+E HLPAGDFP
Sbjct  435  NEFVKRSRSAKVHAHIISHLKKEMPALMGKAKAQQRLLDSLDEQFAKVQKELHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVE +RE LS Y+ DKFE+LKPK+VQ VDDML YDIPDLLK+FRNPY+
Sbjct  495  SVEEYRETLSAYNFDKFERLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>ref|XP_006602183.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=541

 Score =   406 bits (1044),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 210/227 (93%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMR+YGALMW
Sbjct  314  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRIYGALMW  373

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLN PEVMRVYIGSFNDK IN++ +GPLG ELF+KEQDDLLSDLKDIPKKACDR+I
Sbjct  374  SLGKVLNVPEVMRVYIGSFNDKTINDSLSGPLGNELFQKEQDDLLSDLKDIPKKACDRKI  433

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+K+MPAM+GKAK QQ+LIDNL  EF K+Q+E HLP GDFP
Sbjct  434  NEFVKRARAAKIHAYIISHLKKQMPAMIGKAKAQQKLIDNLDTEFVKIQKEFHLPPGDFP  493

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VEHF+E LSGY+IDKFEKL  KM+Q VDDML YD+P+LLK FRNPY
Sbjct  494  NVEHFKETLSGYNIDKFEKLNKKMIQTVDDMLAYDVPNLLKTFRNPY  540



>gb|AIE88276.1| hypothetical protein OG_BBa0063K01.7 [Oryza glaberrima]
Length=487

 Score =   404 bits (1039),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL+GHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  260  AAKCDLILLLFDPHKLDISDEFKRVIGSLKGHDDKIRIVLNKADQVDAQQLMRVYGALLW  319

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ET  GPLGKELFEKEQ+DLLSDL DIPKKACDRRI
Sbjct  320  SLGKVLNTPEVMRVYIGSFNDKPIRETVAGPLGKELFEKEQEDLLSDLNDIPKKACDRRI  379

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKR+R+AK+HA IISHL+KEMPA+MGKAK QQRL+D L ++FAKVQ+E HLPAGDFP
Sbjct  380  NEFVKRSRSAKVHAHIISHLKKEMPALMGKAKAQQRLLDTLDEQFAKVQKELHLPAGDFP  439

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SV+ +RE LS Y+ DKFE+LKPK+VQ VDDML YDIPDLLK+FRNPY+
Sbjct  440  SVDEYRETLSAYNFDKFERLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  487



>ref|XP_002985283.1| hypothetical protein SELMODRAFT_121714 [Selaginella moellendorffii]
 gb|EFJ13777.1| hypothetical protein SELMODRAFT_121714 [Selaginella moellendorffii]
Length=552

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  325  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  384

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPIN+ A GP+GKELFEKEQ+DLL+DLKDIP+KACDR+I
Sbjct  385  SLGKVLNTPEVMRVYIGSFNDKPINDRALGPIGKELFEKEQNDLLADLKDIPRKACDRKI  444

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARA KIH++I+ HL+KEMPAMMGK K QQRL+DNL +EF KVQRE  LP GDFP
Sbjct  445  NEFVKRARAVKIHSYIVGHLKKEMPAMMGKTKAQQRLVDNLEEEFRKVQREQRLPPGDFP  504

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V+ FRE LSGY+ DKFEKLKP+M+Q+VDDMLG+DIP+LLK FRNPYD
Sbjct  505  DVDAFRERLSGYNFDKFEKLKPRMIQSVDDMLGHDIPNLLKKFRNPYD  552



>ref|XP_002970092.1| hypothetical protein SELMODRAFT_92582 [Selaginella moellendorffii]
 gb|EFJ29216.1| hypothetical protein SELMODRAFT_92582 [Selaginella moellendorffii]
Length=544

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPIN+ A GP+GKELFEKEQ+DLL+DLKDIP+KACDR+I
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPINDRALGPIGKELFEKEQNDLLADLKDIPRKACDRKI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARA KIH++I+ HL+KEMPAMMGK K QQRL+DNL +EF KVQRE  LP GDFP
Sbjct  437  NEFVKRARAVKIHSYIVGHLKKEMPAMMGKTKAQQRLVDNLEEEFRKVQREQRLPPGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V+ FRE LSGY+ DKFEKLKP+M+Q+VDDMLG+DIP+LLK FRNPYD
Sbjct  497  DVDAFRERLSGYNFDKFEKLKPRMIQSVDDMLGHDIPNLLKKFRNPYD  544



>gb|KHG01502.1| EH domain-containing 1 [Gossypium arboreum]
Length=475

 Score =   403 bits (1035),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMR+YGALMW
Sbjct  248  AAKCDLILLLFDPHKLDISDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRIYGALMW  307

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFN+KP+NE  TGP+GK LFEKEQ+DLL+DLKDIPKKACDRRI
Sbjct  308  SLGKVLNTPEVVRVYIGSFNEKPVNEGFTGPIGKALFEKEQEDLLTDLKDIPKKACDRRI  367

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+ HL+KEMP  +GKAKTQ RL DNL +EF KVQR++HLP GDFP
Sbjct  368  NEFVKRARAAKIHAYIVGHLKKEMPTFIGKAKTQHRLTDNLEEEFVKVQRDYHLPPGDFP  427

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VE+F+E+L GYS D+FEKLKPKM+Q VD+MLGYDIP+LLK  RNPYD
Sbjct  428  DVENFKEVLRGYSFDRFEKLKPKMIQDVDEMLGYDIPNLLKTLRNPYD  475



>ref|NP_001054202.1| Os04g0669300 [Oryza sativa Japonica Group]
 emb|CAE02814.2| OSJNBa0043A12.19 [Oryza sativa Japonica Group]
 dbj|BAF16116.1| Os04g0669300 [Oryza sativa Japonica Group]
 gb|EEC78218.1| hypothetical protein OsI_17853 [Oryza sativa Indica Group]
 gb|EEE61874.1| hypothetical protein OsJ_16560 [Oryza sativa Japonica Group]
Length=542

 Score =   405 bits (1041),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL+GHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVIGSLKGHDDKIRIVLNKADQVDAQQLMRVYGALLW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ET  GPLGKELFEKEQ+DLLSDL DIPKKACDRRI
Sbjct  375  SLGKVLNTPEVMRVYIGSFNDKPIRETVAGPLGKELFEKEQEDLLSDLNDIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKR+R+AK+HA IISHL+KEMPA+MGKAK QQRL+D L ++FAKVQ+E HLPAGDFP
Sbjct  435  NEFVKRSRSAKVHAHIISHLKKEMPALMGKAKAQQRLLDTLDEQFAKVQKELHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SV+ +RE LS Y+ DKFE+LKPK+VQ VDDML YDIPDLLK+FRNPY+
Sbjct  495  SVDEYRETLSAYNFDKFERLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>ref|XP_011096032.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
 ref|XP_011096033.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
Length=547

 Score =   405 bits (1040),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRG+DDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDLILLLFDPHKLDISDEFKRVISSLRGNDDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE A GP+GKELFEKEQDDLL DL DIPKKACDRRI
Sbjct  380  SLGKVLNTPEVSRVYIGSFNDKPVNEAAAGPVGKELFEKEQDDLLLDLIDIPKKACDRRI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+SHL+KEMPA+MGKAKTQ+RL+DNL  EF KVQRE+HLPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIMSHLKKEMPALMGKAKTQRRLMDNLETEFEKVQREYHLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LS Y+ID FEKLKPKM+QAVDDMLGYDIP+LLKNFRN YD
Sbjct  500  NVEHFREVLSRYNIDDFEKLKPKMIQAVDDMLGYDIPELLKNFRNIYD  547



>ref|XP_006652990.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=542

 Score =   404 bits (1039),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  315  AAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI E+A GPLG ELFEKEQDDLLSDL +IPKKACDRRI
Sbjct  375  SLGKVLNTPEVMRVYIGSFNDKPIKESAAGPLGIELFEKEQDDLLSDLNNIPKKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AK+HA IISHL+KEMPA+MGKAK QQRL+D L +EFAKVQ+E HLPAGDFP
Sbjct  435  NEFVKRARSAKVHAHIISHLKKEMPALMGKAKAQQRLLDGLDEEFAKVQKELHLPAGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V+ +RE LS Y+ DKFEKLKPK+VQ VDDML YDIPDLLK+FRNPY+
Sbjct  495  GVDEYREALSAYNFDKFEKLKPKLVQGVDDMLAYDIPDLLKSFRNPYE  542



>gb|KJB45560.1| hypothetical protein B456_007G312100 [Gossypium raimondii]
Length=510

 Score =   402 bits (1032),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMR+YGALMW
Sbjct  283  AAKCDLILLLFDPHKLDISDEFKRVIYSLRGHDDKIRVVLNKADQVDTQQLMRIYGALMW  342

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFN+KP+NE  TGP+GK LFEKEQ+DLL+DLKDIPKKACDRRI
Sbjct  343  SLGKVLNTPEVVRVYIGSFNEKPVNEGFTGPIGKALFEKEQEDLLTDLKDIPKKACDRRI  402

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+ HL+KEMP  +GKAKTQ RL DNL +EF KVQR++HLP GDFP
Sbjct  403  NEFVKRARAAKIHAYIVGHLKKEMPTFIGKAKTQLRLTDNLEEEFVKVQRDYHLPPGDFP  462

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VE+F+E+L GYS D+FEKLKPKM+Q VD+MLGYDIP+LLK  RNPYD
Sbjct  463  DVENFKEVLRGYSFDRFEKLKPKMIQDVDEMLGYDIPNLLKTLRNPYD  510



>gb|KEH33921.1| EPS15-like domain protein [Medicago truncatula]
Length=543

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 188/227 (83%), Positives = 210/227 (93%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAK DLILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMR+YGALMW
Sbjct  316  AAKSDLILLLFDPHKLDISDEFKRVITSLKGHDDKIRVVLNKADQVDTQQLMRIYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLN PEV RVYIGSFND+P+N    G LG ELFE+EQ+DLL+DLKDIPKKACDR+I
Sbjct  376  SLGKVLNIPEVTRVYIGSFNDQPVNNVVNGVLGNELFEREQEDLLTDLKDIPKKACDRKI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+K+MPAMMGKAK QQ+LIDNL  EFAKVQ+E HLPAGDFP
Sbjct  436  NEFVKRARAAKIHAYIISHLKKQMPAMMGKAKAQQKLIDNLEGEFAKVQKEFHLPAGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VEHF+++LSGY+IDKFEKLKPK +QAVDDML +DIP+LLK FRNPY
Sbjct  496  NVEHFKDVLSGYNIDKFEKLKPKSIQAVDDMLAHDIPNLLKTFRNPY  542



>ref|XP_004507654.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Cicer 
arietinum]
Length=567

 Score =   402 bits (1033),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 195/252 (77%), Positives = 214/252 (85%), Gaps = 25/252 (10%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVI+SLRGHDDKIRVVLNKADQ+DTQQLMRVYGALMW
Sbjct  315  AAKCDLILLLFDPHKLDVSDEFKRVIASLRGHDDKIRVVLNKADQIDTQQLMRVYGALMW  374

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKPINE + GPLG+ LFEKEQ+DLL+DL DIP+KACD RI
Sbjct  375  SLGKVLNTPEVVRVYIGSFNDKPINEGSVGPLGQALFEKEQNDLLADLVDIPRKACDGRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAK-------------  214
            NEFVKRAR+AKIHA+IISHL+ EMPAM+GKAK QQRLIDNL DEF K             
Sbjct  435  NEFVKRARSAKIHAYIISHLKMEMPAMIGKAKAQQRLIDNLEDEFKKVSSFHFSFLILLS  494

Query  213  ------------VQREHHLPAGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYD  70
                        VQRE HLPAGDFP+V+HFRE+L+GYSIDKFEKLKPKM+QAVDDMLGY+
Sbjct  495  FLITCYFHLAKQVQREFHLPAGDFPNVDHFREVLNGYSIDKFEKLKPKMIQAVDDMLGYE  554

Query  69   IPDLLKNFRNPY  34
            IPDLL  FRNPY
Sbjct  555  IPDLLNKFRNPY  566



>ref|XP_009334827.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009334845.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Pyrus 
x bretschneideri]
Length=545

 Score =   401 bits (1031),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQ DTQQLM+VYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQSDTQQLMKVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+V+NTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ DLLSDL DIPKKAC+R+I
Sbjct  378  SLGRVVNTPEVMRVYIGSFNDKPVNEAATGPVGKELFEKEQGDLLSDLNDIPKKACERKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+ EMPAM  K+  QQ+LIDNL DEF KVQ EHHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V  +R+ILSGYS DKFE LKPKM+ AVD+MLGYDIP+LLK FRNP+D
Sbjct  498  DVNRYRDILSGYSFDKFETLKPKMIDAVDEMLGYDIPELLKKFRNPFD  545



>ref|XP_009334826.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009334843.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=591

 Score =   402 bits (1033),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQ DTQQLM+VYGALMW
Sbjct  364  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQSDTQQLMKVYGALMW  423

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+V+NTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ DLLSDL DIPKKAC+R+I
Sbjct  424  SLGRVVNTPEVMRVYIGSFNDKPVNEAATGPVGKELFEKEQGDLLSDLNDIPKKACERKI  483

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+ EMPAM  K+  QQ+LIDNL DEF KVQ EHHLP GDFP
Sbjct  484  NEFVKRARAAKIHAYIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFP  543

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V  +R+ILSGYS DKFE LKPKM+ AVD+MLGYDIP+LLK FRNP+D
Sbjct  544  DVNRYRDILSGYSFDKFETLKPKMIDAVDEMLGYDIPELLKKFRNPFD  591



>ref|XP_009334825.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009334842.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=591

 Score =   402 bits (1032),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQ DTQQLM+VYGALMW
Sbjct  364  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQSDTQQLMKVYGALMW  423

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+V+NTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ DLLSDL DIPKKAC+R+I
Sbjct  424  SLGRVVNTPEVMRVYIGSFNDKPVNEAATGPVGKELFEKEQGDLLSDLNDIPKKACERKI  483

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+ EMPAM  K+  QQ+LIDNL DEF KVQ EHHLP GDFP
Sbjct  484  NEFVKRARAAKIHAYIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFP  543

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V  +R+ILSGYS DKFE LKPKM+ AVD+MLGYDIP+LLK FRNP+D
Sbjct  544  DVNRYRDILSGYSFDKFETLKPKMIDAVDEMLGYDIPELLKKFRNPFD  591



>ref|XP_008370549.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=476

 Score =   394 bits (1011),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDE+KRVISSL GHDDKIRVVLNKADQ DTQQLMRVYGALMW
Sbjct  249  AAKCDLILLLFDPHKLDVSDEYKRVISSLHGHDDKIRVVLNKADQSDTQQLMRVYGALMW  308

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+V NTPEVMRVYIGSFNDK +NE ATGP+GKELFEKE  DLLSDL DIPKKAC+R+I
Sbjct  309  SLGRVFNTPEVMRVYIGSFNDKXVNEAATGPVGKELFEKELGDLLSDLNDIPKKACERKI  368

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA IISHL+ EMPAM  K+  QQ+LIDNL DEF KVQ EHHLP GDFP
Sbjct  369  NEFVKRARAAKIHACIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFP  428

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             V  +R+ILSGYSID FEKLKPKM+ AVD+MLGYDIP+LLK F+NPYD
Sbjct  429  DVNRYRDILSGYSIDNFEKLKPKMIDAVDEMLGYDIPELLKKFKNPYD  476



>ref|XP_009398680.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   395 bits (1016),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 208/228 (91%), Gaps = 1/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDL+LLLFDP+K DISDEFKRVI SLRGHDDKIRVVLNKADQVDTQQLMRVYGAL+W
Sbjct  317  AAKCDLVLLLFDPYKLDISDEFKRVIGSLRGHDDKIRVVLNKADQVDTQQLMRVYGALLW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPINE     +GK LFEKEQ+DLLSDL DIPKKACDRRI
Sbjct  377  SLGKVLNTPEVMRVYIGSFNDKPINEAEHAVIGK-LFEKEQEDLLSDLNDIPKKACDRRI  435

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAK+HA IISHL+KEMPAMMGKAK QQ+LIDNL +EF KVQ+E HL  GDFP
Sbjct  436  NEFVKRARAAKVHACIISHLKKEMPAMMGKAKAQQKLIDNLEEEFLKVQKEFHLAPGDFP  495

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V+ FRE+L GY+IDKFEK+K KM+QAVDDMLGYDIP+LLK FRNPYD
Sbjct  496  NVDQFREVLGGYNIDKFEKMKHKMIQAVDDMLGYDIPELLKRFRNPYD  543



>ref|XP_010675794.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=446

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 208/225 (92%), Gaps = 0/225 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAK DLILLLFDPHK DISDEFKRVISSL+GHDDKIRVVLNKADQV+TQQLMR+YGALMW
Sbjct  219  AAKSDLILLLFDPHKLDISDEFKRVISSLKGHDDKIRVVLNKADQVETQQLMRIYGALMW  278

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFND P+NE A GP+G++LF KEQ DLL+DLKDIPK AC+RR+
Sbjct  279  SLGKVLNTPEVTRVYIGSFNDGPLNEAAAGPMGQDLFLKEQSDLLADLKDIPKNACNRRV  338

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA IISHL+KEMP ++GKAK Q+ LIDNL  EF KVQRE+HLPAGDFP
Sbjct  339  NEFVKRARAAKIHALIISHLKKEMPLLIGKAKAQETLIDNLEIEFRKVQREYHLPAGDFP  398

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRN  40
            +VEHF+E+L GY+IDKFEKLKPKM+QAVD+MLGYDIP+LL+NF++
Sbjct  399  NVEHFKEVLKGYNIDKFEKLKPKMIQAVDEMLGYDIPELLRNFKS  443



>ref|XP_010487999.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=545

 Score =   395 bits (1014),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A+KCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVDTQ+L + +   + 
Sbjct  318  ASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQRLWKGWFDSVD  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
               KVLNTPEV RVYIGSF+DKPINE ATGP+G+ELFEKEQDDLL+DLKDIPKKACDRRI
Sbjct  378  LFXKVLNTPEVSRVYIGSFSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPA+MGKAK QQ+LIDNL D F KVQREHHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLIDNLEDVFGKVQREHHLPKGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VEHFRE+LSGY+IDKFEKLKPKM+Q VDDMLGYDIP LLK+F+NPYD
Sbjct  498  NVEHFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPQLLKSFKNPYD  545



>ref|XP_009352442.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=550

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/233 (81%), Positives = 206/233 (88%), Gaps = 5/233 (2%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQ DTQQLM+VYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQSDTQQLMKVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLG+V+NTPEVMRVYIGSFNDKP+NE ATGP+GKELFEKEQ DLLSDL DIPKKAC+R+I
Sbjct  378  SLGRVVNTPEVMRVYIGSFNDKPVNEAATGPVGKELFEKEQGDLLSDLNDIPKKACERKI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+ EMPAM  K+  QQ+LIDNL DEF KVQ EHHLP GDFP
Sbjct  438  NEFVKRARAAKIHAYIISHLKAEMPAMFWKSTAQQKLIDNLEDEFKKVQGEHHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPK-----MVQAVDDMLGYDIPDLLKNFRNPYD  31
             V  +R+ILSGYS DKFE LKPK     M+ AVD+MLGYDIP+LLK FRNP+D
Sbjct  498  DVNRYRDILSGYSFDKFETLKPKMIDAAMIDAVDEMLGYDIPELLKKFRNPFD  550



>ref|XP_003579456.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=548

 Score =   392 bits (1006),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/228 (80%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL+G+DDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  321  AAKCDLILLLFDPHKLDISDEFKRVIGSLKGNDDKIRIVLNKADQVDAQQLMRVYGALLW  380

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKPI ETA GPLG ELFE+EQ+DL+SDL DIPKKACDRRI
Sbjct  381  SLGKVLNTPEVMRVYIGSFNDKPIRETAAGPLGMELFEREQEDLMSDLNDIPKKACDRRI  440

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AK+HA+II HL+KEMPA+MGK K QQRL++ L ++F KVQ+E  LPAGDFP
Sbjct  441  NEFVKRARSAKVHAYIIGHLKKEMPALMGKGKAQQRLLETLEEQFDKVQKEMRLPAGDFP  500

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVE +R+ LS  + D+FE+L+PKM+QAVDDML YDIPDLLK FRNPYD
Sbjct  501  SVEEYRDTLSACNFDRFERLRPKMLQAVDDMLAYDIPDLLKQFRNPYD  548



>gb|KHG30640.1| EH domain-containing 1 [Gossypium arboreum]
Length=542

 Score =   390 bits (1002),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 196/228 (86%), Positives = 215/228 (94%), Gaps = 1/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVIS LRG+DDKIRVVLNKA QVDTQQLMRVYGALMW
Sbjct  316  AAKCDLILLLFDPHKLDISDEFKRVISCLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMW  375

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDK INE A  PLG++LFEKEQDDLL DL DIP+KACDRRI
Sbjct  376  SLGKVLNTPEVVRVYIGSFNDKQINE-ADDPLGQDLFEKEQDDLLKDLLDIPRKACDRRI  434

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMP+MMGKAK QQRLIDNL DEFAKVQRE+HLP GDFP
Sbjct  435  NEFVKRARAAKINAYIVSHLKKEMPSMMGKAKAQQRLIDNLQDEFAKVQREYHLPPGDFP  494

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEH+RE+L+ Y+IDKFEKLKPK+VQAVDDMLGY+IP+LLKNFRNPY+
Sbjct  495  SVEHYREVLNNYNIDKFEKLKPKLVQAVDDMLGYEIPELLKNFRNPYE  542



>ref|XP_007145728.1| hypothetical protein PHAVU_007G262900g [Phaseolus vulgaris]
 gb|ESW17722.1| hypothetical protein PHAVU_007G262900g [Phaseolus vulgaris]
Length=540

 Score =   389 bits (1000),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVD QQLMR+YGALMW
Sbjct  313  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDPQQLMRIYGALMW  372

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLN PEVMRVYIGSFNDK ++++ +G LG ELF+KEQDDLLSDLKDIPKKACDR+I
Sbjct  373  SLGKVLNVPEVMRVYIGSFNDKFMHDSISGQLGDELFQKEQDDLLSDLKDIPKKACDRKI  432

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARA  IHA+IISHL+K+MP+M+GKAK QQ+LIDNL  EF KVQRE HLPAGDFP
Sbjct  433  NEFVKRARAVVIHAYIISHLKKQMPSMIGKAKAQQKLIDNLDVEFGKVQREFHLPAGDFP  492

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +VE F+E LSGY+ID+FEKL  KM+Q VDDML YDIP+LLK FRNPY
Sbjct  493  NVEQFKETLSGYNIDRFEKLNKKMIQTVDDMLAYDIPNLLKAFRNPY  539



>gb|EYU27756.1| hypothetical protein MIMGU_mgv1a004743mg [Erythranthe guttata]
Length=512

 Score =   388 bits (997),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/227 (85%), Positives = 210/227 (93%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLF+PHK DISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  285  AAKCDVILLLFEPHKLDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  344

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV RVYIGSFNDKP+NE A GP+GKELFEKEQDDLL DL DIPKKACDRRI
Sbjct  345  SLGKVLNTPEVSRVYIGSFNDKPVNEAAIGPVGKELFEKEQDDLLLDLIDIPKKACDRRI  404

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR AKIHA+IIS L+KEMPA+MGKAK Q++L+DNL   F KVQ+E+HLPAGDFP
Sbjct  405  NEFVKRARDAKIHAYIISQLKKEMPAVMGKAKAQRKLVDNLEKVFEKVQKEYHLPAGDFP  464

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            SVEHFRE+LS YSID FEKLKPKM+QAVDDML YDIP+LLK+FRN Y
Sbjct  465  SVEHFREVLSRYSIDDFEKLKPKMIQAVDDMLSYDIPELLKSFRNLY  511



>ref|XP_009626939.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=548

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSL+GH+DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  321  AAKCDMILLLFDPHKLDISDEFKRVISSLKGHEDKIRVVLNKADQVDTQQLMRVYGALMW  380

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE A GP GK+LFEKEQDDLL DL DIPKKACDRRI
Sbjct  381  SLGKVLNTPEVVRVYIGSFNDKPVNEEAVGPTGKDLFEKEQDDLLDDLIDIPKKACDRRI  440

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIH++IISHL+KEMPA+MGK+KTQQ+LI NL + F KVQ+E  LP GDFP
Sbjct  441  NEFVKRARAAKIHSYIISHLKKEMPALMGKSKTQQKLIQNLDNVFEKVQKEFRLPPGDFP  500

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SV+HFRE+LS YSI+ FEKLKPKM+QAVDDMLG+DIP+LLKNFRNPY+
Sbjct  501  SVDHFREVLSHYSINDFEKLKPKMIQAVDDMLGHDIPELLKNFRNPYE  548



>gb|KJB69208.1| hypothetical protein B456_011G010900 [Gossypium raimondii]
Length=545

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVIS LRG+DDKIRVVLNKA QVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVISCLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFND  INE     LG++LFEKEQDDLL DL DIP+KACDRRI
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDNQINEADVDQLGQDLFEKEQDDLLKDLLDIPRKACDRRI  437

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMP+MMGKAK QQRLIDNL DEFAKVQRE+HLP GDFP
Sbjct  438  NEFVKRARAAKINAYIVSHLKKEMPSMMGKAKAQQRLIDNLQDEFAKVQREYHLPPGDFP  497

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEH+RE+L+ Y+IDKFEKLKPK+VQAVDDMLGY+IP+LLKNFRNPY+
Sbjct  498  SVEHYREVLNNYNIDKFEKLKPKLVQAVDDMLGYEIPELLKNFRNPYE  545



>gb|KJB69209.1| hypothetical protein B456_011G010900 [Gossypium raimondii]
Length=544

 Score =   389 bits (998),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 193/228 (85%), Positives = 212/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVIS LRG+DDKIRVVLNKA QVDTQQLMRVYGALMW
Sbjct  317  AAKCDLILLLFDPHKLDISDEFKRVISCLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMW  376

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFND  INE     LG++LFEKEQDDLL DL DIP+KACDRRI
Sbjct  377  SLGKVLNTPEVVRVYIGSFNDNQINEADVDQLGQDLFEKEQDDLLKDLLDIPRKACDRRI  436

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKI+A+I+SHL+KEMP+MMGKAK QQRLIDNL DEFAKVQRE+HLP GDFP
Sbjct  437  NEFVKRARAAKINAYIVSHLKKEMPSMMGKAKAQQRLIDNLQDEFAKVQREYHLPPGDFP  496

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEH+RE+L+ Y+IDKFEKLKPK+VQAVDDMLGY+IP+LLKNFRNPY+
Sbjct  497  SVEHYREVLNNYNIDKFEKLKPKLVQAVDDMLGYEIPELLKNFRNPYE  544



>ref|XP_009769722.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana sylvestris]
Length=548

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 213/228 (93%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSL+GH+DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  321  AAKCDMILLLFDPHKLDISDEFKRVISSLKGHEDKIRVVLNKADQVDTQQLMRVYGALMW  380

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE A G  GK+LFEKEQDDLL DL DIPKKACDRRI
Sbjct  381  SLGKVLNTPEVVRVYIGSFNDKPVNEEAVGLTGKDLFEKEQDDLLDDLIDIPKKACDRRI  440

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIH++IISHL+KEMPA+MGK+KTQQ+LI NL + F KVQ+E  LPAGDFP
Sbjct  441  NEFVKRARAAKIHSYIISHLKKEMPALMGKSKTQQKLIQNLDNVFEKVQKEFRLPAGDFP  500

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SV+HFRE+LS YSI+ FEKLKPKM+QAVDDMLG+DIP+LLKNFRNPY+
Sbjct  501  SVDHFREVLSHYSINDFEKLKPKMIQAVDDMLGHDIPELLKNFRNPYE  548



>gb|KEH33927.1| calcium-binding EF hand protein [Medicago truncatula]
Length=437

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 206/225 (92%), Gaps = 2/225 (1%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAK D+ILLLFDPHK DISDEFKRVI+SL+GHDDKIRVVLNKADQVDTQQLMR+YGALMW
Sbjct  214  AAKSDIILLLFDPHKLDISDEFKRVITSLKGHDDKIRVVLNKADQVDTQQLMRIYGALMW  273

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV N PE+MRVYIGSFND+P+N    G LG ELFE+EQ+DLL+DLKDIPKKACDR+I
Sbjct  274  SLGKVFNIPEIMRVYIGSFNDQPVNNI--GVLGNELFEREQEDLLTDLKDIPKKACDRKI  331

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMP ++GKAK QQ+LIDNL  EFAKVQRE HLPAGDFP
Sbjct  332  NEFVKRARAAKIHAYIISHLKKEMPIVIGKAKAQQKLIDNLEVEFAKVQREFHLPAGDFP  391

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRN  40
            +V+HF+E+LS Y+IDKFEKLKPKM+Q VDDML +DIP+LLK FRN
Sbjct  392  NVDHFKEVLSVYNIDKFEKLKPKMIQDVDDMLAHDIPNLLKTFRN  436



>emb|CAJ86083.1| H0818H01.5 [Oryza sativa Indica Group]
 emb|CAJ86201.1| B0811B10.21 [Oryza sativa Indica Group]
Length=555

 Score =   386 bits (992),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 190/268 (71%), Positives = 210/268 (78%), Gaps = 40/268 (15%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL+GHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  288  AAKCDLILLLFDPHKLDISDEFKRVIGSLKGHDDKIRIVLNKADQVDAQQLMRVYGALLW  347

Query  534  SLGKVLNTPEVMRVYIG----------------------------------------SFN  475
            SLGKVLNTPEVMRVYIG                                        SFN
Sbjct  348  SLGKVLNTPEVMRVYIGYDVIFPRSFTFTYGNASINLMVLQRSHNLTTDNSKLTCDSSFN  407

Query  474  DKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRINEFVKRARAAKIHAFIISHL  295
            DKPI ET  GPLGKELFEKEQ+DLLSDL DIPKKACDRRINEFVKR+R+AK+HA IISHL
Sbjct  408  DKPIRETVAGPLGKELFEKEQEDLLSDLNDIPKKACDRRINEFVKRSRSAKVHAHIISHL  467

Query  294  RKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFPSVEHFREILSGYSIDKFEKL  115
            +KEMPA+MGKAK QQRL+D L ++FAKVQ+E HLPAGDFPSV+ +RE LS Y+ DKFE+L
Sbjct  468  KKEMPALMGKAKAQQRLLDTLDEQFAKVQKELHLPAGDFPSVDEYRETLSAYNFDKFERL  527

Query  114  KPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            KPK+VQ VDDML YDIPDLLK+FRNPY+
Sbjct  528  KPKLVQGVDDMLAYDIPDLLKSFRNPYE  555



>ref|XP_004250246.1| PREDICTED: EH domain-containing protein 1-like [Solanum lycopersicum]
Length=547

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/228 (82%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSL+GH+DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDMILLLFDPHKLDISDEFKRVISSLKGHEDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE A GP+GK LFEKEQDDLL DL DIPKKACDRRI
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPVNEEAVGPMGKGLFEKEQDDLLDDLIDIPKKACDRRI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+ HL+KEMPA+MGK+KTQQ+LI NL +EF KVQ+   LPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIMGHLKKEMPALMGKSKTQQKLIQNLENEFEKVQKAFRLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SV+HFRE+L  Y+I  FEKLKP+M+QAVDDML +DIP+LLK+FRNPY+
Sbjct  500  SVDHFREVLGHYNITDFEKLKPRMIQAVDDMLSHDIPELLKSFRNPYE  547



>ref|XP_007145730.1| hypothetical protein PHAVU_007G263100g [Phaseolus vulgaris]
 gb|ESW17724.1| hypothetical protein PHAVU_007G263100g [Phaseolus vulgaris]
Length=538

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 201/227 (89%), Gaps = 0/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSLRGHDDKIRVVLNKADQVD QQLMR+YGALMW
Sbjct  311  AAKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDPQQLMRIYGALMW  370

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLN PEVMRVYIGSFNDK ++++ +GPLG ELF+KEQDDLLSDLKDIPKKACDR+I
Sbjct  371  SLGKVLNVPEVMRVYIGSFNDKFVHDSISGPLGNELFQKEQDDLLSDLKDIPKKACDRKI  430

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR   IHA+IISHL+K+MP M+GKAK QQ+LIDNL  EF KVQRE HLPAGDFP
Sbjct  431  NEFVKRARDVVIHAYIISHLKKQMPTMIGKAKAQQKLIDNLDVEFGKVQREFHLPAGDFP  490

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
             VE F+E L  Y+IDKFEKL  KM+  VDDML +DIP+LLK FRNPY
Sbjct  491  DVEQFKENLRSYNIDKFEKLNKKMIDKVDDMLAHDIPNLLKAFRNPY  537



>ref|XP_006352380.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=547

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK DISDEFKRVISSL+GH+DKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  320  AAKCDMILLLFDPHKLDISDEFKRVISSLKGHEDKIRVVLNKADQVDTQQLMRVYGALMW  379

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE A G +GK LFEKEQDDLL DL DIPKKACDRRI
Sbjct  380  SLGKVLNTPEVVRVYIGSFNDKPVNEEAIGSMGKGLFEKEQDDLLDDLIDIPKKACDRRI  439

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+I+SHL+KEMPA+MGK+KTQQ+LI NL +EF KVQ+   LPAGDFP
Sbjct  440  NEFVKRARAAKIHAYIMSHLKKEMPALMGKSKTQQKLIQNLDNEFEKVQKAFRLPAGDFP  499

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SV+HFRE+L  Y+I  FEKLKP+M+QAVDDML +DIP+LLKNFRNPY+
Sbjct  500  SVDHFREVLGHYNITDFEKLKPRMIQAVDDMLSHDIPELLKNFRNPYE  547



>ref|XP_002985697.1| hypothetical protein SELMODRAFT_122705 [Selaginella moellendorffii]
 gb|EFJ13275.1| hypothetical protein SELMODRAFT_122705 [Selaginella moellendorffii]
Length=558

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 184/228 (81%), Positives = 202/228 (89%), Gaps = 1/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL GHDDKI+VVLNKADQVDTQQLMRVYGALMW
Sbjct  329  AAKCDLILLLFDPHKLDISDEFKRVIGSLHGHDDKIKVVLNKADQVDTQQLMRVYGALMW  388

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+NE   GP+GKELFEKEQ D+L DL DIP+KACDR++
Sbjct  389  SLGKVLNTPEVMRVYIGSFNDKPLNEK-LGPIGKELFEKEQSDILIDLMDIPRKACDRKV  447

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA II+HL+KEMPAM+GK K QQRL+ NL DEFAKVQRE HLPAGD P
Sbjct  448  NEFVKRARAAKIHAHIIAHLKKEMPAMVGKNKAQQRLMVNLEDEFAKVQRELHLPAGDMP  507

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            + + FREIL+ Y+IDKFEK KPK++QAV+ ML  DIPDLL  F NPYD
Sbjct  508  NPDKFREILARYNIDKFEKYKPKLIQAVETMLAQDIPDLLNKFHNPYD  555



>ref|XP_002974220.1| hypothetical protein SELMODRAFT_414547 [Selaginella moellendorffii]
 gb|EFJ24442.1| hypothetical protein SELMODRAFT_414547 [Selaginella moellendorffii]
Length=540

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 202/228 (89%), Gaps = 1/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVI SL GHDDKI+VVLNKADQVDTQQLMRVYGALMW
Sbjct  311  AAKCDLILLLFDPHKLDISDEFKRVIGSLHGHDDKIKVVLNKADQVDTQQLMRVYGALMW  370

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+N+   GP+GKELFEKEQ D+L DL DIP+KACDR++
Sbjct  371  SLGKVLNTPEVMRVYIGSFNDKPLND-KLGPIGKELFEKEQSDILIDLMDIPRKACDRKV  429

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA II+HL+KEMPAM+GK K QQRL+ NL DEFAKVQRE HLPAGD P
Sbjct  430  NEFVKRARAAKIHAHIIAHLKKEMPAMVGKNKAQQRLMVNLEDEFAKVQRELHLPAGDMP  489

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            + + FREIL+ Y+IDKFEK KPK++QAV+ ML  DIPDLL  F NPYD
Sbjct  490  NPDKFREILARYNIDKFEKYKPKLIQAVETMLAQDIPDLLNKFHNPYD  537



>emb|CDO98110.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 197/229 (86%), Gaps = 12/229 (5%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCD+ILLLFDPHK +ISDEFK              VVLNKADQVDTQQLMRVYGALMW
Sbjct  319  AAKCDMILLLFDPHKLEISDEFKHT-----------HVVLNKADQVDTQQLMRVYGALMW  367

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGK+LNTPEV+RVYIGSFNDKP+NE A GP+GK+ FEKEQ++LL DL DIPKKA DRRI
Sbjct  368  SLGKILNTPEVVRVYIGSFNDKPVNEEAAGPIGKDFFEKEQENLLMDLMDIPKKASDRRI  427

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NE VKRARAAKIHA+I+SHL+KEMP++MGKAKTQQRLIDNL D F+KVQRE HLPAGDFP
Sbjct  428  NELVKRARAAKIHAYIMSHLKKEMPSLMGKAKTQQRLIDNLEDVFSKVQREFHLPAGDFP  487

Query  174  SVEHFREIL-SGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
             VEHFRE+L SGY ID FEK KPK++QAVDDML  DIP+LLKNFRNPY+
Sbjct  488  RVEHFREVLKSGYKIDDFEKTKPKLIQAVDDMLSCDIPELLKNFRNPYE  536



>gb|KCW77036.1| hypothetical protein EUGRSUZ_D01382 [Eucalyptus grandis]
Length=459

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFK VI+SLR HD+KIRVVLNKADQVD+QQLMRVYGALMW
Sbjct  232  AAKCDLILLLFDPHKLDISDEFKHVITSLRRHDNKIRVVLNKADQVDSQQLMRVYGALMW  291

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE   GP+G++LF+KEQDDLL+D++DIPKKACDR+I
Sbjct  292  SLGKVLNTPEVVRVYIGSFNDKPVNEDIVGPIGRDLFKKEQDDLLADVRDIPKKACDRQI  351

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            +E+VKRA AAK+HA+IISHL+ EMP +MGKA  +QRLI+NL DEF KVQR +HLP  DFP
Sbjct  352  SEYVKRACAAKVHAYIISHLKNEMPLIMGKAMARQRLINNLEDEFLKVQRMYHLPKCDFP  411

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V  F+E+L G++I  FEKLKPKM++AVD+ML ++IP+LLKN + PY+
Sbjct  412  NVHQFKEVLRGHNIGNFEKLKPKMIEAVDEMLRHEIPELLKNSKYPYE  459



>ref|XP_010054613.1| PREDICTED: EH domain-containing protein 1-like [Eucalyptus grandis]
Length=528

 Score =   361 bits (927),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFK VI+SLR HD+KIRVVLNKADQVD+QQLMRVYGALMW
Sbjct  301  AAKCDLILLLFDPHKLDISDEFKHVITSLRRHDNKIRVVLNKADQVDSQQLMRVYGALMW  360

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDKP+NE   GP+G++LF+KEQDDLL+D++DIPKKACDR+I
Sbjct  361  SLGKVLNTPEVVRVYIGSFNDKPVNEDIVGPIGRDLFKKEQDDLLADVRDIPKKACDRQI  420

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            +E+VKRA AAK+HA+IISHL+ EMP +MGKA  +QRLI+NL DEF KVQR +HLP  DFP
Sbjct  421  SEYVKRACAAKVHAYIISHLKNEMPLIMGKAMARQRLINNLEDEFLKVQRMYHLPKCDFP  480

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +V  F+E+L G++I  FEKLKPKM++AVD+ML ++IP+LLKN + PY+
Sbjct  481  NVHQFKEVLRGHNIGNFEKLKPKMIEAVDEMLRHEIPELLKNSKYPYE  528



>ref|XP_002298819.2| hypothetical protein POPTR_0001s36630g [Populus trichocarpa]
 gb|EEE83624.2| hypothetical protein POPTR_0001s36630g [Populus trichocarpa]
Length=512

 Score =   358 bits (920),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 186/228 (82%), Gaps = 33/228 (14%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK D+SDEFKRVISSL GHDDKIRVVLNKADQVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDVSDEFKRVISSLHGHDDKIRVVLNKADQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEVMRVYIGSFNDKP+N                                  I
Sbjct  378  SLGKVLNTPEVMRVYIGSFNDKPVNA---------------------------------I  404

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRL+DNLA+EF KVQRE HLP GDFP
Sbjct  405  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLLDNLAEEFGKVQREFHLPPGDFP  464

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +VE FRE+LSGY+ DKFEKLKPKM+QAVDDMLGYDIPDLLKNFRNPYD
Sbjct  465  NVEQFREVLSGYNFDKFEKLKPKMIQAVDDMLGYDIPDLLKNFRNPYD  512



>ref|NP_001170407.1| uncharacterized protein LOC100384394 [Zea mays]
 gb|ACN36917.1| unknown [Zea mays]
Length=177

 Score =   337 bits (864),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -2

Query  561  MRVYGALMWSLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDI  382
            MRVYGALMWSLGKVLNTPEV RVYIGSFNDKP+NE+A GPLGKELFE+EQDDLLSDLKDI
Sbjct  1    MRVYGALMWSLGKVLNTPEVSRVYIGSFNDKPVNESAVGPLGKELFEREQDDLLSDLKDI  60

Query  381  PKKACDRRINEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQRE  202
            PKKACDRRINEFVKRARAAKIHA+II HL+KEMP MMGKAK QQRLIDNL DEFAKVQRE
Sbjct  61   PKKACDRRINEFVKRARAAKIHAYIIGHLKKEMPTMMGKAKAQQRLIDNLPDEFAKVQRE  120

Query  201  HHLPAGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            +HLP+GDFP VEHF+E+LSGYS DKFEK+KPKMVQAVDDMLGYDIP+LLKNFRNPY+
Sbjct  121  YHLPSGDFPYVEHFKEVLSGYSFDKFEKVKPKMVQAVDDMLGYDIPELLKNFRNPYE  177



>ref|XP_007026229.1| EPS15 domain 2 isoform 5 [Theobroma cacao]
 gb|EOY28851.1| EPS15 domain 2 isoform 5 [Theobroma cacao]
Length=511

 Score =   348 bits (893),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 187/228 (82%), Gaps = 34/228 (15%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLILLLFDPHK DISDEFKRVISSLRG+DDKIRVVLNKA QVDTQQLMRVYGALMW
Sbjct  318  AAKCDLILLLFDPHKLDISDEFKRVISSLRGNDDKIRVVLNKAHQVDTQQLMRVYGALMW  377

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPEV+RVYIGSFNDK +                                  +I
Sbjct  378  SLGKVLNTPEVVRVYIGSFNDKLL----------------------------------KI  403

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL DEF KVQR+ HLPAGDFP
Sbjct  404  NEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFGKVQRDFHLPAGDFP  463

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SVEH+RE+L+GYSIDKFEKLKPKM+QAVDDMLGY+IP+LLKNFRNPY+
Sbjct  464  SVEHYREVLNGYSIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  511



>ref|XP_009779289.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana sylvestris]
Length=177

 Score =   335 bits (860),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -2

Query  561  MRVYGALMWSLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDI  382
            MRVYGALMWSLG+VLNTPEV RVYIGSFND+PINE  TGP+GKELFEKEQDDLLSDLK+I
Sbjct  1    MRVYGALMWSLGRVLNTPEVTRVYIGSFNDRPINEAPTGPVGKELFEKEQDDLLSDLKNI  60

Query  381  PKKACDRRINEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQRE  202
            PKKACDRRINEFVKRARAAKIHA+IISHL+KEMPAMMGKAK Q+RLIDNL DEF K+Q+E
Sbjct  61   PKKACDRRINEFVKRARAAKIHAYIISHLKKEMPAMMGKAKKQKRLIDNLEDEFVKIQKE  120

Query  201  HHLPAGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            HHLPAGDFP+VEHFRE+LSGYSIDKFEKLKPK++QAVDDMLGYDIP+LLKNF NPYD
Sbjct  121  HHLPAGDFPNVEHFREVLSGYSIDKFEKLKPKLIQAVDDMLGYDIPELLKNFGNPYD  177



>ref|XP_010042271.1| PREDICTED: EH domain-containing protein 1-like, partial [Eucalyptus 
grandis]
Length=305

 Score =   333 bits (854),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = -2

Query  567  QLMRVYGALMWSLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLK  388
            QLMRVYGALMWSLGKVLNTPEV RVYIGSFNDKP+N+   GP+G++LFEKEQDDLL+DL 
Sbjct  127  QLMRVYGALMWSLGKVLNTPEVARVYIGSFNDKPVNDGIVGPIGRDLFEKEQDDLLADLI  186

Query  387  DIPKKACDRRINEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQ  208
            DIPKKACDRRINEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL DEFAKVQ
Sbjct  187  DIPKKACDRRINEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLEDEFAKVQ  246

Query  207  REHHLPAGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            R++HLPAGDFPSV+HFRE+LSGY+IDKFEKLKPKM+QAVDDMLGY+IP+LLKNFRNPY+
Sbjct  247  RDYHLPAGDFPSVDHFREVLSGYNIDKFEKLKPKMIQAVDDMLGYEIPELLKNFRNPYE  305



>gb|EMT24958.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=457

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 186/228 (82%), Gaps = 16/228 (7%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAK DLILLLFDPHK DISDEFKRVI SLRGHDDKIR+VLNKADQVD QQLMRVYGAL+W
Sbjct  246  AAKSDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRIVLNKADQVDAQQLMRVYGALLW  305

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKVLNTPE                TA GPLG ELF +EQ+DLLSDL DIPKKAC RRI
Sbjct  306  SLGKVLNTPE----------------TAAGPLGSELFVREQEDLLSDLNDIPKKACGRRI  349

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR+AK+HA I+ HL+ +MPA+MGKAK QQ+L++ L ++FAKVQ+E HLP GDFP
Sbjct  350  NEFVKRARSAKVHAHIVGHLKNQMPALMGKAKAQQKLLETLDEQFAKVQKEMHLPPGDFP  409

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            SV+ +R+ LS Y+ D+FE+L  KMV+ VDDML YDIPDLLK FRNPY+
Sbjct  410  SVDEYRDTLSAYNFDRFERLHTKMVKDVDDMLAYDIPDLLKQFRNPYE  457



>ref|XP_005643284.1| hypothetical protein COCSUDRAFT_38543 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18740.1| hypothetical protein COCSUDRAFT_38543 [Coccomyxa subellipsoidea 
C-169]
Length=540

 Score =   324 bits (830),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 181/228 (79%), Gaps = 2/228 (1%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AA+CDLILLLFDP K DISDE K VI SL+GHDDK+RVVLNKADQVD QQLMRVYGALMW
Sbjct  313  AARCDLILLLFDPAKLDISDEMKEVIQSLKGHDDKVRVVLNKADQVDMQQLMRVYGALMW  372

Query  534  SLGKVLNTPEVMRVYIGSFN-DKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRR  358
            SLGKV  +PEV +VYIGSFN DKPI  T   P G ELFEKEQ DLL DL DIP++ACDR+
Sbjct  373  SLGKVFKSPEVCKVYIGSFNADKPIR-TDLNPAGLELFEKEQADLLQDLFDIPQRACDRK  431

Query  357  INEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDF  178
            +NEFVKR RAAKIH  II HLRK+MPAMMGK K Q++L+ +L   FA VQREHHLPAGDF
Sbjct  432  VNEFVKRVRAAKIHTLIIGHLRKQMPAMMGKQKAQEKLLRDLPTHFAHVQREHHLPAGDF  491

Query  177  PSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            P V  +R+IL GY +  F KLK K V+A++D L  DIP L+K F NPY
Sbjct  492  PDVNRYRDILGGYDLSTFPKLKEKDVKALEDALSLDIPSLVKQFDNPY  539



>gb|ABR16762.1| unknown [Picea sitchensis]
Length=170

 Score =   311 bits (796),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  540  MWSLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDR  361
            MWSLGKVLNTPEV RVYIGSFNDKPIN+ A GP+GK+LFEKEQ+DLLSDLKDIP+KACDR
Sbjct  1    MWSLGKVLNTPEVNRVYIGSFNDKPINDVAIGPIGKDLFEKEQEDLLSDLKDIPRKACDR  60

Query  360  RINEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGD  181
            RINEFVKRARAAKIHA+IISHL+KEMPAMMGKAK QQRLIDNL +EFAKVQRE+HLPAGD
Sbjct  61   RINEFVKRARAAKIHAYIISHLKKEMPAMMGKAKAQQRLIDNLDEEFAKVQREYHLPAGD  120

Query  180  FPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            FPS+EHF+E+LSGY+ DKFEK+K KM+Q+VDDMLGYDIP+LL+ FRNPYD
Sbjct  121  FPSIEHFKEVLSGYNFDKFEKIKLKMIQSVDDMLGYDIPELLRKFRNPYD  170



>ref|XP_009402015.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 187/229 (82%), Gaps = 1/229 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAKCDLI+LLFDPHK DISDEF  VI SL GH+DKIRVVLNKADQVDT+QL+RV  AL+W
Sbjct  277  AAKCDLIILLFDPHKIDISDEFNNVIRSLHGHEDKIRVVLNKADQVDTEQLIRVNRALIW  336

Query  534  SLGKVL-NTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRR  358
            SL KVL N PEVMR+Y GSFNDKP N     P+ K++FE++Q+DLLSD++DIP   CD +
Sbjct  337  SLAKVLPNRPEVMRIYNGSFNDKPSNNVVVDPILKKVFERDQNDLLSDVRDIPNNVCDLK  396

Query  357  INEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDF  178
            I  FV+RA+AAK+HA+IISHL+ +MP ++GKA  Q+RLIDNL +EF +VQR+++LP GDF
Sbjct  397  IRAFVRRAKAAKVHAYIISHLKNKMPLILGKATAQRRLIDNLENEFVEVQRKYNLPLGDF  456

Query  177  PSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            P V+ F+E LS ++ID+F+KLKPK+++AVD ML  DIP LL+ F N Y+
Sbjct  457  PDVQRFKEALSCHNIDEFKKLKPKLIRAVDVMLTCDIPQLLRTFGNSYE  505



>gb|AAD48968.1|AF147263_10 contains similarity to Pfam family PF00036 - EF hand; score=11.7, 
E=0.66,N=1 [Arabidopsis thaliana]
 emb|CAB81094.1| AT4g05520 [Arabidopsis thaliana]
Length=514

 Score =   305 bits (780),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 165/179 (92%), Gaps = 5/179 (3%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQ-----LMRVY  550
            A+KCD+ILLLFDPHK DISDEFKRVI+SLRG++DKIRVVLNKADQVDTQQ     LMRVY
Sbjct  335  ASKCDMILLLFDPHKLDISDEFKRVITSLRGNEDKIRVVLNKADQVDTQQPLFLKLMRVY  394

Query  549  GALMWSLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKA  370
            GALMWSLGKVLNTPEV+RVYIGSFNDKPINE A GP+GKELFEKEQ+DLL+DL D+PKKA
Sbjct  395  GALMWSLGKVLNTPEVVRVYIGSFNDKPINEVAVGPIGKELFEKEQNDLLADLMDVPKKA  454

Query  369  CDRRINEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHL  193
            CDR+INEFVKRAR+AKI+A+I+SHL+KEMPAMMGK+K QQRL+DNL +EF KV++  HL
Sbjct  455  CDRKINEFVKRARSAKINAYIMSHLKKEMPAMMGKSKAQQRLMDNLEEEFGKVRKISHL  513



>ref|XP_002978188.1| hypothetical protein SELMODRAFT_108442, partial [Selaginella 
moellendorffii]
 gb|EFJ20845.1| hypothetical protein SELMODRAFT_108442, partial [Selaginella 
moellendorffii]
Length=385

 Score =   298 bits (763),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAK D+I LLFDPHK DISDE KRVI SLRG+DDKIRV+LNK D +D QQLMRVYGALMW
Sbjct  164  AAKSDMIFLLFDPHKLDISDELKRVIESLRGNDDKIRVLLNKVDGIDAQQLMRVYGALMW  223

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV+NTPEVMRVYIGSF D P        L K+LF+ E+ DLL +L ++PK++CDRRI
Sbjct  224  SLGKVVNTPEVMRVYIGSFYDNPQKII----LSKDLFDLEKKDLLRELSELPKRSCDRRI  279

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            +EFVKRA AAK+HA++I HL+++MP + GKA  Q+ L+ NL DEF KVQ  +HLP GD P
Sbjct  280  SEFVKRAHAAKVHAYLIGHLKQQMPILWGKADAQESLVVNLEDEFVKVQSLYHLPKGDLP  339

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNF  46
            +++ FR +L+ ++ID F +L+P M+Q+VDDML +DIP LL N+
Sbjct  340  NIDTFRRVLAVHNIDSFHRLRPSMIQSVDDMLTHDIPKLLSNY  382



>ref|XP_002966377.1| hypothetical protein SELMODRAFT_85478, partial [Selaginella moellendorffii]
 gb|EFJ32404.1| hypothetical protein SELMODRAFT_85478, partial [Selaginella moellendorffii]
Length=385

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AAK D+I LLFDPHK DISDE KRVI SLRG+DDKIRV+LNK D +D QQLMRVYGALMW
Sbjct  164  AAKSDMIFLLFDPHKLDISDELKRVIESLRGNDDKIRVLLNKVDGIDAQQLMRVYGALMW  223

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV+NTPEVMRVYIGSF D P        L K+LF+ E+ DLL +L ++PK++CDRRI
Sbjct  224  SLGKVVNTPEVMRVYIGSFYDNPQKII----LSKDLFDLEKKDLLRELSELPKRSCDRRI  279

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            +EFVKRA AAK+HA++I HL+++MP + GKA  Q+ L+ NL DEF KVQ  +HLP GD P
Sbjct  280  SEFVKRAHAAKVHAYLIGHLKQQMPILWGKADAQESLVVNLEDEFVKVQSLYHLPKGDLP  339

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNF  46
            +++ FR +L+ ++ID F +L+P M+Q+VDDML +DIP LL N+
Sbjct  340  NIDTFRRVLAVHNIDSFHRLRPSMIQSVDDMLTHDIPKLLSNY  382



>gb|KDD73486.1| hypothetical protein H632_c2126p0 [Helicosporidium sp. ATCC 50920]
Length=376

 Score =   280 bits (715),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 174/228 (76%), Gaps = 3/228 (1%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A++CD ILLLFDPHK DISDEF+ VI+SL+GH+DK+RVVLNKAD VD QQL+RVYGALMW
Sbjct  150  ASRCDAILLLFDPHKLDISDEFREVIASLKGHEDKMRVVLNKADSVDAQQLLRVYGALMW  209

Query  534  SLGKVLNTPEVMRVYIGSFN-DKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRR  358
            SLG+V+ +PEV RVY+GSFN   P+ E    P GK LFEKE +DLL DL  IP +ACDR+
Sbjct  210  SLGRVVGSPEVARVYVGSFNAGHPVREDVN-PEGKALFEKEHEDLLHDLYAIPARACDRK  268

Query  357  INEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDF  178
            +NEFVKR RAA++H  I++HLR+++P   G+ K Q++L+  L   FA++QREHHL AGDF
Sbjct  269  VNEFVKRVRAARMHCLILAHLRRQLP-YFGQKKAQEKLLRELPQHFAQLQREHHLHAGDF  327

Query  177  PSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            P V+ +R++LS + I +F KL    ++ +DD L  DIP L++   NPY
Sbjct  328  PDVQRYRDMLSAFDISRFPKLDKGALKQLDDALSVDIPRLVQLMGNPY  375



>gb|KIZ06387.1| EH domain-containing protein 4 [Monoraphidium neglectum]
Length=535

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 173/229 (76%), Gaps = 2/229 (1%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AA+CD+ILLLFDP K DISDE ++VI++LRGHDDKIRVVLNKADQVD QQLMRVYGALMW
Sbjct  308  AARCDMILLLFDPFKLDISDEMRQVIAALRGHDDKIRVVLNKADQVDQQQLMRVYGALMW  367

Query  534  SLGKVLNTPEVMRVYIGSFN-DKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRR  358
            SLGKV  TPEV RVYIGSFN DKP++ +   P    LFEKE  DLL DL +IP ++CDR+
Sbjct  368  SLGKVFRTPEVCRVYIGSFNADKPVDASRN-PECVGLFEKEHADLLEDLHEIPARSCDRK  426

Query  357  INEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDF  178
            +NEFVKR RA +IH  +I H+RK MPA+ GK   ++++++ L + F +VQREHHLPAGDF
Sbjct  427  VNEFVKRVRALRIHMMLIGHIRKHMPAVFGKDGAKRKVLEQLPEIFYEVQREHHLPAGDF  486

Query  177  PSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPYD  31
            P +  FR IL+ +    F K+ P  +  +D +L   IP+L+K F NPY+
Sbjct  487  PDLGRFRSILATFDFTLFPKMTPDKLATIDAVLAEYIPNLVKAFDNPYN  535



>ref|XP_002499973.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61231.1| predicted protein [Micromonas sp. RCC299]
Length=427

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 168/227 (74%), Gaps = 1/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AA+ D+ILLLFDPHK DISDEFK VI+SLRGHDDK+RVVLNKADQV  QQLMRVYGALMW
Sbjct  202  AARSDVILLLFDPHKLDISDEFKSVIASLRGHDDKVRVVLNKADQVSAQQLMRVYGALMW  261

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV NTPEV +VY+GSFND+P+N T    LG ELFEKEQ DL  DL DIP+++CDR++
Sbjct  262  SLGKVFNTPEVCKVYVGSFNDQPLN-TENNQLGAELFEKEQSDLKRDLLDIPQRSCDRKV  320

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKR RA   HA I++HLR +MP M G    Q++L+  L  EF +    H +P GD P
Sbjct  321  NEFVKRVRACVTHAKIMTHLRGKMPLMAGHESKQKKLLGRLDKEFEECVHTHQIPKGDLP  380

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            +   F EI  G  I K  K+  K ++A++++L  DIP++++ F NP+
Sbjct  381  NERRFAEICKGMPIWKMPKVDKKQMKALEEVLSVDIPEVMRRFDNPF  427



>ref|XP_011402336.1| EH domain-containing protein 1 [Auxenochlorella protothecoides]
 gb|KFM29283.1| EH domain-containing protein 1 [Auxenochlorella protothecoides]
Length=598

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 174/243 (72%), Gaps = 18/243 (7%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            AA+CDLILLLFDP+K DISDEFK VIS+LRGHDDK+R+VLNKAD VD QQLMRVYGALMW
Sbjct  357  AARCDLILLLFDPYKLDISDEFKEVISTLRGHDDKVRIVLNKADSVDQQQLMRVYGALMW  416

Query  534  SLGKVLNTPEVMRVYIGSFN-DKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRR  358
            SLGKV  +PEV RVYIGSFN   PI +    P  K LFEKEQ+DLL DL DIP ++CDR+
Sbjct  417  SLGKVFRSPEVCRVYIGSFNASNPIRDDVN-PTCKPLFEKEQEDLLHDLYDIPARSCDRK  475

Query  357  INEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQRE----HHLP  190
            +NEFVKR RAAKIH  I+ HLRK+MP   G+ K Q++L+DNLA+EF +  R      H P
Sbjct  476  VNEFVKRVRAAKIHCLIMGHLRKQMP-YFGQKKAQEKLMDNLANEFRQGLRSCIWIQHPP  534

Query  189  -----------AGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFR  43
                       AGDFP V  +R+ILS + I KF KL   M++ +DD L  DIP L++   
Sbjct  535  DAIANVIHPADAGDFPDVNRYRDILSAFDISKFTKLDKSMIKQIDDSLSIDIPQLVRQMD  594

Query  42   NPY  34
            NPY
Sbjct  595  NPY  597



>ref|XP_004365433.1| hypothetical protein CAOG_00562 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89000.1| hypothetical protein CAOG_000562 [Capsaspora owczarzaki ATCC 
30864]
Length=534

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 170/223 (76%), Gaps = 4/223 (2%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A KCDLILLLFD HK DISDEFKRVI+SL+GHDDKIR+VLNKAD +  QQLMRVYGALMW
Sbjct  178  AEKCDLILLLFDAHKLDISDEFKRVITSLKGHDDKIRLVLNKADMITGQQLMRVYGALMW  237

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV+ TPEVMRVYIGSF D+P++        K LF+ EQ DLLSDL+ +P+ +  R+I
Sbjct  238  SLGKVIQTPEVMRVYIGSFWDQPLHNDEN----KRLFDAEQRDLLSDLRALPRNSAVRKI  293

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NE VKRAR AK+HA IISHL+ EMPAM GK+  Q  LI NL +E  K+QR+H +P GDFP
Sbjct  294  NELVKRARLAKVHALIISHLKNEMPAMFGKSAKQAELIANLEEECVKIQRQHGIPPGDFP  353

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNF  46
             +   +E+LS +   KF KL  ++++++D++L  DIP L++ F
Sbjct  354  DLNRMKELLSVHDFGKFPKLDKRIIESMDEVLANDIPALMRKF  396



>ref|XP_003055188.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60440.1| predicted protein [Micromonas pusilla CCMP1545]
Length=526

 Score =   274 bits (700),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 171/227 (75%), Gaps = 1/227 (0%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A++ D+ILLLFDPHK DISDEFK VISSLRGHDDK+RVVLNKADQV  QQLMRVYGALMW
Sbjct  301  ASRSDVILLLFDPHKLDISDEFKAVISSLRGHDDKVRVVLNKADQVSAQQLMRVYGALMW  360

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV  TPEV +VY+GSFNDKP   T    LG+ELF KE + L  DL DIP+++CDR++
Sbjct  361  SLGKVFMTPEVCKVYVGSFNDKP-PVTTNNVLGEELFMKEHEALKKDLLDIPQRSCDRKV  419

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKR RAA  HA I++HL+K+MPAMMG    Q++L+  + +EF K   E+ +  GD P
Sbjct  420  NEFVKRVRAALTHARIVTHLKKQMPAMMGHESKQKKLLGRIEEEFTKCVHEYTIARGDLP  479

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFRNPY  34
            + + FR+I+    I KF K+  K ++A++++L  DIP ++K F NP+
Sbjct  480  NPKRFRDIMKDMEIWKFPKIDKKAMKALEEVLTVDIPAVMKKFDNPF  526



>gb|ABI13180.1| hypothetical protein [Emiliania huxleyi]
Length=417

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 163/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A++ D+ILLLFD HK DISDEFK  I +L+GHDDKIRVVLNKAD VD+Q+L+R+YGALMW
Sbjct  172  ASRADVILLLFDAHKLDISDEFKEAIEALKGHDDKIRVVLNKADAVDSQKLLRIYGALMW  231

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV+ TPE MRVYIGSF D+P+  +      ++LFE E  DLL+DLK++PK A  R++
Sbjct  232  SLGKVIKTPECMRVYIGSFWDQPLRGSE---WSRQLFEMEMRDLLTDLKNVPKNAAVRKV  288

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NE VKR R AK HA+I+ HL+KEMP+  G  K Q +L+ N+ + F KV R H LP GDFP
Sbjct  289  NELVKRVRLAKAHAYIVGHLKKEMPSYFGAQKAQAKLLANIEEHFLKVHRAHSLPVGDFP  348

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNF  46
             V  FR ++ G+ + KF KL  K + A++ +L ++IP L+  F
Sbjct  349  DVAKFRAVMEGHDLTKFPKLDTKAIAAMEHVLAHEIPKLMAQF  391



>gb|KFQ44554.1| EH domain-containing protein 4, partial [Nestor notabilis]
Length=463

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 166/232 (72%), Gaps = 6/232 (3%)
 Frame = -2

Query  732  WCDIL--VAAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLM  559
            +C +L   A + D I+LLFD HK DISDEF   I S RG DDKIRVVLNKADQVDTQQLM
Sbjct  96   FCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLM  155

Query  558  RVYGALMWSLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIP  379
            RVYGALMWSLGKV+NTPEV+RVYIGSF   P+  T      + LFE E  DL  D++ +P
Sbjct  156  RVYGALMWSLGKVINTPEVLRVYIGSFWSNPLRNTEN----RRLFEAEAQDLFKDIQGLP  211

Query  378  KKACDRRINEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREH  199
            +KA  R++N+ +KRAR AK+HA+IIS+L+KEMP++ GK   ++ LI  L + + ++QRE+
Sbjct  212  QKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKKELISRLPEIYTQLQREY  271

Query  198  HLPAGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFR  43
            H+ AGDFP V+  +E+L  Y   KF  LKPK+++AVD+ML   I  L+   R
Sbjct  272  HISAGDFPEVKKMQELLENYDFTKFHSLKPKLIEAVDNMLANKIASLMNLIR  323



>ref|XP_010016866.1| PREDICTED: EH domain-containing protein 4, partial [Nestor notabilis]
Length=462

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 166/232 (72%), Gaps = 6/232 (3%)
 Frame = -2

Query  732  WCDIL--VAAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLM  559
            +C +L   A + D I+LLFD HK DISDEF   I S RG DDKIRVVLNKADQVDTQQLM
Sbjct  95   FCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLM  154

Query  558  RVYGALMWSLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIP  379
            RVYGALMWSLGKV+NTPEV+RVYIGSF   P+  T      + LFE E  DL  D++ +P
Sbjct  155  RVYGALMWSLGKVINTPEVLRVYIGSFWSNPLRNTEN----RRLFEAEAQDLFKDIQGLP  210

Query  378  KKACDRRINEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREH  199
            +KA  R++N+ +KRAR AK+HA+IIS+L+KEMP++ GK   ++ LI  L + + ++QRE+
Sbjct  211  QKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKKELISRLPEIYTQLQREY  270

Query  198  HLPAGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFR  43
            H+ AGDFP V+  +E+L  Y   KF  LKPK+++AVD+ML   I  L+   R
Sbjct  271  HISAGDFPEVKKMQELLENYDFTKFHSLKPKLIEAVDNMLANKIASLMNLIR  322



>ref|XP_005780580.1| RME1A, RME-1/EHD family protein [Emiliania huxleyi CCMP1516]
 gb|EOD28151.1| RME1A, RME-1/EHD family protein [Emiliania huxleyi CCMP1516]
Length=562

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 163/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A++ D+ILLLFD HK DISDEFK  I +L+GHDDKIRVVLNKAD VD+Q+L+R+YGALMW
Sbjct  172  ASRADVILLLFDAHKLDISDEFKEAIEALKGHDDKIRVVLNKADAVDSQKLLRIYGALMW  231

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            SLGKV+ TPE MRVYIGSF D+P+  +      ++LFE E  DLL+DLK++PK A  R++
Sbjct  232  SLGKVIKTPECMRVYIGSFWDQPLRGSE---WSRQLFEMEMRDLLTDLKNVPKNAAVRKV  288

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NE VKR R AK HA+I+ HL+KEMP+  G  K Q +L+ N+ + F KV R H LP GDFP
Sbjct  289  NELVKRVRLAKAHAYIVGHLKKEMPSYFGAQKAQAKLLANIEEHFLKVHRAHSLPVGDFP  348

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNF  46
             V  FR ++ G+ + KF KL  K + A++ +L ++IP L+  F
Sbjct  349  DVAKFRAVMEGHDLTKFPKLDTKAIAAMEHVLAHEIPKLMAQF  391



>emb|CCI42136.1| unnamed protein product [Albugo candida]
Length=549

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 167/220 (76%), Gaps = 4/220 (2%)
 Frame = -2

Query  714  AAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMW  535
            A + DLILLLFD HK DISDEF+RVI  L+GHDDKIR VLNKADQ+D Q+LMRVYGALMW
Sbjct  202  AERSDLILLLFDAHKLDISDEFQRVIEVLKGHDDKIRCVLNKADQIDRQRLMRVYGALMW  261

Query  534  SLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIPKKACDRRI  355
            S+GKVL TPEV+RV+IGSF D+P+  T       ELFE E++DLL++L+++P+ A  R+I
Sbjct  262  SMGKVLKTPEVLRVFIGSFWDQPMVFTDNA----ELFEAEENDLLTELRNLPQNAAIRKI  317

Query  354  NEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREHHLPAGDFP  175
            NEFVKRAR AK+H F+I  LR +MPAM+GK K Q+ LI+NL + F +VQR +HLP GDFP
Sbjct  318  NEFVKRARLAKVHCFLIGVLRDKMPAMIGKEKKQKALIENLGETFREVQRRYHLPPGDFP  377

Query  174  SVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLL  55
             ++ F++ L  +   KF  L  K +Q +D++L  DIP L+
Sbjct  378  QLDEFQKKLVDHKFQKFATLNVKGIQEIDELLSKDIPKLM  417



>ref|XP_005143974.1| PREDICTED: EH domain-containing protein 4 [Melopsittacus undulatus]
Length=541

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 166/232 (72%), Gaps = 6/232 (3%)
 Frame = -2

Query  732  WCDIL--VAAKCDLILLLFDPHKXDISDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLM  559
            +C +L   A + D I+LLFD HK DISDEF   I S RG DDKIRVVLNKADQVDTQQLM
Sbjct  174  FCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKSFRGQDDKIRVVLNKADQVDTQQLM  233

Query  558  RVYGALMWSLGKVLNTPEVMRVYIGSFNDKPINETATGPLGKELFEKEQDDLLSDLKDIP  379
            RVYGALMWSLGKV+NTPEV+RVYIGSF   P+  T      + LFE E  DL  D++ +P
Sbjct  234  RVYGALMWSLGKVINTPEVLRVYIGSFWSNPLRNTEN----RRLFEAEAQDLFKDIQGLP  289

Query  378  KKACDRRINEFVKRARAAKIHAFIISHLRKEMPAMMGKAKTQQRLIDNLADEFAKVQREH  199
            +KA  R++N+ +KRAR AK+HA+IIS+L+KEMP++ GK   ++ LI  L D + ++QRE+
Sbjct  290  QKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKKELISRLPDIYIQLQREY  349

Query  198  HLPAGDFPSVEHFREILSGYSIDKFEKLKPKMVQAVDDMLGYDIPDLLKNFR  43
            H+ AGDFP V+  +E+L  Y   KF  LKPK+++AVD+ML   I  L+   R
Sbjct  350  HISAGDFPEVKKMQELLENYDFTKFHSLKPKLIEAVDNMLANKIASLMNLIR  401



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680