BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020D23

Length=696
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006340784.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    292   3e-95   Solanum tuberosum [potatoes]
ref|XP_006380560.1|  hypothetical protein POPTR_0007s09270g             291   1e-94   
ref|XP_007046593.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    290   1e-94   
gb|KHG30312.1|  Prolyl 4-hydroxylase subunit alpha-1                    291   1e-94   Gossypium arboreum [tree cotton]
ref|XP_009622125.1|  PREDICTED: probable prolyl 4-hydroxylase 10        290   2e-94   Nicotiana tomentosiformis
gb|KJB43227.1|  hypothetical protein B456_007G190600                    289   6e-94   Gossypium raimondii
ref|XP_011014780.1|  PREDICTED: probable prolyl 4-hydroxylase 10        288   1e-93   Populus euphratica
ref|XP_004232524.1|  PREDICTED: probable prolyl 4-hydroxylase 10        288   1e-93   Solanum lycopersicum
gb|EYU30384.1|  hypothetical protein MIMGU_mgv1a011046mg                286   7e-93   Erythranthe guttata [common monkey flower]
ref|XP_009776785.1|  PREDICTED: probable prolyl 4-hydroxylase 10        286   8e-93   Nicotiana sylvestris
ref|XP_006383041.1|  hypothetical protein POPTR_0005s10980g             284   4e-92   Populus trichocarpa [western balsam poplar]
ref|XP_011022255.1|  PREDICTED: probable prolyl 4-hydroxylase 10        284   5e-92   Populus euphratica
ref|XP_010485337.1|  PREDICTED: probable prolyl 4-hydroxylase 10        280   5e-92   
gb|KHN35999.1|  Prolyl 4-hydroxylase subunit alpha-1                    284   5e-92   Glycine soja [wild soybean]
emb|CDP01844.1|  unnamed protein product                                284   6e-92   Coffea canephora [robusta coffee]
emb|CDX81416.1|  BnaC09g08270D                                          283   2e-91   
ref|NP_001242522.1|  uncharacterized protein LOC100806046               282   2e-91   
ref|XP_009112275.1|  PREDICTED: probable prolyl 4-hydroxylase 10        282   2e-91   Brassica rapa
ref|XP_010465981.1|  PREDICTED: probable prolyl 4-hydroxylase 10 ...    282   2e-91   Camelina sativa [gold-of-pleasure]
ref|XP_010444842.1|  PREDICTED: probable prolyl 4-hydroxylase 10        282   2e-91   Camelina sativa [gold-of-pleasure]
ref|XP_008440878.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    282   3e-91   Cucumis melo [Oriental melon]
ref|XP_011079010.1|  PREDICTED: probable prolyl 4-hydroxylase 10        282   4e-91   Sesamum indicum [beniseed]
ref|XP_009587704.1|  PREDICTED: probable prolyl 4-hydroxylase 10        281   6e-91   Nicotiana tomentosiformis
ref|XP_007202401.1|  hypothetical protein PRUPE_ppa009475mg             281   6e-91   Prunus persica
ref|NP_201407.4|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    281   6e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007046594.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    281   8e-91   
ref|XP_010113287.1|  Prolyl 4-hydroxylase subunit alpha-1               281   8e-91   Morus notabilis
gb|KDO71355.1|  hypothetical protein CISIN_1g023009mg                   277   9e-91   Citrus sinensis [apfelsine]
ref|XP_004134841.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    280   1e-90   Cucumis sativus [cucumbers]
ref|XP_006280909.1|  hypothetical protein CARUB_v10026902mg             280   1e-90   Capsella rubella
ref|XP_009344824.1|  PREDICTED: probable prolyl 4-hydroxylase 10        281   1e-90   Pyrus x bretschneideri [bai li]
ref|XP_009801759.1|  PREDICTED: probable prolyl 4-hydroxylase 10        280   1e-90   Nicotiana sylvestris
gb|EPS71884.1|  hypothetical protein M569_02873                         280   2e-90   Genlisea aurea
ref|XP_002263060.1|  PREDICTED: probable prolyl 4-hydroxylase 10        280   2e-90   Vitis vinifera
ref|XP_006425363.1|  hypothetical protein CICLE_v10026208mg             280   2e-90   Citrus clementina [clementine]
ref|XP_006342080.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    280   2e-90   Solanum tuberosum [potatoes]
ref|XP_006343343.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    280   2e-90   Solanum tuberosum [potatoes]
ref|XP_004234520.1|  PREDICTED: probable prolyl 4-hydroxylase 10        280   2e-90   Solanum lycopersicum
ref|XP_008242010.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    280   2e-90   Prunus mume [ume]
ref|XP_003538892.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    280   3e-90   Glycine max [soybeans]
ref|XP_008337965.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    280   3e-90   Malus domestica [apple tree]
gb|KDO71350.1|  hypothetical protein CISIN_1g023009mg                   280   3e-90   Citrus sinensis [apfelsine]
gb|KDO71351.1|  hypothetical protein CISIN_1g023009mg                   279   3e-90   Citrus sinensis [apfelsine]
emb|CAN64470.1|  hypothetical protein VITISV_014644                     279   4e-90   Vitis vinifera
ref|XP_004238387.1|  PREDICTED: probable prolyl 4-hydroxylase 3         279   4e-90   Solanum lycopersicum
ref|XP_006467024.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    279   4e-90   Citrus sinensis [apfelsine]
ref|XP_006467023.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    279   4e-90   Citrus sinensis [apfelsine]
gb|KJB48235.1|  hypothetical protein B456_008G061800                    279   4e-90   Gossypium raimondii
ref|XP_006425365.1|  hypothetical protein CICLE_v10026208mg             277   5e-90   
ref|XP_006393794.1|  hypothetical protein EUTSA_v10004714mg             279   5e-90   Eutrema salsugineum [saltwater cress]
ref|XP_004158845.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    279   6e-90   
ref|XP_010550487.1|  PREDICTED: probable prolyl 4-hydroxylase 10        278   7e-90   Tarenaya hassleriana [spider flower]
ref|XP_004291329.1|  PREDICTED: probable prolyl 4-hydroxylase 3         279   7e-90   Fragaria vesca subsp. vesca
gb|KDO71354.1|  hypothetical protein CISIN_1g023009mg                   276   1e-89   Citrus sinensis [apfelsine]
ref|XP_009363441.1|  PREDICTED: probable prolyl 4-hydroxylase 10        278   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_007157869.1|  hypothetical protein PHAVU_002G104900g             278   2e-89   Phaseolus vulgaris [French bean]
ref|XP_010029633.1|  PREDICTED: probable prolyl 4-hydroxylase 10        279   3e-89   Eucalyptus grandis [rose gum]
ref|XP_009337076.1|  PREDICTED: probable prolyl 4-hydroxylase 10        276   4e-89   Pyrus x bretschneideri [bai li]
gb|KDP23952.1|  hypothetical protein JCGZ_25340                         275   1e-88   Jatropha curcas
ref|XP_002285898.1|  PREDICTED: probable prolyl 4-hydroxylase 3         275   2e-88   Vitis vinifera
gb|KHG25173.1|  P4ha[2]: Prolyl 4-hydroxylase subunit alpha-1           277   2e-88   Gossypium arboreum [tree cotton]
ref|XP_008393737.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    275   2e-88   Malus domestica [apple tree]
gb|KHN09058.1|  Prolyl 4-hydroxylase subunit alpha-2                    275   3e-88   Glycine soja [wild soybean]
ref|XP_002530636.1|  prolyl 4-hydroxylase alpha subunit, putative       274   4e-88   Ricinus communis
ref|XP_004512179.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    274   4e-88   
ref|XP_010033532.1|  PREDICTED: probable prolyl 4-hydroxylase 10        274   5e-88   Eucalyptus grandis [rose gum]
ref|XP_003612249.1|  Prolyl 4-hydroxylase alpha-2 subunit               273   6e-88   Medicago truncatula
ref|XP_008377129.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    273   9e-88   Malus domestica [apple tree]
ref|XP_004287769.1|  PREDICTED: probable prolyl 4-hydroxylase 10        273   1e-87   Fragaria vesca subsp. vesca
ref|XP_006581148.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    273   1e-87   Glycine max [soybeans]
ref|XP_010266900.1|  PREDICTED: probable prolyl 4-hydroxylase 3         273   1e-87   Nelumbo nucifera [Indian lotus]
ref|XP_007156206.1|  hypothetical protein PHAVU_003G267200g             273   1e-87   Phaseolus vulgaris [French bean]
gb|KHG25174.1|  phy-2: Prolyl 4-hydroxylase subunit alpha-2             273   6e-87   Gossypium arboreum [tree cotton]
ref|XP_010061109.1|  PREDICTED: probable prolyl 4-hydroxylase 3         272   7e-87   Eucalyptus grandis [rose gum]
ref|XP_010100124.1|  Prolyl 4-hydroxylase subunit alpha-2               270   9e-87   Morus notabilis
ref|XP_009620049.1|  PREDICTED: probable prolyl 4-hydroxylase 3         271   1e-86   Nicotiana tomentosiformis
ref|XP_006577956.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    270   1e-86   Glycine max [soybeans]
ref|XP_006577957.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    270   1e-86   Glycine max [soybeans]
ref|XP_007017902.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    270   2e-86   Theobroma cacao [chocolate]
gb|KDP36874.1|  hypothetical protein JCGZ_08165                         269   3e-86   Jatropha curcas
ref|XP_007136121.1|  hypothetical protein PHAVU_009G019600g             269   4e-86   Phaseolus vulgaris [French bean]
ref|XP_010266054.1|  PREDICTED: probable prolyl 4-hydroxylase 3         269   4e-86   Nelumbo nucifera [Indian lotus]
ref|XP_008221210.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    269   5e-86   Prunus mume [ume]
ref|XP_008387904.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    268   6e-86   
gb|KGN60775.1|  hypothetical protein Csa_2G009620                       267   6e-86   Cucumis sativus [cucumbers]
ref|XP_008387906.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    268   8e-86   
ref|XP_004171765.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    268   8e-86   
ref|XP_009798871.1|  PREDICTED: probable prolyl 4-hydroxylase 3         268   9e-86   Nicotiana sylvestris
ref|XP_010536435.1|  PREDICTED: probable prolyl 4-hydroxylase 3         268   1e-85   Tarenaya hassleriana [spider flower]
gb|KHG14293.1|  Prolyl 4-hydroxylase subunit alpha-2                    268   1e-85   Gossypium arboreum [tree cotton]
gb|KJB59736.1|  hypothetical protein B456_009G269000                    267   1e-85   Gossypium raimondii
gb|ACR34708.1|  unknown                                                 263   2e-85   Zea mays [maize]
ref|XP_009334602.1|  PREDICTED: probable prolyl 4-hydroxylase 3         267   2e-85   Pyrus x bretschneideri [bai li]
gb|ACN35795.1|  unknown                                                 263   2e-85   Zea mays [maize]
gb|EYU36811.1|  hypothetical protein MIMGU_mgv1a011044mg                267   3e-85   Erythranthe guttata [common monkey flower]
ref|XP_007223346.1|  hypothetical protein PRUPE_ppa009548mg             266   3e-85   
ref|XP_010539828.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    266   3e-85   Tarenaya hassleriana [spider flower]
ref|XP_010940405.1|  PREDICTED: probable prolyl 4-hydroxylase 3         266   4e-85   Elaeis guineensis
gb|KJB59733.1|  hypothetical protein B456_009G269000                    266   4e-85   Gossypium raimondii
ref|XP_008456388.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    266   5e-85   Cucumis melo [Oriental melon]
ref|XP_008809395.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    266   6e-85   Phoenix dactylifera
ref|XP_008809398.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    266   6e-85   Phoenix dactylifera
ref|XP_002893096.1|  oxidoreductase                                     266   7e-85   
ref|XP_006305481.1|  hypothetical protein CARUB_v10009921mg             265   9e-85   Capsella rubella
ref|XP_010548243.1|  PREDICTED: prolyl 4-hydroxylase 5                  265   9e-85   Tarenaya hassleriana [spider flower]
ref|XP_010539831.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    264   1e-84   Tarenaya hassleriana [spider flower]
emb|CDX96644.1|  BnaA08g21870D                                          265   1e-84   
ref|NP_564109.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    265   1e-84   Arabidopsis thaliana [mouse-ear cress]
emb|CDP07346.1|  unnamed protein product                                265   1e-84   Coffea canephora [robusta coffee]
ref|XP_010459709.1|  PREDICTED: probable prolyl 4-hydroxylase 3         265   1e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010477260.1|  PREDICTED: probable prolyl 4-hydroxylase 3         265   2e-84   Camelina sativa [gold-of-pleasure]
dbj|BAD23054.1|  putative prolyl 4-hydroxylase                          265   2e-84   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006449333.1|  hypothetical protein CICLE_v10016152mg             265   2e-84   Citrus clementina [clementine]
gb|EPS63604.1|  iron ion binding / oxidoreductase/ oxidoreductase...    264   2e-84   Genlisea aurea
ref|XP_010918436.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    265   2e-84   Elaeis guineensis
ref|XP_010918438.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    264   2e-84   Elaeis guineensis
emb|CDY54327.1|  BnaCnng26730D                                          265   2e-84   Brassica napus [oilseed rape]
ref|XP_008778322.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    265   3e-84   Phoenix dactylifera
ref|XP_009110235.1|  PREDICTED: probable prolyl 4-hydroxylase 3         264   3e-84   Brassica rapa
ref|XP_010531576.1|  PREDICTED: prolyl 4-hydroxylase 5-like             265   4e-84   Tarenaya hassleriana [spider flower]
gb|EMT22590.1|  Prolyl 4-hydroxylase subunit alpha-1                    261   4e-84   
ref|XP_003629229.1|  Prolyl 4-hydroxylase alpha-2 subunit               263   4e-84   Medicago truncatula
ref|XP_004139389.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    263   4e-84   
emb|CDY51328.1|  BnaCnng20650D                                          263   6e-84   Brassica napus [oilseed rape]
gb|AAM61711.1|  putative prolyl 4-hydroxylase, alpha subunit            263   6e-84   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29362.1|  BnaA06g14340D                                          263   6e-84   Brassica napus [oilseed rape]
ref|XP_010498461.1|  PREDICTED: probable prolyl 4-hydroxylase 3         263   8e-84   Camelina sativa [gold-of-pleasure]
gb|KJB29665.1|  hypothetical protein B456_005G112700                    263   1e-83   Gossypium raimondii
ref|XP_002453082.1|  hypothetical protein SORBIDRAFT_04g038020          263   1e-83   Sorghum bicolor [broomcorn]
ref|XP_003603828.1|  Prolyl 4-hydroxylase alpha-2 subunit               258   1e-83   
ref|XP_003603827.1|  Prolyl 4-hydroxylase alpha-2 subunit               262   1e-83   Medicago truncatula
ref|XP_006648159.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    263   2e-83   Oryza brachyantha
ref|XP_010266902.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    263   2e-83   
ref|XP_010266901.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    263   2e-83   Nelumbo nucifera [Indian lotus]
ref|XP_010667434.1|  PREDICTED: probable prolyl 4-hydroxylase 3         262   2e-83   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB58041.1|  hypothetical protein B456_009G191400                    261   3e-83   Gossypium raimondii
ref|XP_003574128.1|  PREDICTED: probable prolyl 4-hydroxylase 3         262   3e-83   Brachypodium distachyon [annual false brome]
gb|AFK48224.1|  unknown                                                 258   3e-83   Lotus japonicus
ref|NP_001241865.1|  prolyl 4-hydroxylase 5-1                           258   3e-83   
ref|NP_001151238.1|  LOC100284871                                       262   3e-83   Zea mays [maize]
ref|XP_011074717.1|  PREDICTED: probable prolyl 4-hydroxylase 3         261   4e-83   Sesamum indicum [beniseed]
ref|XP_010683036.1|  PREDICTED: probable prolyl 4-hydroxylase 10        261   4e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006661912.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    259   4e-83   Oryza brachyantha
ref|NP_001159002.1|  prolyl 4-hydroxylase alpha-2 subunit               261   5e-83   Zea mays [maize]
dbj|BAJ85763.1|  predicted protein                                      261   6e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK01841.1|  predicted protein                                      261   6e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB58040.1|  hypothetical protein B456_009G191400                    259   7e-83   Gossypium raimondii
ref|XP_004954469.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    261   8e-83   Setaria italica
ref|XP_006285542.1|  hypothetical protein CARUB_v10006984mg             260   1e-82   Capsella rubella
ref|XP_009386075.1|  PREDICTED: probable prolyl 4-hydroxylase 3         260   1e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008778312.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    261   1e-82   
ref|XP_006828848.1|  hypothetical protein AMTR_s00001p00155640          260   1e-82   
ref|XP_002467008.1|  hypothetical protein SORBIDRAFT_01g018200          261   1e-82   Sorghum bicolor [broomcorn]
ref|XP_002510597.1|  prolyl 4-hydroxylase alpha subunit, putative       259   2e-82   
ref|NP_001241694.1|  prolyl 4-hydroxylase 8-4                           260   2e-82   
gb|ABK24739.1|  unknown                                                 260   2e-82   Picea sitchensis
gb|EPS68098.1|  hypothetical protein M569_06675                         258   4e-82   Genlisea aurea
ref|XP_011083428.1|  PREDICTED: probable prolyl 4-hydroxylase 3         259   4e-82   Sesamum indicum [beniseed]
ref|XP_002307750.2|  oxidoreductase family protein                      259   4e-82   
ref|NP_001131953.1|  uncharacterized protein LOC100193348               259   4e-82   Zea mays [maize]
ref|NP_001241695.1|  prolyl 4-hydroxylase 8-5                           259   7e-82   
emb|CDY07826.1|  BnaC03g47960D                                          258   9e-82   Brassica napus [oilseed rape]
tpg|DAA49456.1|  TPA: hypothetical protein ZEAMMB73_536273              260   9e-82   
ref|XP_006409254.1|  hypothetical protein EUTSA_v10022796mg             258   1e-81   Eutrema salsugineum [saltwater cress]
ref|XP_009150770.1|  PREDICTED: prolyl 4-hydroxylase 5 isoform X1       258   1e-81   Brassica rapa
ref|XP_003570489.1|  PREDICTED: probable prolyl 4-hydroxylase 3         258   1e-81   Brachypodium distachyon [annual false brome]
emb|CDY29194.1|  BnaA06g25630D                                          257   1e-81   Brassica napus [oilseed rape]
ref|XP_009150771.1|  PREDICTED: prolyl 4-hydroxylase 5 isoform X2       257   2e-81   Brassica rapa
ref|XP_009394475.1|  PREDICTED: probable prolyl 4-hydroxylase 3         257   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011003088.1|  PREDICTED: probable prolyl 4-hydroxylase 3         256   2e-81   Populus euphratica
ref|XP_009121088.1|  PREDICTED: prolyl 4-hydroxylase 5-like             257   3e-81   Brassica rapa
ref|XP_006298248.1|  hypothetical protein CARUB_v10014309mg             256   3e-81   Capsella rubella
ref|NP_179363.1|  prolyl 4-hydroxylase 5                                256   3e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266057.1|  PREDICTED: probable prolyl 4-hydroxylase 10        257   3e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010446875.1|  PREDICTED: prolyl 4-hydroxylase 5-like             256   3e-81   Camelina sativa [gold-of-pleasure]
emb|CDY20811.1|  BnaC07g06600D                                          256   4e-81   Brassica napus [oilseed rape]
gb|AAM65040.1|  putative prolyl 4-hydroxylase, alpha subunit            256   4e-81   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24364.1|  BnaA07g02890D                                          256   4e-81   Brassica napus [oilseed rape]
ref|XP_010266056.1|  PREDICTED: probable prolyl 4-hydroxylase 3         257   4e-81   
ref|XP_010489402.1|  PREDICTED: prolyl 4-hydroxylase 5                  256   4e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010514697.1|  PREDICTED: prolyl 4-hydroxylase 5-like             256   4e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010467565.1|  PREDICTED: prolyl 4-hydroxylase 5                  256   7e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002884079.1|  oxidoreductase                                     256   7e-81   
ref|XP_009397948.1|  PREDICTED: probable prolyl 4-hydroxylase 3         255   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010437420.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    254   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010437419.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    254   3e-80   Camelina sativa [gold-of-pleasure]
ref|XP_003629237.1|  Prolyl 4-hydroxylase alpha-2 subunit               253   4e-80   Medicago truncatula
ref|XP_010432225.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    253   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010432226.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    253   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_008456352.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    253   7e-80   
ref|XP_004167095.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    251   9e-80   
gb|KHG08442.1|  Prolyl 4-hydroxylase subunit alpha-1                    253   9e-80   Gossypium arboreum [tree cotton]
ref|XP_009392830.1|  PREDICTED: probable prolyl 4-hydroxylase 3         253   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418644.1|  PREDICTED: probable prolyl 4-hydroxylase 3         252   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE51215.1|  hypothetical protein OsJ_32038                          248   7e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010446308.1|  PREDICTED: probable prolyl 4-hydroxylase 10        245   2e-78   
ref|NP_001064962.1|  Os10g0497800                                       250   2e-78   
gb|EYU17561.1|  hypothetical protein MIMGU_mgv1a0210091mg               246   2e-78   Erythranthe guttata [common monkey flower]
emb|CDX69169.1|  BnaC01g02840D                                          249   2e-78   
gb|KCW70504.1|  hypothetical protein EUGRSUZ_F03711                     249   3e-78   Eucalyptus grandis [rose gum]
gb|KJB43228.1|  hypothetical protein B456_007G190600                    248   3e-78   Gossypium raimondii
ref|XP_010935631.1|  PREDICTED: probable prolyl 4-hydroxylase 3         248   5e-78   Elaeis guineensis
ref|XP_008802391.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    248   8e-78   
emb|CDX75528.1|  BnaA01g01740D                                          248   8e-78   
ref|XP_008802369.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    248   1e-77   Phoenix dactylifera
ref|XP_003629236.1|  Prolyl 4-hydroxylase alpha-2 subunit               249   1e-77   
ref|XP_002869059.1|  oxidoreductase                                     247   1e-77   Arabidopsis lyrata subsp. lyrata
ref|XP_010432223.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    247   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010432224.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    247   2e-77   Camelina sativa [gold-of-pleasure]
emb|CDY24822.1|  BnaA08g14880D                                          247   2e-77   Brassica napus [oilseed rape]
ref|XP_009109263.1|  PREDICTED: prolyl 4-hydroxylase 5-like             246   3e-77   Brassica rapa
ref|NP_195306.2|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    246   5e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002978409.1|  hypothetical protein SELMODRAFT_418273             244   6e-77   
ref|XP_002970251.1|  hypothetical protein SELMODRAFT_411114             243   2e-76   
ref|XP_002866777.1|  oxidoreductase                                     242   7e-76   
dbj|BAB10411.1|  prolyl 4-hydroxylase, alpha subunit-like protein       242   8e-76   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE92293.1|  putative prolyl 4-hydroxylase, alpha subunit           241   3e-75   Cryptomeria japonica
ref|XP_009149485.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    241   5e-75   Brassica rapa
ref|XP_004982729.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    241   7e-75   Setaria italica
ref|XP_006425362.1|  hypothetical protein CICLE_v10026208mg             238   2e-74   
ref|XP_003520105.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    239   3e-74   Glycine max [soybeans]
gb|KDO71356.1|  hypothetical protein CISIN_1g023009mg                   238   3e-74   Citrus sinensis [apfelsine]
ref|XP_003520111.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    238   5e-74   Glycine max [soybeans]
gb|KJB48236.1|  hypothetical protein B456_008G061800                    237   6e-74   Gossypium raimondii
ref|XP_007017903.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    236   1e-73   
ref|XP_001754091.1|  predicted protein                                  233   4e-73   
ref|XP_003629231.1|  Prolyl 4-hydroxylase alpha-2 subunit               235   5e-73   Medicago truncatula
gb|AGP04974.1|  prolyl-4-hydroxylase 5                                  234   2e-72   Physcomitrella patens
gb|AGP04976.1|  prolyl-4-hydroxylase 6_b                                232   1e-71   Physcomitrella patens
ref|XP_007017904.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    232   1e-71   
ref|XP_001782374.1|  predicted protein                                  229   2e-71   
ref|XP_008456383.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    231   3e-71   Cucumis melo [Oriental melon]
ref|XP_006598732.1|  PREDICTED: uncharacterized protein LOC100782...    231   3e-71   Glycine max [soybeans]
gb|KJB59734.1|  hypothetical protein B456_009G269000                    231   3e-71   Gossypium raimondii
emb|CDY41627.1|  BnaC03g62570D                                          230   5e-71   Brassica napus [oilseed rape]
ref|XP_008809399.1|  PREDICTED: probable prolyl 4-hydroxylase 3 i...    228   2e-70   
gb|AGP04975.1|  prolyl-4-hydroxylase 6_a                                230   2e-70   Physcomitrella patens
ref|XP_002989495.1|  hypothetical protein SELMODRAFT_129912             224   7e-70   
ref|XP_002964648.1|  hypothetical protein SELMODRAFT_82355              224   1e-69   
ref|XP_009400627.1|  PREDICTED: probable prolyl 4-hydroxylase 3         220   2e-69   
ref|XP_010480555.1|  PREDICTED: probable prolyl 4-hydroxylase 3         224   8e-69   
gb|KDO75954.1|  hypothetical protein CISIN_1g0230532mg                  223   2e-68   Citrus sinensis [apfelsine]
ref|NP_001242181.1|  uncharacterized protein LOC100782154               221   2e-67   Glycine max [soybeans]
ref|XP_004487245.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    221   2e-67   Cicer arietinum [garbanzo]
ref|XP_003629235.1|  Prolyl 4-hydroxylase alpha-2 subunit               217   3e-67   
gb|AET03711.2|  prolyl 4-hydroxylase alpha subunit, putative            217   1e-66   Medicago truncatula
gb|EEE58093.1|  hypothetical protein OsJ_08962                          219   2e-65   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74283.1|  hypothetical protein OsI_09531                          218   2e-65   Oryza sativa Indica Group [Indian rice]
gb|AAL58274.1|AC068923_16  putative prolyl 4-hydroxylase, alpha s...    211   5e-63   Oryza sativa Japonica Group [Japonica rice]
emb|CAA21467.1|  putative protein                                       209   1e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48941.1|  BnaA08g04730D                                          210   1e-61   Brassica napus [oilseed rape]
gb|AES74073.2|  prolyl 4-hydroxylase alpha-like protein                 207   5e-59   Medicago truncatula
ref|XP_006386160.1|  hypothetical protein POPTR_0002s01820g             198   1e-58   
ref|XP_003603822.1|  Prolyl 4-hydroxylase alpha-2 subunit               206   3e-58   
ref|XP_003603823.1|  Prolyl 4-hydroxylase alpha-2 subunit               194   4e-57   
gb|EMS46596.1|  Prolyl 4-hydroxylase subunit alpha-2                    193   5e-57   Triticum urartu
gb|AES74074.2|  prolyl 4-hydroxylase alpha-like protein                 194   6e-57   Medicago truncatula
ref|XP_010451037.1|  PREDICTED: probable prolyl 4-hydroxylase 11        188   8e-56   
ref|XP_002443286.1|  hypothetical protein SORBIDRAFT_08g016950          186   1e-55   
ref|NP_001190630.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...    189   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb|EMT09490.1|  Prolyl 4-hydroxylase subunit alpha-1                    189   2e-55   
ref|XP_008341521.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    191   3e-55   
ref|XP_010451038.1|  PREDICTED: probable prolyl 4-hydroxylase 11        189   6e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010437417.1|  PREDICTED: probable prolyl 4-hydroxylase 11        188   8e-55   
ref|XP_005649922.1|  hypothetical protein COCSUDRAFT_35772              186   1e-54   Coccomyxa subellipsoidea C-169
ref|XP_007032350.1|  Oxoglutarate/iron-dependent oxygenase              188   2e-54   
ref|XP_009335795.1|  PREDICTED: probable prolyl 4-hydroxylase 7         188   3e-54   Pyrus x bretschneideri [bai li]
gb|KHG25059.1|  Prolyl 4-hydroxylase subunit alpha-1                    187   4e-54   Gossypium arboreum [tree cotton]
ref|XP_008379308.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    187   4e-54   
ref|XP_008460837.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    185   4e-54   Cucumis melo [Oriental melon]
gb|KJB75782.1|  hypothetical protein B456_012G057800                    187   4e-54   Gossypium raimondii
ref|XP_008365392.1|  PREDICTED: LOW QUALITY PROTEIN: prolyl 4-hyd...    187   5e-54   
gb|ADE76168.1|  unknown                                                 186   8e-54   Picea sitchensis
gb|AAT84604.1|  prolyl 4-hydroxylase                                    187   9e-54   Dianthus caryophyllus [carnation]
gb|KHN00440.1|  Prolyl 4-hydroxylase subunit alpha-1                    191   2e-53   Glycine soja [wild soybean]
ref|XP_002517437.1|  prolyl 4-hydroxylase alpha subunit, putative       185   3e-53   Ricinus communis
ref|XP_010033232.1|  PREDICTED: probable prolyl 4-hydroxylase 7         185   3e-53   Eucalyptus grandis [rose gum]
gb|KJB40816.1|  hypothetical protein B456_007G078100                    182   5e-53   Gossypium raimondii
ref|XP_009766050.1|  PREDICTED: probable prolyl 4-hydroxylase 6         184   6e-53   Nicotiana sylvestris
ref|XP_004302371.1|  PREDICTED: probable prolyl 4-hydroxylase 7         184   6e-53   
ref|XP_010684860.1|  PREDICTED: uncharacterized protein LOC104899381    189   7e-53   
ref|XP_007215695.1|  hypothetical protein PRUPE_ppa008787mg             184   9e-53   
gb|KDP45441.1|  hypothetical protein JCGZ_09690                         184   9e-53   
gb|EPS61415.1|  type 2 proly 4-hydroxylase                              183   1e-52   
ref|XP_006836965.1|  hypothetical protein AMTR_s00098p00019020          177   2e-52   
ref|XP_008230700.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    183   2e-52   
ref|XP_004139390.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    182   3e-52   
ref|XP_009617950.1|  PREDICTED: probable prolyl 4-hydroxylase 6         182   3e-52   
ref|XP_006357128.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    182   3e-52   
ref|XP_004167094.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    182   4e-52   
gb|KJB40817.1|  hypothetical protein B456_007G078100                    181   6e-52   
ref|XP_010932926.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    181   6e-52   
gb|KJB24936.1|  hypothetical protein B456_004G168800                    179   7e-52   
ref|XP_003571778.1|  PREDICTED: probable prolyl 4-hydroxylase 7         181   1e-51   
emb|CDP20599.1|  unnamed protein product                                181   1e-51   
ref|XP_002281420.1|  PREDICTED: probable prolyl 4-hydroxylase 6         181   1e-51   
ref|XP_011008369.1|  PREDICTED: probable prolyl 4-hydroxylase 6         181   1e-51   
ref|XP_009149614.1|  PREDICTED: prolyl 4-hydroxylase 5-like isofo...    179   2e-51   
ref|XP_006291518.1|  hypothetical protein CARUB_v10017667mg             180   2e-51   
ref|XP_004233344.1|  PREDICTED: probable prolyl 4-hydroxylase 6         180   3e-51   
gb|EMT18067.1|  Prolyl 4-hydroxylase subunit alpha-2                    177   4e-51   
ref|XP_009403981.1|  PREDICTED: probable prolyl 4-hydroxylase 6 i...    179   4e-51   
gb|EYU34687.1|  hypothetical protein MIMGU_mgv1a023388mg                178   5e-51   
ref|XP_002467256.1|  hypothetical protein SORBIDRAFT_01g022150          179   7e-51   
gb|EMS64054.1|  Prolyl 4-hydroxylase subunit alpha-2                    178   7e-51   
ref|XP_009760981.1|  PREDICTED: probable prolyl 4-hydroxylase 4         178   7e-51   
gb|KDO72423.1|  hypothetical protein CISIN_1g021056mg                   176   8e-51   
gb|KJB24937.1|  hypothetical protein B456_004G168800                    178   8e-51   
emb|CDO98947.1|  unnamed protein product                                178   9e-51   
ref|XP_002977584.1|  hypothetical protein SELMODRAFT_106693             178   1e-50   
ref|XP_002954156.1|  hypothetical protein VOLCADRAFT_82641              178   1e-50   
ref|XP_008812319.1|  PREDICTED: probable prolyl 4-hydroxylase 6 i...    178   1e-50   
ref|XP_010554021.1|  PREDICTED: probable prolyl 4-hydroxylase 7         178   1e-50   
ref|XP_010255777.1|  PREDICTED: probable prolyl 4-hydroxylase 6         178   1e-50   
gb|EYU34124.1|  hypothetical protein MIMGU_mgv1a008232mg                179   2e-50   
ref|NP_001169835.1|  prolyl 4-hydroxylase 2 precursor                   177   2e-50   
dbj|BAJ97134.1|  predicted protein                                      177   2e-50   
gb|EMT08121.1|  Prolyl 4-hydroxylase subunit alpha-1                    177   3e-50   
ref|XP_006356692.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    177   3e-50   
ref|XP_010502850.1|  PREDICTED: probable prolyl 4-hydroxylase 7         177   3e-50   
ref|XP_010425628.1|  PREDICTED: probable prolyl 4-hydroxylase 7         177   3e-50   
ref|XP_010514553.1|  PREDICTED: probable prolyl 4-hydroxylase 7         177   3e-50   
pdb|2JIG|A  Chain A, Crystal Structure Of Chlamydomonas Reinhardt...    175   3e-50   
ref|XP_003564301.1|  PREDICTED: probable prolyl 4-hydroxylase 6         177   3e-50   
dbj|BAF63493.1|  prolyl 4-hydroxylase                                   175   3e-50   
pdb|3GZE|A  Chain A, Algal Prolyl 4-hydroxylase Complexed With Zi...    174   3e-50   
ref|XP_006650750.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    174   3e-50   
gb|KCW60920.1|  hypothetical protein EUGRSUZ_H03653                     175   3e-50   
ref|XP_004241065.1|  PREDICTED: probable prolyl 4-hydroxylase 4         177   3e-50   
pdb|2JIJ|A  Chain A, Crystal Structure Of The Apo Form Of Chlamyd...    175   4e-50   
gb|EMS60792.1|  Prolyl 4-hydroxylase subunit alpha-1                    176   4e-50   
ref|XP_006365272.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    176   4e-50   
ref|XP_006290404.1|  hypothetical protein CARUB_v10018771mg             176   5e-50   
ref|XP_004983172.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    176   5e-50   
ref|XP_010029258.1|  PREDICTED: probable prolyl 4-hydroxylase 7         177   5e-50   
ref|XP_006431045.1|  hypothetical protein CICLE_v10012224mg             177   6e-50   
gb|KGN60774.1|  hypothetical protein Csa_2G009610                       174   6e-50   
ref|XP_009602696.1|  PREDICTED: probable prolyl 4-hydroxylase 4         176   6e-50   
ref|NP_001176154.1|  Os10g0415128                                       174   6e-50   
ref|XP_003543632.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    176   7e-50   
ref|XP_010693781.1|  PREDICTED: probable prolyl 4-hydroxylase 4         176   7e-50   
ref|XP_004981380.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    176   8e-50   
ref|XP_006482512.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    176   8e-50   
gb|KDO72422.1|  hypothetical protein CISIN_1g021056mg                   176   8e-50   
ref|XP_002877111.1|  oxidoreductase                                     176   9e-50   
ref|XP_004229482.1|  PREDICTED: probable prolyl 4-hydroxylase 4         176   9e-50   
ref|XP_009604218.1|  PREDICTED: probable prolyl 4-hydroxylase 4         176   9e-50   
gb|AFW68767.1|  hypothetical protein ZEAMMB73_452923                    173   1e-49   
emb|CDX86429.1|  BnaA06g31460D                                          176   1e-49   
ref|XP_010934126.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    174   1e-49   
ref|XP_006395360.1|  hypothetical protein EUTSA_v10004627mg             176   1e-49   
gb|ACG35468.1|  prolyl 4-hydroxylase                                    175   1e-49   
ref|XP_002324024.1|  hypothetical protein POPTR_0017s11150g             176   1e-49   
gb|AAV64222.1|  unknown                                                 177   1e-49   
ref|XP_010024472.1|  PREDICTED: probable prolyl 4-hydroxylase 4         175   1e-49   
gb|KJB15318.1|  hypothetical protein B456_002G170800                    176   2e-49   
ref|XP_009151868.1|  PREDICTED: probable prolyl 4-hydroxylase 7         176   2e-49   
gb|AFW68768.1|  hypothetical protein ZEAMMB73_452923                    172   2e-49   
ref|XP_001697425.1|  predicted protein                                  175   2e-49   
ref|XP_011098556.1|  PREDICTED: probable prolyl 4-hydroxylase 7         175   2e-49   
ref|XP_002975178.1|  hypothetical protein SELMODRAFT_174666             174   2e-49   
gb|EEC66934.1|  hypothetical protein OsI_33548                          175   2e-49   
ref|NP_001064592.1|  Os10g0413500                                       175   2e-49   
ref|XP_009772473.1|  PREDICTED: probable prolyl 4-hydroxylase 4         175   3e-49   
ref|XP_003554232.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    175   3e-49   
ref|XP_010670355.1|  PREDICTED: probable prolyl 4-hydroxylase 6         175   3e-49   
ref|NP_001051610.1|  Os03g0803500                                       174   3e-49   
gb|AAV64184.1|  unknown                                                 177   3e-49   
ref|XP_006661770.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    172   4e-49   
ref|XP_006842809.1|  hypothetical protein AMTR_s00081p00029310          175   4e-49   
ref|XP_002505227.1|  predicted protein                                  173   4e-49   
ref|XP_010934120.1|  PREDICTED: probable prolyl 4-hydroxylase 7 i...    174   5e-49   
ref|NP_001132477.1|  uncharacterized protein LOC100193935 precursor     174   5e-49   
gb|KHG03768.1|  Prolyl 4-hydroxylase subunit alpha-1                    174   5e-49   
gb|KJB38490.1|  hypothetical protein B456_006G256500                    174   5e-49   
ref|XP_007035415.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    173   6e-49   
ref|XP_002439985.1|  hypothetical protein SORBIDRAFT_09g023860          174   7e-49   
ref|NP_566838.1|  oxoglutarate/iron-dependent oxygenase                 174   7e-49   
gb|ACU19077.1|  unknown                                                 174   7e-49   
gb|AAL57673.1|  AT3g28480/MFJ20_16                                      174   7e-49   
ref|XP_011090892.1|  PREDICTED: probable prolyl 4-hydroxylase 4         173   7e-49   
ref|XP_010272176.1|  PREDICTED: probable prolyl 4-hydroxylase 7         174   8e-49   
gb|ABB47602.2|  prolyl 4-hydroxylase, putative, expressed               173   9e-49   
dbj|BAB02864.1|  prolyl 4-hydroxylase alpha subunit-like protein        174   1e-48   
ref|XP_002877112.1|  predicted protein                                  172   1e-48   
ref|NP_001149322.1|  LOC100282945 precursor                             173   1e-48   
gb|ACN36301.1|  unknown                                                 172   1e-48   
ref|NP_001189994.1|  oxoglutarate/iron-dependent oxygenase              173   1e-48   
emb|CDY00131.1|  BnaC09g01700D                                          173   2e-48   
ref|XP_002516833.1|  prolyl 4-hydroxylase alpha subunit, putative       172   2e-48   
ref|XP_002463711.1|  hypothetical protein SORBIDRAFT_01g004670          172   2e-48   
ref|XP_010912106.1|  PREDICTED: probable prolyl 4-hydroxylase 4         172   2e-48   
ref|XP_008360309.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    172   2e-48   
ref|XP_009111597.1|  PREDICTED: probable prolyl 4-hydroxylase 7         173   2e-48   
ref|NP_001241863.1|  prolyl 4-hydroxylase 4 precursor                   171   2e-48   
ref|XP_010934134.1|  PREDICTED: probable prolyl 4-hydroxylase 7         171   3e-48   
ref|XP_005644366.1|  hypothetical protein COCSUDRAFT_25518              173   3e-48   
ref|XP_009352176.1|  PREDICTED: probable prolyl 4-hydroxylase 4         172   3e-48   
ref|XP_010425629.1|  PREDICTED: probable prolyl 4-hydroxylase 6         172   3e-48   
ref|NP_001241866.1|  prolyl 4-hydroxylase 6 precursor                   171   3e-48   
ref|XP_002324025.2|  hypothetical protein POPTR_0017s11170g             168   4e-48   
ref|XP_003631980.1|  PREDICTED: probable prolyl 4-hydroxylase 4         171   4e-48   
ref|XP_010242572.1|  PREDICTED: probable prolyl 4-hydroxylase 4         171   4e-48   
ref|XP_010412436.1|  PREDICTED: probable prolyl 4-hydroxylase 6         171   5e-48   
ref|XP_009403381.1|  PREDICTED: probable prolyl 4-hydroxylase 7         169   5e-48   
pdb|2V4A|A  Chain A, Crystal Structure Of The Semet-Labeled Proly...    169   5e-48   
ref|NP_001141909.1|  hypothetical protein                               169   6e-48   
ref|XP_004233694.1|  PREDICTED: probable prolyl 4-hydroxylase 6         172   6e-48   
ref|XP_009759224.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    169   6e-48   
gb|KFK26128.1|  hypothetical protein AALP_AA8G207300                    171   7e-48   
gb|EPS60054.1|  hypothetical protein M569_14750                         168   7e-48   
ref|XP_004134175.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    171   8e-48   
ref|XP_009369073.1|  PREDICTED: probable prolyl 4-hydroxylase 4         171   8e-48   
ref|XP_008681529.1|  PREDICTED: hypothetical protein isoform X4         171   8e-48   
gb|KJB43229.1|  hypothetical protein B456_007G190600                    168   8e-48   
ref|XP_010279264.1|  PREDICTED: probable prolyl 4-hydroxylase 4         171   9e-48   
ref|NP_001055890.1|  Os05g0489100                                       171   9e-48   
gb|EAY98503.1|  hypothetical protein OsI_20415                          171   9e-48   
gb|EMS54172.1|  Type I inositol-1,4,5-trisphosphate 5-phosphatase...    178   9e-48   
ref|XP_008340954.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    171   9e-48   
ref|XP_008351224.1|  PREDICTED: uncharacterized protein LOC103414638    171   1e-47   
emb|CDX85201.1|  BnaC07g25120D                                          177   1e-47   
gb|KDP40054.1|  hypothetical protein JCGZ_02052                         170   2e-47   
gb|KGN57053.1|  hypothetical protein Csa_3G150820                       171   2e-47   
ref|XP_007223204.1|  hypothetical protein PRUPE_ppa009336mg             169   2e-47   
ref|XP_008438765.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    170   2e-47   
ref|XP_008681527.1|  PREDICTED: hypothetical protein isoform X2         171   2e-47   
gb|AAO42145.1|  putative prolyl 4-hydroxylase                           168   3e-47   
ref|XP_011008367.1|  PREDICTED: probable prolyl 4-hydroxylase 7         169   3e-47   
gb|KJB59735.1|  hypothetical protein B456_009G269000                    169   3e-47   
gb|KDO74949.1|  hypothetical protein CISIN_1g022406mg                   169   4e-47   
ref|XP_010091922.1|  Prolyl 4-hydroxylase subunit alpha-1               170   4e-47   
ref|XP_011006089.1|  PREDICTED: probable prolyl 4-hydroxylase 4         169   4e-47   
ref|XP_003618430.1|  Prolyl 4-hydroxylase subunit alpha-2               169   4e-47   
ref|XP_008681528.1|  PREDICTED: hypothetical protein isoform X3         169   4e-47   
ref|XP_006489270.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    166   4e-47   
ref|XP_006654567.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    169   5e-47   
ref|XP_008808711.1|  PREDICTED: probable prolyl 4-hydroxylase 6 i...    169   5e-47   
ref|XP_002312720.1|  oxidoreductase family protein                      168   6e-47   
gb|ABI79328.1|  prolyl 4-hydroxylase                                    168   6e-47   
ref|XP_006419737.1|  hypothetical protein CICLE_v10005535mg             168   6e-47   
ref|NP_189490.2|  Oxoglutarate/iron-dependent oxygenase                 168   6e-47   
ref|XP_009390814.1|  PREDICTED: prolyl 4-hydroxylase 1-like isofo...    166   6e-47   
gb|EEC81680.1|  hypothetical protein OsI_25242                          172   7e-47   
ref|XP_006658366.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    169   7e-47   
ref|XP_007151176.1|  hypothetical protein PHAVU_004G024300g             169   7e-47   
dbj|BAC83179.1|  prolyl 4-hydroxylase alpha-1 subunit precursor-l...    168   8e-47   
ref|NP_001059113.1|  Os07g0194500                                       169   8e-47   
gb|EEC76363.1|  hypothetical protein OsI_13952                          177   8e-47   
ref|XP_002461632.1|  hypothetical protein SORBIDRAFT_02g005750          168   1e-46   
ref|XP_008681526.1|  PREDICTED: hypothetical protein isoform X1         169   1e-46   
ref|XP_011401793.1|  Prolyl 4-hydroxylase subunit alpha-2               167   1e-46   
ref|XP_008795106.1|  PREDICTED: probable prolyl 4-hydroxylase 4         167   1e-46   
ref|XP_009390813.1|  PREDICTED: prolyl 4-hydroxylase 1-like isofo...    166   2e-46   
ref|XP_009126289.1|  PREDICTED: probable prolyl 4-hydroxylase 4         167   2e-46   
ref|XP_004489361.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    167   2e-46   
gb|KHG08217.1|  Prolyl 4-hydroxylase subunit alpha-1                    167   2e-46   
gb|KHN03021.1|  Prolyl 4-hydroxylase subunit alpha-1                    167   2e-46   
ref|XP_004296772.2|  PREDICTED: probable prolyl 4-hydroxylase 4         167   2e-46   
gb|EEE66737.1|  hypothetical protein OsJ_23428                          171   3e-46   
emb|CDY47187.1|  BnaAnng08570D                                          166   3e-46   
ref|XP_008223071.1|  PREDICTED: prolyl 4-hydroxylase subunit alpha-1    166   3e-46   
ref|XP_006845819.1|  hypothetical protein AMTR_s00019p00257460          166   3e-46   
ref|XP_010492924.1|  PREDICTED: probable prolyl 4-hydroxylase 4         166   5e-46   
ref|XP_009412183.1|  PREDICTED: probable prolyl 4-hydroxylase 4 i...    166   5e-46   
ref|XP_007154205.1|  hypothetical protein PHAVU_003G098900g             166   5e-46   
ref|XP_006338495.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    166   5e-46   
ref|XP_010420665.1|  PREDICTED: probable prolyl 4-hydroxylase 4         166   5e-46   
dbj|BAB02865.1|  unnamed protein product                                167   5e-46   
emb|CDY02598.1|  BnaC02g08370D                                          166   6e-46   
ref|XP_004961690.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    166   6e-46   
ref|XP_008458700.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    166   6e-46   
ref|XP_009120936.1|  PREDICTED: probable prolyl 4-hydroxylase 4         166   6e-46   
emb|CDX92575.1|  BnaA10g16140D                                          164   7e-46   
ref|XP_004144967.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    166   7e-46   
ref|XP_008458517.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    166   7e-46   
gb|KJB72513.1|  hypothetical protein B456_011G182800                    166   8e-46   
ref|XP_010454140.1|  PREDICTED: probable prolyl 4-hydroxylase 4         165   9e-46   
ref|XP_010105675.1|  Prolyl 4-hydroxylase subunit alpha-1               165   1e-45   
emb|CDY38223.1|  BnaA09g11660D                                          165   1e-45   
emb|CDY13928.1|  BnaC09g38980D                                          165   1e-45   
ref|XP_004159836.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    165   1e-45   
ref|XP_004486084.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    165   1e-45   
ref|XP_002873917.1|  oxidoreductase                                     165   1e-45   
ref|NP_001241485.1|  uncharacterized protein LOC100783075 precursor     165   1e-45   
gb|KJB33682.1|  hypothetical protein B456_006G026200                    165   1e-45   
ref|XP_008647882.1|  PREDICTED: LOC100282945 isoform X1                 174   1e-45   
ref|NP_001242363.1|  uncharacterized protein LOC100796794 precursor     164   2e-45   
ref|XP_006288327.1|  hypothetical protein CARUB_v10001574mg             164   2e-45   
ref|XP_004168311.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    165   2e-45   
gb|AAM13038.1|  unknown protein                                         164   2e-45   
ref|XP_003594053.1|  Prolyl 4-hydroxylase alpha subunit-like protein    164   2e-45   
ref|XP_001775487.1|  predicted protein                                  163   2e-45   
ref|XP_006400443.1|  hypothetical protein EUTSA_v10014223mg             164   2e-45   
ref|XP_008443446.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    165   2e-45   
ref|XP_003566109.1|  PREDICTED: prolyl 4-hydroxylase 2-like             164   3e-45   
ref|XP_004955738.1|  PREDICTED: prolyl 4-hydroxylase subunit alph...    164   3e-45   
gb|ABK23496.1|  unknown                                                 161   3e-45   
ref|XP_010546909.1|  PREDICTED: probable prolyl 4-hydroxylase 4         164   3e-45   
ref|XP_003594052.1|  Prolyl 4-hydroxylase alpha subunit-like protein    164   4e-45   



>ref|XP_006340784.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=287

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR+IEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  138  RDKVIRDIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRIATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDV+EGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  198  LMYLSDVDEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMRV EYKA
Sbjct  258  DPSSLHGGCPVIKGNKWSSTKWMRVDEYKA  287



>ref|XP_006380560.1| hypothetical protein POPTR_0007s09270g, partial [Populus trichocarpa]
 gb|ERP58357.1| hypothetical protein POPTR_0007s09270g, partial [Populus trichocarpa]
Length=287

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADF+FIP+EHGEGLQILHYEVGQKYEPH+DYF+DDYNT+NGGQRIATV
Sbjct  138  RDKIIRDIEKRIADFSFIPSEHGEGLQILHYEVGQKYEPHFDYFMDDYNTENGGQRIATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWWNEL ECGKGGLSVKPKMGDALL WSMKPD SL
Sbjct  198  LMYLSDVEEGGETVFPSAKGNISSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDASL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWMRV EYKA
Sbjct  258  DPSSLHGGCPVIRGNKWSSTKWMRVNEYKA  287



>ref|XP_007046593.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007046596.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX90750.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX90753.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=283

 Score =   290 bits (743),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IRNIEKRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF+D++NTKNGGQRIATV
Sbjct  134  RDKTIRNIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFMDEFNTKNGGQRIATV  193

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL ECGKGGLSVKPKMGDALL WSMKPD SL
Sbjct  194  LMYLSDVEEGGETVFPAAKGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDASL  253

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKW+RV EYK 
Sbjct  254  DPSSLHGGCPVIRGNKWSSTKWIRVNEYKV  283



>gb|KHG30312.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=289

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIE+RIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF+D++NTKNGGQRIATV
Sbjct  140  RDKIIRNIEQRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFMDEFNTKNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPSAKGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWMRV EYK 
Sbjct  260  DPSSLHGGCPVIRGNKWSSTKWMRVNEYKV  289



>ref|XP_009622125.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana tomentosiformis]
Length=291

 Score =   290 bits (742),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IRNIEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  142  RDKVIRNIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPK GDALL WSMKPD +L
Sbjct  202  LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKRGDALLFWSMKPDATL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYKA
Sbjct  262  DPSSLHGGCPVIKGNKWSSTKWIRVHEYKA  291



>gb|KJB43227.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
 gb|KJB43230.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
 gb|KJB43231.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=289

 Score =   289 bits (739),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIE+RIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF+D++NTKNGGQRIATV
Sbjct  140  RDKIIRNIEQRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFMDEFNTKNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPSAKGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKW+RV EYK 
Sbjct  260  DPSSLHGGCPVIRGNKWSSTKWIRVNEYKV  289



>ref|XP_011014780.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Populus euphratica]
Length=291

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADF+FIPAEHGEGLQILHYEVGQKYEPH+DY +DDYNT+NGGQRIATV
Sbjct  142  RDKIIRDIEKRIADFSFIPAEHGEGLQILHYEVGQKYEPHFDYLMDDYNTENGGQRIATV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWWNEL ECGKGGLSVKPKMGDALL WSMKPD SL
Sbjct  202  LMYLSDVEEGGETVFPSAKGNISSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDASL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWMRV EYK 
Sbjct  262  DPSSLHGGCPVIRGNKWSSTKWMRVNEYKV  291



>ref|XP_004232524.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Solanum lycopersicum]
Length=287

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR+IEKRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  138  RDKVIRDIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRIATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDV+EGGETVFP AKGN  AVPWWNEL  CGKGGLSVKPKMGDALL WSMKPD  L
Sbjct  198  LMYLSDVDEGGETVFPAAKGNYSAVPWWNELSVCGKGGLSVKPKMGDALLFWSMKPDAVL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMRV EYKA
Sbjct  258  DPSSLHGGCPVIKGNKWSSTKWMRVHEYKA  287



>gb|EYU30384.1| hypothetical protein MIMGU_mgv1a011046mg [Erythranthe guttata]
Length=294

 Score =   286 bits (733),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI++ IEKRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF+D++NT+NGGQRIATV
Sbjct  145  RDKIVQRIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFMDEFNTQNGGQRIATV  204

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL +CGK GLS+KPKMGDALL WSMKPD +L
Sbjct  205  LMYLSDVEEGGETVFPAAKGNISAVPWWNELSQCGKEGLSIKPKMGDALLFWSMKPDATL  264

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWMRV EYKA
Sbjct  265  DPSSLHGGCPVIRGNKWSSTKWMRVHEYKA  294



>ref|XP_009776785.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana sylvestris]
Length=290

 Score =   286 bits (732),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IRNIEK+IADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  141  RDKVIRNIEKKIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGK GLSVKPK GDALL WSMKPD +L
Sbjct  201  LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKDGLSVKPKRGDALLFWSMKPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYKA
Sbjct  261  DPSSLHGGCPVIKGNKWSSTKWIRVHEYKA  290



>ref|XP_006383041.1| hypothetical protein POPTR_0005s10980g [Populus trichocarpa]
 gb|ERP60838.1| hypothetical protein POPTR_0005s10980g [Populus trichocarpa]
Length=291

 Score =   284 bits (727),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+R+IEKRIADF+FIP EHGEGLQILHYEVGQ+YEPH+DYF+D+YNTKNGGQRIATV
Sbjct  142  RDKIVRDIEKRIADFSFIPVEHGEGLQILHYEVGQRYEPHFDYFMDEYNTKNGGQRIATV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGKGGLSVKPKMGDALL WSM PDGS 
Sbjct  202  LMYLSDVEEGGETVFPSAEGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMNPDGSP  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWMRV EYK 
Sbjct  262  DPSSLHGGCPVIRGNKWSSTKWMRVNEYKV  291



>ref|XP_011022255.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Populus euphratica]
Length=290

 Score =   284 bits (727),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADF+FIP EHGEGLQILHYEVGQ+YEPH+DYF+D+YNTKNGGQRIATV
Sbjct  141  RDKIIRDIEKRIADFSFIPVEHGEGLQILHYEVGQRYEPHFDYFMDEYNTKNGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGKGGLSVKPKMGDALL WSM PDGS 
Sbjct  201  LMYLSDVEEGGETVFPSAEGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMNPDGSP  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWMRV EYK 
Sbjct  261  DPSSLHGGCPVIRGNKWSSTKWMRVNEYKV  290



>ref|XP_010485337.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
Length=176

 Score =   280 bits (716),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  27   RDKIIRQIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  86

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  87   LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL  146

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGC VIKGNKWS TKW+RV EYK 
Sbjct  147  DPSSLHGGCAVIKGNKWSSTKWLRVHEYKV  176



>gb|KHN35999.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=289

 Score =   284 bits (727),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+RNIEK+I+DFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV
Sbjct  140  RDKIVRNIEKKISDFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYL+DVEEGGETVFP AKGN  +VPWWNEL ECGK GLS+KPK GDALL WSMKPD SL
Sbjct  200  LMYLTDVEEGGETVFPAAKGNFSSVPWWNELSECGKKGLSIKPKRGDALLFWSMKPDASL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMRV EY A
Sbjct  260  DPSSLHGGCPVIKGNKWSSTKWMRVSEYNA  289



>emb|CDP01844.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   284 bits (726),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR IEKRIADF FIP EHGEGLQILHYEVGQKYEPHYDYFLD++NT+NGGQRIATV
Sbjct  142  RDKTIREIEKRIADFAFIPVEHGEGLQILHYEVGQKYEPHYDYFLDEFNTRNGGQRIATV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSD+EEGGETVFP AKGNI AVPWWNEL ECGKGGLSVKPK GDALL WSMKPD +L
Sbjct  202  LMYLSDIEEGGETVFPAAKGNISAVPWWNELSECGKGGLSVKPKRGDALLFWSMKPDATL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWMRV EYK 
Sbjct  262  DPSSLHGGCPVIRGNKWSSTKWMRVHEYKV  291



>emb|CDX81416.1| BnaC09g08270D [Brassica napus]
Length=287

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  138  RDKIIRQIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  198  LMYLSDVEEGGETVFPSAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGC VIKGNKWS TKW+RV EYK
Sbjct  258  DPSSLHGGCAVIKGNKWSSTKWLRVHEYK  286



>ref|NP_001242522.1| uncharacterized protein LOC100806046 [Glycine max]
 gb|ACU24023.1| unknown [Glycine max]
Length=289

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+RNIEK+I+DFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV
Sbjct  140  RDKIVRNIEKKISDFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYL+DVEEGGETVFP AKGN   VPWWNEL ECGK GLS+KPK GDALL WSMKPD SL
Sbjct  200  LMYLTDVEEGGETVFPAAKGNFSFVPWWNELFECGKKGLSIKPKRGDALLFWSMKPDASL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMRV EY A
Sbjct  260  DPSSLHGGCPVIKGNKWSSTKWMRVSEYNA  289



>ref|XP_009112275.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Brassica rapa]
 ref|XP_009112276.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Brassica rapa]
 emb|CDY18586.1| BnaA09g08090D [Brassica napus]
Length=287

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  138  RDKIIRQIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  198  LMYLSDVEEGGETVFPSAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGC VIKGNKWS TKW+RV EYK
Sbjct  258  DPSSLHGGCAVIKGNKWSSTKWLRVHEYK  286



>ref|XP_010465981.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X1 [Camelina 
sativa]
 ref|XP_010465989.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X1 [Camelina 
sativa]
 ref|XP_010465996.1| PREDICTED: probable prolyl 4-hydroxylase 10 isoform X2 [Camelina 
sativa]
Length=290

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  141  RDKIIRQIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  201  LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGC VIKGNKWS TKW+RV EYK 
Sbjct  261  DPSSLHGGCAVIKGNKWSSTKWLRVHEYKV  290



>ref|XP_010444842.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
 ref|XP_010444843.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
Length=290

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  141  RDKIIRQIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  201  LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGC VIKGNKWS TKW+RV EYK 
Sbjct  261  DPSSLHGGCAVIKGNKWSSTKWLRVHEYKV  290



>ref|XP_008440878.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
Length=287

 Score =   282 bits (721),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR IEKRI+DF+FIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQRIATV
Sbjct  138  RDKTIRTIEKRISDFSFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRIATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGK GLSVKPK GDALL WSMKPD SL
Sbjct  198  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKRGDALLFWSMKPDASL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMRV EYKA
Sbjct  258  DPSSLHGGCPVIKGNKWSATKWMRVEEYKA  287



>ref|XP_011079010.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Sesamum indicum]
Length=295

 Score =   282 bits (721),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI++ IEKRIADFTF+P EHGEGLQILHYE GQKYEPHYDYFLD++NT+NGGQRIATV
Sbjct  146  RDKIVQRIEKRIADFTFLPVEHGEGLQILHYEAGQKYEPHYDYFLDEFNTQNGGQRIATV  205

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  206  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  265

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+R+ EYKA
Sbjct  266  DPSSLHGGCPVIKGNKWSSTKWIRIHEYKA  295



>ref|XP_009587704.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana tomentosiformis]
Length=290

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DK++R IEKRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYF D++NT NGGQRIATV
Sbjct  141  QDKVVRTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFADEFNTINGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  201  LMYLSDVEEGGETVFPTAKGNFSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMRV EYK 
Sbjct  261  DPSSLHGGCPVIKGNKWSSTKWMRVHEYKV  290



>ref|XP_007202401.1| hypothetical protein PRUPE_ppa009475mg [Prunus persica]
 gb|EMJ03600.1| hypothetical protein PRUPE_ppa009475mg [Prunus persica]
Length=291

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEKRIA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF D++NT+NGGQRIATV
Sbjct  142  RDKIIRNIEKRIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDEFNTRNGGQRIATV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWW+EL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  202  LMYLSDVEEGGETVFPAAKGNISSVPWWDELSECGKKGLSVKPKMGDALLFWSMRPDASL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKW+RV EYK
Sbjct  262  DPSSLHGGCPVIKGNKWSSTKWVRVNEYK  290



>ref|NP_201407.4| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 sp|F4JZ24.1|P4H10_ARATH RecName: Full=Probable prolyl 4-hydroxylase 10; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED98153.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=289

 Score =   281 bits (719),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  140  RDKTIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  200  LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGC VIKGNKWS TKW+RV EYK 
Sbjct  260  DPSSLHGGCAVIKGNKWSSTKWLRVHEYKV  289



>ref|XP_007046594.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 ref|XP_007046595.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOX90751.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX90752.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
Length=296

 Score =   281 bits (719),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 139/163 (85%), Gaps = 13/163 (8%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IRNIEKRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF+D++NTKNGGQRIATV
Sbjct  134  RDKTIRNIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFMDEFNTKNGGQRIATV  193

Query  515  XMYLS-------------DVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGD  375
             MYLS             DVEEGGETVFP AKGNI AVPWWNEL ECGKGGLSVKPKMGD
Sbjct  194  LMYLSVLFFFCVLPFYSSDVEEGGETVFPAAKGNISAVPWWNELSECGKGGLSVKPKMGD  253

Query  374  ALLXWSMKPDGSLDPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            ALL WSMKPD SLDPSSLHGGCPVI+GNKWS TKW+RV EYK 
Sbjct  254  ALLFWSMKPDASLDPSSLHGGCPVIRGNKWSSTKWIRVNEYKV  296



>ref|XP_010113287.1| Prolyl 4-hydroxylase subunit alpha-1 [Morus notabilis]
 gb|EXC35294.1| Prolyl 4-hydroxylase subunit alpha-1 [Morus notabilis]
Length=291

 Score =   281 bits (719),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLDD+NT+NGGQR+AT+
Sbjct  142  RDKVIRTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDDFNTQNGGQRMATL  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGK GLSVKPK GDALL WSMKPD +L
Sbjct  202  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKRGDALLFWSMKPDATL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMR  EYKA
Sbjct  262  DPSSLHGGCPVIKGNKWSSTKWMRANEYKA  291



>gb|KDO71355.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=180

 Score =   277 bits (708),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  31   RDKIIRDIEKRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  90

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD SL
Sbjct  91   LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASL  150

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  151  DPSSLHGGCPVIKGNKWSSTKWIRVNEYKV  180



>ref|XP_004134841.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
 gb|KGN48959.1| hypothetical protein Csa_6G507320 [Cucumis sativus]
Length=287

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK +R IEKR++DF+FIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQRIATV
Sbjct  138  RDKTVRTIEKRLSDFSFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRIATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGK GLSVKPK GDALL WSMKPD SL
Sbjct  198  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKRGDALLFWSMKPDASL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMRV EYKA
Sbjct  258  DPSSLHGGCPVIKGNKWSATKWMRVEEYKA  287



>ref|XP_006280909.1| hypothetical protein CARUB_v10026902mg [Capsella rubella]
 gb|EOA13807.1| hypothetical protein CARUB_v10026902mg [Capsella rubella]
Length=289

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  140  RDKTIRQIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  200  LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGC VIKGNKWS TKW+RV EY+ 
Sbjct  260  DPSSLHGGCAVIKGNKWSSTKWLRVHEYRV  289



>ref|XP_009344824.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=292

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEK+IA+FTF+P E GEGLQ+LHYEVGQKYEPH+DYF DD+NTKNGGQRIATV
Sbjct  143  RDKIIRNIEKKIANFTFLPVEQGEGLQVLHYEVGQKYEPHFDYFQDDFNTKNGGQRIATV  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWWNEL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  203  LMYLSDVEEGGETVFPAAKGNISSVPWWNELSECGKKGLSVKPKMGDALLFWSMRPDASL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLHGGCPVIKGNKWS TKW+RV EY
Sbjct  263  DPSSLHGGCPVIKGNKWSSTKWIRVSEY  290



>ref|XP_009801759.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nicotiana sylvestris]
Length=290

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DK++R IEKRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF D++NT NGGQRIATV
Sbjct  141  QDKVVRTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFADEFNTINGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  201  LMYLSDVEEGGETVFPAAKGNFSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLH GCPVIKGNKWS TKWMRV EYK 
Sbjct  261  DPSSLHSGCPVIKGNKWSSTKWMRVHEYKV  290



>gb|EPS71884.1| hypothetical protein M569_02873 [Genlisea aurea]
Length=292

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI++ IEKRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYF+D++NT+NGGQRIAT+
Sbjct  143  RDKIVQTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFMDEFNTQNGGQRIATL  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A GN  ++PWWNEL ECG+GGLSVKPKMGDALL WSM+PD +L
Sbjct  203  LMYLSDVEEGGETVFPAAAGNFSSLPWWNELSECGRGGLSVKPKMGDALLFWSMRPDATL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMRV EYKA
Sbjct  263  DPSSLHGGCPVIKGNKWSSTKWMRVHEYKA  292



>ref|XP_002263060.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Vitis vinifera]
 emb|CBI24447.3| unnamed protein product [Vitis vinifera]
Length=288

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKR++DFTF+P EHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQR+ATV
Sbjct  139  QDKIIRGIEKRLSDFTFLPVEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRMATV  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGK GLSVKPKMGDALL WSMKPD SL
Sbjct  199  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSDCGKEGLSVKPKMGDALLFWSMKPDASL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKW+RV EYK
Sbjct  259  DPSSLHGGCPVIKGNKWSSTKWIRVNEYK  287



>ref|XP_006425363.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 ref|XP_006425364.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38603.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38604.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=288

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  139  RDKIIRDIEKRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD SL
Sbjct  199  LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  259  DPSSLHGGCPVIKGNKWSSTKWIRVNEYKV  288



>ref|XP_006342080.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=292

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEKRIAD+TFIPAEHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIAT+
Sbjct  143  RDKIIRNIEKRIADYTFIPAEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATI  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  + P WNEL EC KGGLSVKPKMGDALL WSM+PD +L
Sbjct  203  LMYLSDVEEGGETVFPAAKGNFSSSPGWNELSECAKGGLSVKPKMGDALLFWSMRPDATL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM V EYK+
Sbjct  263  DPSSLHGGCPVIKGNKWSSTKWMHVGEYKS  292



>ref|XP_006343343.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Solanum 
tuberosum]
Length=289

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DK++R IEKRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF D++NT+NGGQRIATV
Sbjct  140  QDKVVRTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFSDEFNTQNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GN  AVPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPAAQGNFSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLHGGC VIKGNKWS TKWMRV EY
Sbjct  260  DPSSLHGGCAVIKGNKWSSTKWMRVHEY  287



>ref|XP_004234520.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Solanum lycopersicum]
Length=289

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DK++R IEKRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYF D++NT+NGGQRIATV
Sbjct  140  QDKVVRTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFSDEFNTQNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GN  AVPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPAAQGNFSAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLHGGC VIKGNKWS TKWMRV EY
Sbjct  260  DPSSLHGGCAVIKGNKWSSTKWMRVHEY  287



>ref|XP_008242010.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Prunus 
mume]
Length=291

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEKRIA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF D++NT+NGGQRIATV
Sbjct  142  RDKIIRNIEKRIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDEFNTRNGGQRIATV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI +VPWW+EL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  202  LMYLSDVEEGGETVFPAAEGNISSVPWWDELSECGKKGLSVKPKMGDALLFWSMRPDASL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKW+RV EYK
Sbjct  262  DPSSLHGGCPVIKGNKWSSTKWVRVNEYK  290



>ref|XP_003538892.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Glycine max]
 gb|KHN41867.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=290

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+R+IEKRIA ++FIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV
Sbjct  141  RDKIVRDIEKRIAHYSFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYL+DVEEGGETVFP AKGN  +VPWWNEL ECGK GLS+KPK GDALL WSMKPD +L
Sbjct  201  LMYLTDVEEGGETVFPAAKGNFSSVPWWNELSECGKKGLSIKPKRGDALLFWSMKPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMRV EYKA
Sbjct  261  DPSSLHGGCPVIKGNKWSSTKWMRVSEYKA  290



>ref|XP_008337965.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Malus domestica]
Length=291

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEK+IA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF DD+NTKNGGQRI TV
Sbjct  142  RDKIIRNIEKKIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDDFNTKNGGQRIGTV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWWNEL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  202  LMYLSDVEEGGETVFPAAKGNISSVPWWNELSECGKKGLSVKPKMGDALLFWSMRPDASL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLHGGCPVIKGNKWS TKW+RV EY
Sbjct  262  DPSSLHGGCPVIKGNKWSSTKWIRVNEY  289



>gb|KDO71350.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=287

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  138  RDKIIRDIEKRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD SL
Sbjct  198  LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  258  DPSSLHGGCPVIKGNKWSSTKWIRVNEYKV  287



>gb|KDO71351.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71352.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
 gb|KDO71353.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=288

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  139  RDKIIRDIEKRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD SL
Sbjct  199  LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  259  DPSSLHGGCPVIKGNKWSSTKWIRVNEYKV  288



>emb|CAN64470.1| hypothetical protein VITISV_014644 [Vitis vinifera]
Length=288

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKR++DFTF+P EHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQR+ATV
Sbjct  139  QDKIIRGIEKRLSDFTFLPVEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRMATV  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL  CGK GLSVKPKMGDALL WSMKPD SL
Sbjct  199  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSXCGKEGLSVKPKMGDALLFWSMKPDASL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKW+RV EYK
Sbjct  259  DPSSLHGGCPVIKGNKWSSTKWIRVNEYK  287



>ref|XP_004238387.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Solanum lycopersicum]
Length=292

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEKRIAD+TFIPAEHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIAT+
Sbjct  143  RDKIIRNIEKRIADYTFIPAEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATL  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  + P WNEL EC KGGLSVKPKMGDALL WSM+PD +L
Sbjct  203  LMYLSDVEEGGETVFPAAKGNFSSSPGWNELSECAKGGLSVKPKMGDALLFWSMRPDATL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM V EYK+
Sbjct  263  DPSSLHGGCPVIKGNKWSSTKWMHVGEYKS  292



>ref|XP_006467024.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Citrus sinensis]
Length=287

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  138  RDKIIRDIEKRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD +L
Sbjct  198  LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDAAL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  258  DPSSLHGGCPVIKGNKWSSTKWIRVNEYKV  287



>ref|XP_006467023.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Citrus sinensis]
Length=288

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  139  RDKIIRDIEKRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD +L
Sbjct  199  LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDAAL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  259  DPSSLHGGCPVIKGNKWSSTKWIRVNEYKV  288



>gb|KJB48235.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
 gb|KJB48237.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
 gb|KJB48238.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
 gb|KJB48239.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
Length=289

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII++IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+ NT+NGGQRIATV
Sbjct  140  RDKIIKSIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFKDEVNTRNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL ECGKGGLSV+PKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPSAKGNISAVPWWNELSECGKGGLSVRPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D SSLHGGCPVI+GNKWS TKWMRV EYK 
Sbjct  260  DLSSLHGGCPVIRGNKWSSTKWMRVNEYKV  289



>ref|XP_006425365.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38605.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=235

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  86   RDKIIRDIEKRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  145

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD SL
Sbjct  146  LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASL  205

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  206  DPSSLHGGCPVIKGNKWSSTKWIRVNEYKV  235



>ref|XP_006393794.1| hypothetical protein EUTSA_v10004714mg [Eutrema salsugineum]
 gb|ESQ31080.1| hypothetical protein EUTSA_v10004714mg [Eutrema salsugineum]
Length=289

 Score =   279 bits (713),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  140  RDKTIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWW+EL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  200  LMYLSDVEEGGETVFPAAKGNYSAVPWWSELSECGKGGLSVKPKMGDALLFWSMTPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGC VIKGNKWS TKW+RV EYK 
Sbjct  260  DPSSLHGGCAVIKGNKWSSTKWLRVHEYKV  289



>ref|XP_004158845.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=287

 Score =   279 bits (713),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK +R IEKR++DF+FIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQRIATV
Sbjct  138  RDKTVRTIEKRLSDFSFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRIATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGK GLSVKPK GDALL WSMKPD SL
Sbjct  198  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKRGDALLFWSMKPDASL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYKA
Sbjct  258  DPSSLHGGCPVIKGNKWSATKWVRVEEYKA  287



>ref|XP_010550487.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Tarenaya hassleriana]
Length=285

 Score =   278 bits (712),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIAD TFIP EHGEGLQ+LHYE GQKYEPHYDYF+D+YNT+NGGQR ATV
Sbjct  136  RDKIIRDIEKRIADLTFIPVEHGEGLQVLHYEAGQKYEPHYDYFMDEYNTRNGGQRTATV  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WS  PD +L
Sbjct  196  LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSTTPDATL  255

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+R+ EYKA
Sbjct  256  DPSSLHGGCPVIKGNKWSSTKWLRLHEYKA  285



>ref|XP_004291329.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   279 bits (714),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR+IEKRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLD+YNTKNGGQRIAT+
Sbjct  159  RDKVIRDIEKRIADFTFIPVEHGEGLQILHYEVGQKYDAHFDYFLDEYNTKNGGQRIATL  218

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL ECGK GL+VKPKMGDALL WSM+PD SL
Sbjct  219  LMYLSDVEEGGETVFPAAKGNISAVPWWNELSECGKKGLAVKPKMGDALLFWSMRPDASL  278

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWM + EYK 
Sbjct  279  DPSSLHGGCPVIRGNKWSSTKWMHLEEYKV  308



>gb|KDO71354.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=235

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  86   RDKIIRDIEKRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  145

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD SL
Sbjct  146  LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASL  205

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  206  DPSSLHGGCPVIKGNKWSSTKWIRVNEYKV  235



>ref|XP_009363441.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=291

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEK+IA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF DD+NTKNGGQRI TV
Sbjct  142  RDKIIRNIEKKIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDDFNTKNGGQRIGTV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWW EL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  202  LMYLSDVEEGGETVFPAAKGNISSVPWWYELSECGKKGLSVKPKMGDALLFWSMRPDASL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLHGGCPVIKGNKWS TKW+RV EY
Sbjct  262  DPSSLHGGCPVIKGNKWSSTKWIRVNEY  289



>ref|XP_007157869.1| hypothetical protein PHAVU_002G104900g [Phaseolus vulgaris]
 gb|ESW29863.1| hypothetical protein PHAVU_002G104900g [Phaseolus vulgaris]
Length=290

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+RNIEK+IADF+FIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV
Sbjct  141  RDKIVRNIEKKIADFSFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYL+DVEEGGETVFP AKGN  +VPWWNEL +CGK GLS+KP+ GDALL WSMKPD +L
Sbjct  201  LMYLTDVEEGGETVFPAAKGNFSSVPWWNELSDCGKKGLSIKPRRGDALLFWSMKPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D SSLHGGCPVIKGNKWS TKW+RV EYKA
Sbjct  261  DSSSLHGGCPVIKGNKWSSTKWLRVNEYKA  290



>ref|XP_010029633.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 gb|KCW56575.1| hypothetical protein EUGRSUZ_I02306 [Eucalyptus grandis]
Length=343

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+YNTKNGGQR+AT+
Sbjct  194  RDKIIRDIEKRIADFTFIPIEHGEGLQMLHYEVGQKYEPHYDYFQDEYNTKNGGQRMATI  253

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL +CGK GLSVKPKMGDALL WSMKPDGSL
Sbjct  254  LMYLSDVEEGGETVFPTAKGNFSAVPWWNELSDCGKEGLSVKPKMGDALLFWSMKPDGSL  313

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D SSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  314  DKSSLHGGCPVIKGNKWSSTKWLRVHEYKV  343



>ref|XP_009337076.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Pyrus x bretschneideri]
Length=291

 Score =   276 bits (707),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEK+IA+FTF+P EHGEGLQ+LHYEVGQKYEPHYDYF DD+NTKNGGQRI TV
Sbjct  142  RDKIIRNIEKKIANFTFLPVEHGEGLQVLHYEVGQKYEPHYDYFQDDFNTKNGGQRIGTV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWW EL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  202  LMYLSDVEEGGETVFPAAKGNISSVPWWYELSECGKKGLSVKPKMGDALLFWSMRPDASL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLHGGCPVIKGNKWS TKW+RV EY
Sbjct  262  DPSSLHGGCPVIKGNKWSSTKWIRVNEY  289



>gb|KDP23952.1| hypothetical protein JCGZ_25340 [Jatropha curcas]
Length=289

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF D++NT+NGGQRIAT+
Sbjct  140  RDKKIREIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFNDEFNTRNGGQRIATL  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GN+  VPWWNEL ECGKGGLSVKPK GDALL WSMKPD SL
Sbjct  200  LMYLSDVEEGGETVFPAAEGNVSDVPWWNELSECGKGGLSVKPKRGDALLFWSMKPDASL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGC VIKGNKWS TKWMRV EY+A
Sbjct  260  DPSSLHGGCAVIKGNKWSATKWMRVNEYQA  289



>ref|XP_002285898.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 ref|XP_010664132.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 ref|XP_010664133.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Vitis vinifera]
 emb|CBI18919.3| unnamed protein product [Vitis vinifera]
Length=288

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTFIP EHGEGLQ+LHYEVGQKY+ HYDYFLD++NTKNGGQRIAT+
Sbjct  139  RDKIIRDIEKRIADFTFIPVEHGEGLQVLHYEVGQKYDAHYDYFLDEFNTKNGGQRIATL  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP  K N  +VPWWNEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  199  LMYLSDVEEGGETVFPATKANFSSVPWWNELSECGKKGLSVKPKMGDALLFWSMRPDATL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM V EYKA
Sbjct  259  DPSSLHGGCPVIKGNKWSSTKWMHVEEYKA  288



>gb|KHG25173.1| P4ha[2]: Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=347

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII++IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+ NT+NGGQRIATV
Sbjct  140  RDKIIKSIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFKDEVNTRNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL ECGKGGLSV+PKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPSAKGNISAVPWWNELSECGKGGLSVRPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            D  SLHGGCPVI+GNKWS TKWMRV EYK
Sbjct  260  DLLSLHGGCPVIRGNKWSSTKWMRVNEYK  288



>ref|XP_008393737.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Malus domestica]
Length=292

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEK+IA+FTF+P E GEGLQ+LHYEVGQKYEPH+DYF DD+NTKNGGQRIATV
Sbjct  143  RDKIIRNIEKKIANFTFLPVEQGEGLQVLHYEVGQKYEPHFDYFQDDFNTKNGGQRIATV  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWW EL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  203  LMYLSDVEEGGETVFPAAKGNISSVPWWYELSECGKKGLSVKPKMGDALLFWSMRPDASL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLHGGCPVIKGNKWS TKW+RV EY
Sbjct  263  DPSSLHGGCPVIKGNKWSSTKWIRVSEY  290



>gb|KHN09058.1| Prolyl 4-hydroxylase subunit alpha-2 [Glycine soja]
Length=290

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI++NIEKRIADFTFIP E+GEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  141  RDKIVQNIEKRIADFTFIPEENGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPWWN+L +C + GLSVKPKMGDALL WSM+PD +L
Sbjct  201  LMYLSDVEEGGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM +REYK 
Sbjct  261  DPSSLHGGCPVIKGNKWSSTKWMHLREYKV  290



>ref|XP_002530636.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
 gb|EEF31744.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
Length=287

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR+IEKRIADF+FIP EHGEGLQ+LHYEVGQKYEPH+DYF D++NTKNGGQR+AT+
Sbjct  138  RDKKIRDIEKRIADFSFIPVEHGEGLQVLHYEVGQKYEPHFDYFNDEFNTKNGGQRVATL  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGK GLSVKP MGDALL WSMKPD +L
Sbjct  198  LMYLSDVEEGGETVFPAAKGNFSAVPWWNELSECGKKGLSVKPNMGDALLFWSMKPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI GNKWS TKWMRV EY+ 
Sbjct  258  DPSSLHGGCPVINGNKWSATKWMRVNEYRV  287



>ref|XP_004512179.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004512180.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Cicer arietinum]
Length=292

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+RNIEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLDD+NT+NGGQRIAT+
Sbjct  143  RDKIVRNIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTQNGGQRIATI  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYL+DVEEGGETVFP AKGN  +VPW+N+L +CGK GLS+KPK GDALL WSMKPD +L
Sbjct  203  LMYLTDVEEGGETVFPAAKGNFSSVPWYNDLSDCGKKGLSIKPKRGDALLFWSMKPDATL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D SSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  263  DASSLHGGCPVIKGNKWSSTKWIRVSEYKT  292



>ref|XP_010033532.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 ref|XP_010033534.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Eucalyptus grandis]
 gb|KCW53223.1| hypothetical protein EUGRSUZ_J02489 [Eucalyptus grandis]
 gb|KCW53224.1| hypothetical protein EUGRSUZ_J02489 [Eucalyptus grandis]
Length=294

 Score =   274 bits (700),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIAD+TFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD+YNT+NGGQR+AT+
Sbjct  145  RDKIIRDIEKRIADYTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEYNTRNGGQRMATL  204

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGK GLSVKPKMGDALL WSM+PD +L
Sbjct  205  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSDCGKKGLSVKPKMGDALLFWSMRPDATL  264

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D SSLHGGCPVIKGNKWS TKWMRV EYK 
Sbjct  265  DESSLHGGCPVIKGNKWSSTKWMRVHEYKV  294



>ref|XP_003612249.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES95207.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=289

 Score =   273 bits (699),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+RNIEK+IADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  140  RDKIVRNIEKKIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYL+DVEEGGETVFP AKGN   VPW+NEL +CGK GLS+KPK GDALL WSMKPD +L
Sbjct  200  LMYLTDVEEGGETVFPAAKGNFSNVPWYNELSDCGKKGLSIKPKRGDALLFWSMKPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D SSLHGGCPVIKGNKWS TKW+RV EYK 
Sbjct  260  DASSLHGGCPVIKGNKWSSTKWIRVNEYKT  289



>ref|XP_008377129.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Malus domestica]
Length=287

 Score =   273 bits (698),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+
Sbjct  138  RDKIIRDIEKRIADFTFIPVEHGEGLQILHYEVGQKYDAHFDYFLDEFNTKNGGQRVATL  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWWNEL ECGK GL+VKPKMGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETVFPAAKGNISSVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI GNKWS TKWM + EYK 
Sbjct  258  DPSSLHGGCPVIIGNKWSSTKWMHLEEYKV  287



>ref|XP_004287769.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Fragaria vesca subsp. 
vesca]
Length=292

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IRNIE++IA+FTF+P EHGEGLQILHYEVGQKYEPH+DYF D+YNT+NGGQR+AT+
Sbjct  143  RDKVIRNIERKIANFTFLPVEHGEGLQILHYEVGQKYEPHFDYFQDEYNTRNGGQRMATI  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWW+EL ECGK GLSVKPKMGDALL WSM PD +L
Sbjct  203  LMYLSDVEEGGETVFPNAKGNISSVPWWDELSECGKKGLSVKPKMGDALLFWSMNPDATL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKW+RV EYK 
Sbjct  263  DPSSLHGGCPVIRGNKWSSTKWIRVDEYKV  292



>ref|XP_006581148.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X1 [Glycine 
max]
 ref|XP_006581149.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X2 [Glycine 
max]
 ref|XP_006581150.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X3 [Glycine 
max]
 ref|XP_006581151.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 isoform X4 [Glycine 
max]
Length=290

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKI++NIEKRIADFTFIP E+GEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  141  KDKIVQNIEKRIADFTFIPEENGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPWWN+L +C + GLSVKPKMGDALL WSM+PD +L
Sbjct  201  LMYLSDVEEGGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM +REYK 
Sbjct  261  DPSSLHGGCPVIKGNKWSSTKWMHLREYKV  290



>ref|XP_010266900.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=289

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIRNIEKRIADFTFIP EHGEGLQILHYEVGQKYEPHYDYFLD++NTKNGGQR+AT+
Sbjct  140  QDKIIRNIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHYDYFLDEFNTKNGGQRMATL  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP    N  +VPW+NEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  200  LMYLSDVEEGGETIFPSTNTNFSSVPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM + EYK 
Sbjct  260  DPSSLHGGCPVIKGNKWSSTKWMHINEYKV  289



>ref|XP_007156206.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
 ref|XP_007156207.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
 gb|ESW28200.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
 gb|ESW28201.1| hypothetical protein PHAVU_003G267200g [Phaseolus vulgaris]
Length=289

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RD+++R+IEKRI+D TFIP EHGEGLQ+LHYEVGQKYE H+DYF+D+ NTKNGGQRIAT+
Sbjct  140  RDQVVRDIEKRISDLTFIPVEHGEGLQVLHYEVGQKYESHFDYFMDNINTKNGGQRIATM  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN+ +VPWWNEL ECGK GLS+KPKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPDAKGNVSSVPWWNELSECGKKGLSIKPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKWMR++EYKA
Sbjct  260  DPLSLHGGCPVIKGNKWSSTKWMRLKEYKA  289



>gb|KHG25174.1| phy-2: Prolyl 4-hydroxylase subunit alpha-2 [Gossypium arboreum]
Length=339

 Score =   273 bits (697),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII++IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+ NT+NGGQRIATV
Sbjct  140  RDKIIKSIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFKDEVNTRNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL ECGKGGLSV+PKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPSAKGNISAVPWWNELSECGKGGLSVRPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVRE  255
            D  SLHGGCPVI+GNKWS TKWMRV E
Sbjct  260  DLLSLHGGCPVIRGNKWSSTKWMRVNE  286



>ref|XP_010061109.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
 ref|XP_010061110.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Eucalyptus grandis]
 gb|KCW68007.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
 gb|KCW68008.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
 gb|KCW68009.1| hypothetical protein EUGRSUZ_F01696 [Eucalyptus grandis]
Length=321

 Score =   272 bits (695),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            DKIIR+IEKRIADFTFIP EHGEGLQ+LHYEVGQKY+ HYDYFLD++NTKNGGQRIAT+ 
Sbjct  173  DKIIRDIEKRIADFTFIPVEHGEGLQVLHYEVGQKYDAHYDYFLDEFNTKNGGQRIATLL  232

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGNI +VPWW++L ECGK GL+VKPKMGDALL WSM+P+G+LD
Sbjct  233  MYLSDVEEGGETVFPDAKGNISSVPWWDQLSECGKQGLAVKPKMGDALLFWSMRPEGTLD  292

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPVI GNKWS TKWM +REYK 
Sbjct  293  PSSLHGGCPVISGNKWSSTKWMHLREYKV  321



>ref|XP_010100124.1| Prolyl 4-hydroxylase subunit alpha-2 [Morus notabilis]
 gb|EXB81507.1| Prolyl 4-hydroxylase subunit alpha-2 [Morus notabilis]
Length=287

 Score =   270 bits (691),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLDD+NTKNGGQR+AT+
Sbjct  138  RDKIIRDIEKRIADFTFIPVEHGEGLQILHYEVGQKYDEHFDYFLDDFNTKNGGQRVATL  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  ++P+WNEL ECGK GL+VKPKMGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETVFPSAKGNFSSLPYWNELSECGKQGLAVKPKMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM + EYK 
Sbjct  258  DPSSLHGGCPVIKGNKWSSTKWMHLGEYKV  287



>ref|XP_009620049.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana tomentosiformis]
Length=291

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IRNIEKRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+
Sbjct  142  RDKVIRNIEKRIADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATL  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  + P WNEL EC K GLSVKPKMGDALL WSM+PD SL
Sbjct  202  LMYLSDVEEGGETVFPAAKGNFSSSPGWNELSECAKRGLSVKPKMGDALLFWSMRPDASL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKWM V EYK
Sbjct  262  DPSSLHGGCPVIKGNKWSSTKWMHVGEYK  290



>ref|XP_006577956.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Glycine max]
 gb|KHN45959.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=289

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+NIEKRIADFTFIP E+GEGLQILHYE GQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  140  RDKIIQNIEKRIADFTFIPVENGEGLQILHYEAGQKYEPHYDYFLDEFNTKNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPWWN+L +C + GLSVKPKMGDALL WSM+PD +L
Sbjct  200  LMYLSDVEEGGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW+ + EYK 
Sbjct  260  DPSSLHGGCPVIKGNKWSSTKWLHLHEYKV  289



>ref|XP_006577957.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Glycine max]
Length=289

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+NIEKRIADFTFIP E+GEGLQILHYE GQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  140  RDKIIQNIEKRIADFTFIPVENGEGLQILHYEAGQKYEPHYDYFLDEFNTKNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPWWN+L +C + GLSVKPKMGDALL WSM+PD +L
Sbjct  200  LMYLSDVEEGGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKW+ + EYK
Sbjct  260  DPSSLHGGCPVIKGNKWSSTKWLHLHEYK  288



>ref|XP_007017902.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15127.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
Length=287

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR+IEKRIAD+TFIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+
Sbjct  138  QDKIIRDIEKRIADYTFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATM  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGN  AVPWWNEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETIFPAAKGNFSAVPWWNELSECGKQGLSVKPKMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI GNKWS TKW+ V EYK 
Sbjct  258  DPSSLHGGCPVIMGNKWSSTKWIHVEEYKV  287



>gb|KDP36874.1| hypothetical protein JCGZ_08165 [Jatropha curcas]
Length=289

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEKRIADF+FIP EHGEGLQILHYEVGQKYE HYDYFLD++NTKNGGQR AT+
Sbjct  140  RDKIIRNIEKRIADFSFIPVEHGEGLQILHYEVGQKYEAHYDYFLDEFNTKNGGQRTATL  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+ NI +VPWWNEL ECGK GLSVKPKMG+ALL WS +PD +L
Sbjct  200  LMYLSDVEEGGETVFPAAQANISSVPWWNELSECGKRGLSVKPKMGNALLFWSTRPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHG CPVI+GNKWS TKWM + EYK 
Sbjct  260  DPSSLHGSCPVIRGNKWSATKWMHLGEYKV  289



>ref|XP_007136121.1| hypothetical protein PHAVU_009G019600g [Phaseolus vulgaris]
 gb|ESW08115.1| hypothetical protein PHAVU_009G019600g [Phaseolus vulgaris]
Length=289

 Score =   269 bits (688),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK++++IEKRIADFTFIP E+GEGLQILHYEVGQKYEPHYDYF+D++NTKNGGQRIATV
Sbjct  140  RDKVVQDIEKRIADFTFIPVENGEGLQILHYEVGQKYEPHYDYFIDEFNTKNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPWWN+L +C + GLSVKPKMGDALL WSM+PD +L
Sbjct  200  LMYLSDVEEGGETVFPAANANFSSVPWWNDLSQCARKGLSVKPKMGDALLFWSMRPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM + EYK 
Sbjct  260  DPSSLHGGCPVIKGNKWSSTKWMHLHEYKV  289



>ref|XP_010266054.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
 ref|XP_010266055.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=289

 Score =   269 bits (687),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D IIRNIEKRIAD+TFIP EHGEGLQILHYEVGQKYE HYDYFLD++NTKNGGQR+AT+
Sbjct  140  QDAIIRNIEKRIADYTFIPVEHGEGLQILHYEVGQKYESHYDYFLDEFNTKNGGQRMATL  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET FP AK N  +VPW+NEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  200  LMYLSDVEEGGETAFPNAKANFSSVPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM + EYK 
Sbjct  260  DPSSLHGGCPVIKGNKWSSTKWMHINEYKV  289



>ref|XP_008221210.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Prunus mume]
Length=299

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+ +IEKRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLD++NTKNGGQRIAT+
Sbjct  150  RDKIVSDIEKRIADFTFIPVEHGEGLQILHYEVGQKYDAHFDYFLDEFNTKNGGQRIATL  209

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKG+  +V WWNEL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  210  LMYLSDVEEGGETVFPAAKGSFKSVRWWNELSECGKQGLSVKPKMGDALLFWSMRPDASL  269

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWM + EYK 
Sbjct  270  DPSSLHGGCPVIRGNKWSSTKWMHIEEYKV  299



>ref|XP_008387904.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Malus domestica]
 ref|XP_008350486.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Malus domestica]
Length=291

 Score =   268 bits (686),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D++NTKNGGQR+AT+
Sbjct  142  RDKIIRDIEKRIADFTFIPVEHGEGLQVLHYEVGQKYDAHFDYFADEFNTKNGGQRVATL  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKG+I +VPWWNEL ECGK GL++KPKMGDALL WSM+PD +L
Sbjct  202  LMYLSDVEEGGETVFPTAKGSISSVPWWNELSECGKQGLALKPKMGDALLFWSMRPDATL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHG CPVI+GNKWS TKWM ++EYK 
Sbjct  262  DPSSLHGACPVIRGNKWSCTKWMHLQEYKV  291



>gb|KGN60775.1| hypothetical protein Csa_2G009620 [Cucumis sativus]
Length=259

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIRNIEKRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+
Sbjct  111  QDKIIRNIEKRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATL  170

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  171  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  230

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP+SLHG CPVI+GNKWS TKWM V +Y
Sbjct  231  DPTSLHGACPVIRGNKWSCTKWMHVDKY  258



>ref|XP_008387906.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Malus domestica]
 ref|XP_008350487.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Malus domestica]
Length=286

 Score =   268 bits (685),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D++NTKNGGQR+AT+
Sbjct  137  RDKIIRDIEKRIADFTFIPVEHGEGLQVLHYEVGQKYDAHFDYFADEFNTKNGGQRVATL  196

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKG+I +VPWWNEL ECGK GL++KPKMGDALL WSM+PD +L
Sbjct  197  LMYLSDVEEGGETVFPTAKGSISSVPWWNELSECGKQGLALKPKMGDALLFWSMRPDATL  256

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHG CPVI+GNKWS TKWM ++EYK 
Sbjct  257  DPSSLHGACPVIRGNKWSCTKWMHLQEYKV  286



>ref|XP_004171765.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=284

 Score =   268 bits (685),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIRNIEKRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+
Sbjct  136  QDKIIRNIEKRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATL  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  196  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  255

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP+SLHG CPVI+GNKWS TKWM V +Y
Sbjct  256  DPTSLHGACPVIRGNKWSCTKWMHVDKY  283



>ref|XP_009798871.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana sylvestris]
 ref|XP_009798872.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nicotiana sylvestris]
Length=291

 Score =   268 bits (685),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IRNIEKRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+
Sbjct  142  RDKVIRNIEKRIADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATL  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  + P WNEL EC K GLSVKPK GDALL WSM+PD SL
Sbjct  202  LMYLSDVEEGGETVFPAAKGNFSSSPGWNELSECAKRGLSVKPKRGDALLFWSMRPDASL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKWM V EYK
Sbjct  262  DPSSLHGGCPVIKGNKWSSTKWMHVGEYK  290



>ref|XP_010536435.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Tarenaya hassleriana]
Length=289

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR+IEKRIAD+TFIPAEHGEGLQ+LHYE GQKYEPHYDYFLD++NTKNGGQR+AT+
Sbjct  140  RDKVIRDIEKRIADYTFIPAEHGEGLQVLHYEEGQKYEPHYDYFLDEFNTKNGGQRMATM  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL  CGK GLSVKPKMGDALL WSM+PD SL
Sbjct  200  LMYLSDVEEGGETVFPSANMNYTSVPWYNELSLCGKKGLSVKPKMGDALLFWSMRPDASL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DP+SLHGGCPVIKGNKWS TKWM V EYK
Sbjct  260  DPTSLHGGCPVIKGNKWSSTKWMHVGEYK  288



>gb|KHG14293.1| Prolyl 4-hydroxylase subunit alpha-2 [Gossypium arboreum]
Length=287

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR+IE RIAD++FIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+
Sbjct  138  QDKIIRDIENRIADYSFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATM  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGNI AVPWWNEL ECGK GL+VKPKMGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETIFPAAKGNISAVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI GNKWS TKWM + EYK 
Sbjct  258  DPSSLHGGCPVITGNKWSSTKWMHLEEYKV  287



>gb|KJB59736.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=276

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII++IEKRIAD++FIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+
Sbjct  127  QDKIIKDIEKRIADYSFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATM  186

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGNI +VPWWNEL ECGK GL+VKPKMGDALL WSM+PD +L
Sbjct  187  LMYLSDVEEGGETIFPAAKGNISSVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATL  246

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI GNKWS TKWM + EYK 
Sbjct  247  DPSSLHGGCPVIMGNKWSSTKWMHLEEYKV  276



>gb|ACR34708.1| unknown [Zea mays]
Length=180

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  31   RDKVIRVIEKRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATL  90

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N+ ++PW+NEL EC K GLSVKPKMGDALL WSMKPD +L
Sbjct  91   LMYLSDVEEGGETIFPDANVNVSSLPWYNELSECAKRGLSVKPKMGDALLFWSMKPDATL  150

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVI+GNKWS TKWM + EYKA
Sbjct  151  DPLSLHGGCPVIRGNKWSSTKWMHIHEYKA  180



>ref|XP_009334602.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Pyrus x bretschneideri]
Length=287

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D++NTKNGGQR+AT+
Sbjct  138  RDKIIRDIEKRIADFTFIPVEHGEGLQVLHYEVGQKYDAHFDYFADEFNTKNGGQRVATL  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVE+GGETVFP AKG+I +VPWWNEL ECGK GL+VKPKMGDALL WSM PD +L
Sbjct  198  LMYLSDVEQGGETVFPTAKGSISSVPWWNELSECGKQGLAVKPKMGDALLFWSMTPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHG CPVI+GNKWS TKWM ++EYK 
Sbjct  258  DPSSLHGACPVIRGNKWSCTKWMHLQEYKV  287



>gb|ACN35795.1| unknown [Zea mays]
Length=180

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+
Sbjct  31   RDKVIRAIEKRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATL  90

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL +C K GLSVKPKMGDALL WSMKPD +L
Sbjct  91   LMYLSDVEEGGETIFPDANVNASSLPWYNELSDCAKRGLSVKPKMGDALLFWSMKPDATL  150

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKWM + EYKA
Sbjct  151  DPLSLHGGCPVIKGNKWSSTKWMHIHEYKA  180



>gb|EYU36811.1| hypothetical protein MIMGU_mgv1a011044mg [Erythranthe guttata]
Length=294

 Score =   267 bits (682),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+I++IEKRIAD+TFIPAEHGEGLQ+LHYEVGQKYEPHYDYFLDD+NTKNGGQRIATV
Sbjct  145  RDKVIKDIEKRIADYTFIPAEHGEGLQVLHYEVGQKYEPHYDYFLDDFNTKNGGQRIATV  204

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGN   VP WNE  EC K GL+VKPKMGDALL WSM+PD +L
Sbjct  205  LMYLSDVEEGGETIFPAAKGNFSTVPGWNEKSECAKRGLAVKPKMGDALLFWSMRPDATL  264

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP+SLHGGCPVI GNKWS TKWM V EYK 
Sbjct  265  DPTSLHGGCPVIVGNKWSSTKWMHVGEYKV  294



>ref|XP_007223346.1| hypothetical protein PRUPE_ppa009548mg [Prunus persica]
 gb|EMJ24545.1| hypothetical protein PRUPE_ppa009548mg [Prunus persica]
Length=287

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+ +IEKRIADFTFIP EHGEGLQILHYEVGQKY+ H+DYFLD++NTKNGGQRIAT+
Sbjct  138  RDKIVSDIEKRIADFTFIPVEHGEGLQILHYEVGQKYDAHFDYFLDEFNTKNGGQRIATL  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKG+  +V WW EL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  198  LMYLSDVEEGGETVFPAAKGSFNSVRWWKELSECGKQGLSVKPKMGDALLFWSMRPDASL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWM + EYK 
Sbjct  258  DPSSLHGGCPVIRGNKWSSTKWMHIEEYKV  287



>ref|XP_010539828.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539829.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539830.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Tarenaya 
hassleriana]
Length=288

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR+IEKRIAD+TFIP E+GEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  139  KDKIIRDIEKRIADYTFIPVENGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATM  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  199  LMYLSDVEEGGETVFPAANMNYTSVPWYNELSECGKKGLSVKPKMGDALLFWSMRPDASL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMR  EYK 
Sbjct  259  DPSSLHGGCPVIKGNKWSSTKWMRAGEYKV  288



>ref|XP_010940405.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Elaeis guineensis]
Length=295

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR+IEKRIAD+TFIP EHGEG Q+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  146  RDKTIRDIEKRIADYTFIPVEHGEGFQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATL  205

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  ++PW+NEL ECGK GLSVKPKMGDALL WSMKPD +L
Sbjct  206  LMYLSDVEEGGETVFPSAKVNSSSLPWFNELSECGKKGLSVKPKMGDALLFWSMKPDATL  265

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCP+IKGNKWS TKWMRV EYK 
Sbjct  266  DPLSLHGGCPMIKGNKWSATKWMRVHEYKV  295



>gb|KJB59733.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=287

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII++IEKRIAD++FIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+
Sbjct  138  QDKIIKDIEKRIADYSFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATM  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGNI +VPWWNEL ECGK GL+VKPKMGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETIFPAAKGNISSVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI GNKWS TKWM + EYK 
Sbjct  258  DPSSLHGGCPVIMGNKWSSTKWMHLEEYKV  287



>ref|XP_008456388.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X2 [Cucumis melo]
Length=284

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII NIEKRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+
Sbjct  136  QDKIISNIEKRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATL  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  196  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  255

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP+SLHG CPVI+GNKWS TKWM V +Y
Sbjct  256  DPTSLHGACPVIRGNKWSCTKWMHVNKY  283



>ref|XP_008809395.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809396.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008809397.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=290

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+
Sbjct  141  QDKIIRTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNIKNGGQRIATL  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+ N  ++PW+NEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  201  LMYLSDVEEGGETVFPAARVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPV+KGNKWS TKW+ + EYK 
Sbjct  261  DPSSLHGGCPVLKGNKWSSTKWIHIHEYKV  290



>ref|XP_008809398.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=289

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+
Sbjct  140  QDKIIRTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNIKNGGQRIATL  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+ N  ++PW+NEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  200  LMYLSDVEEGGETVFPAARVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPV+KGNKWS TKW+ + EYK 
Sbjct  260  DPSSLHGGCPVLKGNKWSSTKWIHIHEYKV  289



>ref|XP_002893096.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69355.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=287

 Score =   266 bits (679),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQILHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  138  RDKIIKTIEKRIADYTFIPADHGEGLQILHYEAGQKYEPHYDYFVDEFNTKNGGQRMATM  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DP+SLHGGCPVI+GNKWS TKWM V EYK
Sbjct  258  DPTSLHGGCPVIRGNKWSSTKWMHVGEYK  286



>ref|XP_006305481.1| hypothetical protein CARUB_v10009921mg [Capsella rubella]
 gb|EOA38379.1| hypothetical protein CARUB_v10009921mg [Capsella rubella]
Length=287

 Score =   265 bits (678),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  138  RDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNGGQRMATM  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP+SLHGGCPVI+GNKWS TKWM V EYK 
Sbjct  258  DPTSLHGGCPVIRGNKWSSTKWMHVGEYKV  287



>ref|XP_010548243.1| PREDICTED: prolyl 4-hydroxylase 5 [Tarenaya hassleriana]
Length=290

 Score =   265 bits (678),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            DK++  IE+RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD++N KNGGQRIATV 
Sbjct  142  DKVVEEIEQRISDFTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEFNVKNGGQRIATVL  201

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGNI AVPWWNEL +CGK GLSV PKMGDALL WSM PD SLD
Sbjct  202  MYLSDVEEGGETVFPAAKGNISAVPWWNELSQCGKEGLSVMPKMGDALLFWSMTPDASLD  261

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPVIKGNKWS TKW  V E+K 
Sbjct  262  PSSLHGGCPVIKGNKWSSTKWFHVHEFKV  290



>ref|XP_010539831.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Tarenaya 
hassleriana]
Length=248

 Score =   264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR+IEKRIAD+TFIP E+GEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  99   KDKIIRDIEKRIADYTFIPVENGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATM  158

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKPKMGDALL WSM+PD SL
Sbjct  159  LMYLSDVEEGGETVFPAANMNYTSVPWYNELSECGKKGLSVKPKMGDALLFWSMRPDASL  218

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMR  EYK 
Sbjct  219  DPSSLHGGCPVIKGNKWSSTKWMRAGEYKV  248



>emb|CDX96644.1| BnaA08g21870D [Brassica napus]
Length=290

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+I+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  141  RDKVIKTIEKRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATM  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  201  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKWM V EYK
Sbjct  261  DPSSLHGGCPVIKGNKWSSTKWMHVGEYK  289



>ref|NP_564109.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 sp|Q9LN20.1|P4H3_ARATH RecName: Full=Probable prolyl 4-hydroxylase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF88161.1|AC026234_12 Contains similarity to a prolyl 4-hydroxylase alpha subunit protein 
from Gallus gallus gi|212530 [Arabidopsis thaliana]
 gb|ABE02413.1| At1g20270 [Arabidopsis thaliana]
 gb|AEE29956.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=287

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  138  RDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNGGQRMATM  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DP+SLHGGCPVI+GNKWS TKWM V EYK
Sbjct  258  DPTSLHGGCPVIRGNKWSSTKWMHVGEYK  286



>emb|CDP07346.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            DK+IRNIEKRIAD+TFIP +HGEGLQ+LHYEVGQKYEPHYDYFLD YNTKNGGQRIAT+ 
Sbjct  145  DKVIRNIEKRIADYTFIPVDHGEGLQVLHYEVGQKYEPHYDYFLDKYNTKNGGQRIATLL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP + GN    P WNE+ EC K GLSVKPKMGDALL WSM+PD +LD
Sbjct  205  MYLSDVEEGGETVFPASTGNFSTAPGWNEMSECAKRGLSVKPKMGDALLFWSMRPDATLD  264

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPVI+GNKWS TKWM V EYK 
Sbjct  265  PSSLHGGCPVIRGNKWSSTKWMHVEEYKV  293



>ref|XP_010459709.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010459710.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=292

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D +NTKNGGQR+AT+
Sbjct  143  RDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDTFNTKNGGQRMATM  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  203  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP+SLHGGCPVI+GNKWS TKWM V EYK 
Sbjct  263  DPTSLHGGCPVIRGNKWSSTKWMHVGEYKV  292



>ref|XP_010477260.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010477261.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=291

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D +NTKNGGQR+AT+
Sbjct  142  RDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDTFNTKNGGQRMATM  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  202  LMYLSDVEEGGETVFPSANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP+SLHGGCPVI+GNKWS TKWM V EYK 
Sbjct  262  DPTSLHGGCPVIRGNKWSSTKWMHVGEYKV  291



>dbj|BAD23054.1| putative prolyl 4-hydroxylase [Oryza sativa Japonica Group]
Length=310

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQR+AT+
Sbjct  161  RDKVIRAIEKRIADYTFIPMEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRMATL  220

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL EC + GL+VKPKMGDALL WSMKPD +L
Sbjct  221  LMYLSDVEEGGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATL  280

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKWM VREYKA
Sbjct  281  DPLSLHGGCPVIKGNKWSSTKWMHVREYKA  310



>ref|XP_006449333.1| hypothetical protein CICLE_v10016152mg [Citrus clementina]
 ref|XP_006467805.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Citrus 
sinensis]
 gb|ESR62573.1| hypothetical protein CICLE_v10016152mg [Citrus clementina]
 gb|KDO75953.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=288

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+IIR IEKRIADFTFIP EHGEG+Q+LHYEVGQKY+ HYDYFLD++NTKNGGQR+AT+
Sbjct  139  QDRIIRGIEKRIADFTFIPMEHGEGIQVLHYEVGQKYDAHYDYFLDEFNTKNGGQRMATL  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +V WWNEL ECGK GLSVKPK GDALL WSM+PD +L
Sbjct  199  LMYLSDVEEGGETVFPAANANFTSVRWWNELSECGKQGLSVKPKRGDALLFWSMRPDATL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWM V EYKA
Sbjct  259  DPSSLHGGCPVIRGNKWSATKWMHVHEYKA  288



>gb|EPS63604.1| iron ion binding / oxidoreductase/ oxidoreductase protein, partial 
[Genlisea aurea]
Length=283

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+RNIEKRIAD TFIP EHGEGLQILHYE GQKYEPHYDYF+D++NTKNGGQRIAT 
Sbjct  136  RDKIVRNIEKRIADATFIPVEHGEGLQILHYEEGQKYEPHYDYFMDEFNTKNGGQRIATF  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN   VPWWNEL ECGKGGLSVKPK GDA+L WSMKPD +L
Sbjct  196  LMYLSDVEEGGETVFPAAKGNSSGVPWWNELSECGKGGLSVKPKTGDAVLFWSMKPDATL  255

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP+SLHG CPVIKG+KWS  KW+ V EY
Sbjct  256  DPTSLHGSCPVIKGSKWSAPKWIHVHEY  283



>ref|XP_010918436.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Elaeis 
guineensis]
 ref|XP_010918437.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Elaeis 
guineensis]
Length=290

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII+ IEKRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+
Sbjct  141  QDKIIQTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNVKNGGQRIATL  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP  + N  ++PW+NEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  201  LMYLSDVEEGGETVFPSVRVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPV+KGNKWS TKWM V EYK 
Sbjct  261  DPSSLHGGCPVLKGNKWSSTKWMHVYEYKV  290



>ref|XP_010918438.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Elaeis 
guineensis]
Length=289

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII+ IEKRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+
Sbjct  140  QDKIIQTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNVKNGGQRIATL  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP  + N  ++PW+NEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  200  LMYLSDVEEGGETVFPSVRVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPV+KGNKWS TKWM V EYK 
Sbjct  260  DPSSLHGGCPVLKGNKWSSTKWMHVYEYKV  289



>emb|CDY54327.1| BnaCnng26730D [Brassica napus]
Length=290

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+I+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  141  RDKVIKTIEKRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATM  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  201  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWM V EYK 
Sbjct  261  DPSSLHGGCPVIRGNKWSSTKWMHVGEYKV  290



>ref|XP_008778322.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=301

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR IEKRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  152  RDKIIRAIEKRIADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATL  211

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET FP AK N  ++PW+NEL ECGK GLSVKPKMGDALL WSMKPD +L
Sbjct  212  LMYLSDVEEGGETGFPSAKVNSSSLPWFNELSECGKKGLSVKPKMGDALLFWSMKPDATL  271

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCP+IKGNKWS TKW+RV EYK 
Sbjct  272  DPLSLHGGCPLIKGNKWSATKWIRVHEYKV  301



>ref|XP_009110235.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brassica rapa]
Length=290

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RD++I+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  141  RDQVIKTIEKRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATM  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  201  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKWM V EYK
Sbjct  261  DPSSLHGGCPVIKGNKWSSTKWMHVGEYK  289



>ref|XP_010531576.1| PREDICTED: prolyl 4-hydroxylase 5-like [Tarenaya hassleriana]
Length=337

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKI+  IE+RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD++N KNGGQR+ATV
Sbjct  188  QDKIVEEIEQRISDFTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEFNIKNGGQRVATV  247

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLS+VEEGGETVFP AKGNI AVPWWNEL +CGK GLSV PKMGDALL WSM PD SL
Sbjct  248  LMYLSEVEEGGETVFPAAKGNISAVPWWNELSQCGKEGLSVMPKMGDALLFWSMTPDASL  307

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVIKGNKWS TKW  V E+K
Sbjct  308  DPSSLHGGCPVIKGNKWSSTKWFHVHEFK  336



>gb|EMT22590.1| Prolyl 4-hydroxylase subunit alpha-1 [Aegilops tauschii]
Length=224

 Score =   261 bits (668),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IE+RIAD+TFIPAEHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  75   RDKVIRAIERRIADYTFIPAEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATI  134

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL EC + GL+VKPKMGDALL WSMKPD +L
Sbjct  135  LMYLSDVEEGGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATL  194

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKW+ V EYKA
Sbjct  195  DPLSLHGGCPVIKGNKWSSTKWLHVHEYKA  224



>ref|XP_003629229.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03705.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=278

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+RNIEKRIADFTFIP E+GE   +L YEVGQKY+PH DYF DDYNT NGGQRIAT+ 
Sbjct  130  DEIVRNIEKRIADFTFIPVENGESFNVLRYEVGQKYDPHLDYFADDYNTVNGGQRIATML  189

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGNI +VPWWNEL +CGK GLS+KPKMGDALL WSMKPDG+LD
Sbjct  190  MYLSDVEEGGETVFPAAKGNISSVPWWNELSDCGKKGLSIKPKMGDALLFWSMKPDGTLD  249

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHG CPVIKG+KWS TKWMR+ E++A
Sbjct  250  PSSLHGACPVIKGDKWSCTKWMRINEFRA  278



>ref|XP_004139389.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=284

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKI+ NIEKRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+
Sbjct  136  QDKIVSNIEKRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATL  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  196  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSKCGKGGLSVKPKMGDALLFWSMKPDATL  255

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP+SLHG CPVI+GNKWS TKWM V +Y
Sbjct  256  DPTSLHGACPVIRGNKWSCTKWMHVDKY  283



>emb|CDY51328.1| BnaCnng20650D [Brassica napus]
Length=291

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  142  RDKIIKTIEKRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATM  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL  CGK GLSVKP+MGDALL WSM+PD +L
Sbjct  202  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSACGKKGLSVKPRMGDALLFWSMRPDATL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVI+GNKWS TKWM V EYK
Sbjct  262  DPSSLHGGCPVIRGNKWSSTKWMHVGEYK  290



>gb|AAM61711.1| putative prolyl 4-hydroxylase, alpha subunit [Arabidopsis thaliana]
Length=287

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  138  RDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNGGQRMATM  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DP+SLHGGCPVI+GNKWS TKW+ V EYK
Sbjct  258  DPTSLHGGCPVIRGNKWSSTKWIHVGEYK  286



>emb|CDY29362.1| BnaA06g14340D [Brassica napus]
Length=291

 Score =   263 bits (673),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D++NTKNGGQR+AT+
Sbjct  142  RDKIIKTIEKRIADYTFIPADHGEGLQVLHYEEGQKYEPHYDYFVDEFNTKNGGQRMATM  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL  CGK GLSVKP+MGDALL WSM+PD +L
Sbjct  202  LMYLSDVEEGGETVFPAANMNFSSVPWYNELSACGKKGLSVKPRMGDALLFWSMRPDATL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVI+GNKWS TKWM V EYK
Sbjct  262  DPSSLHGGCPVIRGNKWSSTKWMHVGEYK  290



>ref|XP_010498461.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
 ref|XP_010498463.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=292

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D +NTKNGGQR+AT+
Sbjct  143  RDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDTFNTKNGGQRMATM  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +V W+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  203  LMYLSDVEEGGETVFPAANMNFSSVSWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP+SLHGGCPVIKGNKWS TKWM V EYK 
Sbjct  263  DPTSLHGGCPVIKGNKWSSTKWMHVGEYKV  292



>gb|KJB29665.1| hypothetical protein B456_005G112700 [Gossypium raimondii]
Length=286

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII +IEKRIA+++FIP EHGEGLQ+LHYEVGQKYEPH+DYF+D+YNT++GGQR+AT+
Sbjct  137  QDKIISDIEKRIAEYSFIPIEHGEGLQVLHYEVGQKYEPHFDYFVDEYNTRHGGQRLATM  196

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGNI AVPWW+ L +CGKGGL+VKPKMGDALL WSMKPD ++
Sbjct  197  LMYLSDVEEGGETIFPNAKGNISAVPWWDALSKCGKGGLAVKPKMGDALLFWSMKPDATV  256

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVI G+KWS TKWM V EYK
Sbjct  257  DPSSLHGGCPVIVGDKWSSTKWMHVNEYK  285



>ref|XP_002453082.1| hypothetical protein SORBIDRAFT_04g038020 [Sorghum bicolor]
 gb|EES06058.1| hypothetical protein SORBIDRAFT_04g038020 [Sorghum bicolor]
Length=307

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIPA+HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  158  RDKVIRAIEKRIADYTFIPADHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATL  217

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL EC K GLSVKPKMGDALL WSMKPD +L
Sbjct  218  LMYLSDVEEGGETIFPDANVNASSLPWYNELSECAKRGLSVKPKMGDALLFWSMKPDATL  277

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVI+GNKWS TKWM + EYKA
Sbjct  278  DPLSLHGGCPVIRGNKWSSTKWMHIHEYKA  307



>ref|XP_003603828.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
Length=156

 Score =   258 bits (658),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII+NIE+RIADFTFIP E+GEGLQ+LHY VG+KYEPHYDYFLD++NTKNGGQR+ATV
Sbjct  7    KDKIIQNIERRIADFTFIPVENGEGLQVLHYGVGEKYEPHYDYFLDEFNTKNGGQRVATV  66

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  +VPWWN+L EC + GLS+KPKMGDALL WSM+PD +L
Sbjct  67   LMYLSDVEEGGETVFPAAKANFSSVPWWNDLSECARKGLSLKPKMGDALLFWSMRPDATL  126

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D SSLHGGCPVI GNKWS TKWM + EYK 
Sbjct  127  DASSLHGGCPVIVGNKWSSTKWMHLEEYKV  156



>ref|XP_003603827.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AES74078.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=280

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII+NIE+RIADFTFIP E+GEGLQ+LHY VG+KYEPHYDYFLD++NTKNGGQR+ATV
Sbjct  131  KDKIIQNIERRIADFTFIPVENGEGLQVLHYGVGEKYEPHYDYFLDEFNTKNGGQRVATV  190

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  +VPWWN+L EC + GLS+KPKMGDALL WSM+PD +L
Sbjct  191  LMYLSDVEEGGETVFPAAKANFSSVPWWNDLSECARKGLSLKPKMGDALLFWSMRPDATL  250

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D SSLHGGCPVI GNKWS TKWM + EYK 
Sbjct  251  DASSLHGGCPVIVGNKWSSTKWMHLEEYKV  280



>ref|XP_006648159.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Oryza brachyantha]
Length=306

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQR+AT+
Sbjct  157  RDKVIRAIEKRIADYTFIPMEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRMATL  216

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL EC + GL+VKPKMGDALL WSMKPD +L
Sbjct  217  LMYLSDVEEGGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATL  276

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKWM V EYKA
Sbjct  277  DPLSLHGGCPVIKGNKWSSTKWMHVHEYKA  306



>ref|XP_010266902.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Nelumbo 
nucifera]
Length=309

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+IIR IEKRIADFTFIP E+GEGLQIL YE+GQ YEPHYDYF+D++NTKNGG R+ATV
Sbjct  160  QDRIIRTIEKRIADFTFIPVENGEGLQILRYELGQMYEPHYDYFVDEFNTKNGGNRMATV  219

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWWNEL ECGK GLSVKPKMGDA+L WSM+PD +L
Sbjct  220  LMYLSDVEEGGETVFPNAKGNISSVPWWNELSECGKRGLSVKPKMGDAILFWSMRPDATL  279

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHG CPVIKG KWS  KWM V EYK
Sbjct  280  DPSSLHGACPVIKGTKWSCAKWMHVNEYK  308



>ref|XP_010266901.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Nelumbo 
nucifera]
Length=309

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+IIR IEKRIADFTFIP E+GEGLQIL YE+GQ YEPHYDYF+D++NTKNGG R+ATV
Sbjct  160  QDRIIRTIEKRIADFTFIPVENGEGLQILRYELGQMYEPHYDYFVDEFNTKNGGNRMATV  219

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI +VPWWNEL ECGK GLSVKPKMGDA+L WSM+PD +L
Sbjct  220  LMYLSDVEEGGETVFPNAKGNISSVPWWNELSECGKRGLSVKPKMGDAILFWSMRPDATL  279

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHG CPVIKG KWS  KWM V EYK
Sbjct  280  DPSSLHGACPVIKGTKWSCAKWMHVNEYK  308



>ref|XP_010667434.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010667435.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010667436.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Beta vulgaris subsp. 
vulgaris]
Length=285

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR+IEKRIADFTFIP EHGEGLQILHYE GQKYEPHYDYFLD++N KNGGQRIATV
Sbjct  136  QDKIIRDIEKRIADFTFIPVEHGEGLQILHYEEGQKYEPHYDYFLDEFNKKNGGQRIATV  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A GN  ++P WNE  ECGK GLSV+PKMGDALL WSM+PD +L
Sbjct  196  LMYLSDVEEGGETVFPAAPGNFSSLPGWNERSECGKRGLSVRPKMGDALLFWSMRPDATL  255

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D SSLHGGCPVIKGNKWS TKWM V EY+ 
Sbjct  256  DSSSLHGGCPVIKGNKWSSTKWMHVEEYRV  285



>gb|KJB58041.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
 gb|KJB58042.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
 gb|KJB58043.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
Length=287

 Score =   261 bits (668),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII +IEKRIAD+TFIP E+GEGLQ+LHYEV QKY+ H+DYFLD+ NTKNGGQR+ATV
Sbjct  138  QDKIIMDIEKRIADYTFIPVENGEGLQVLHYEVEQKYDAHFDYFLDEINTKNGGQRMATV  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGN+ AVPWWNEL ECGK GL+VKPKMGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETIFPAAKGNVSAVPWWNELSECGKKGLAVKPKMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVI GNKWS TKW+ V EYK
Sbjct  258  DPSSLHGGCPVISGNKWSSTKWLHVEEYK  286



>ref|XP_003574128.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brachypodium distachyon]
Length=306

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DK+IR IEKRI+DFTFIPAE+GEGLQ+LHYEVGQKYEPH+DYF DD+NTKNGGQRIAT+
Sbjct  157  QDKVIRTIEKRISDFTFIPAENGEGLQVLHYEVGQKYEPHFDYFHDDFNTKNGGQRIATL  216

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  ++P++NEL EC K G+SVKPKMGDALL WSM+PDG+L
Sbjct  217  LMYLSDVEEGGETVFPSAKVNSSSIPFYNELSECAKRGISVKPKMGDALLFWSMRPDGTL  276

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DP+SLHGGCPVIKG+KWS TKW+RV EYK
Sbjct  277  DPTSLHGGCPVIKGDKWSSTKWIRVHEYK  305



>gb|AFK48224.1| unknown [Lotus japonicus]
Length=188

 Score =   258 bits (659),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DK+I+ IEKRIADF FIP E+GEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIATV
Sbjct  39   KDKVIQTIEKRIADFAFIPVENGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATV  98

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AK N  +VPW+N+L  C K GLSVKPK GDALL WS++PD +L
Sbjct  99   LMYLSDVEEGGETIFPAAKANFSSVPWYNDLSVCAKKGLSVKPKRGDALLFWSIRPDATL  158

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVI+GNKWS TKWM + EYK 
Sbjct  159  DPSSLHGGCPVIRGNKWSSTKWMHLEEYKV  188



>ref|NP_001241865.1| prolyl 4-hydroxylase 5-1 [Zea mays]
 gb|AEP37749.1| prolyl 4-hydroxylase 5-1 [Zea mays]
Length=180

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRI D+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  31   RDKVIRVIEKRITDYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATL  90

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             M+LSDVEEGGET+FP A  N  ++PW+NEL EC K GLSVKPKMGDALL WSMKPD +L
Sbjct  91   LMHLSDVEEGGETIFPDANVNDSSLPWYNELSECAKRGLSVKPKMGDALLFWSMKPDATL  150

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVI+GNKWS TKWM + EYKA
Sbjct  151  DPLSLHGGCPVIRGNKWSSTKWMHIHEYKA  180



>ref|NP_001151238.1| LOC100284871 [Zea mays]
 ref|XP_008677412.1| PREDICTED: auxin-independent growth promoter protein isoform 
X1 [Zea mays]
 gb|ACG42089.1| prolyl 4-hydroxylase alpha-2 subunit precursor [Zea mays]
 gb|AEP37748.1| prolyl 4-hydroxylase 5 [Zea mays]
 gb|AFW63915.1| prolyl 4-hydroxylase alpha-2 subunit [Zea mays]
Length=308

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  159  RDKVIRVIEKRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATL  218

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N+ ++PW+NEL EC K GLSVKPKMGDALL WSMKPD +L
Sbjct  219  LMYLSDVEEGGETIFPDANVNVSSLPWYNELSECAKRGLSVKPKMGDALLFWSMKPDATL  278

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVI+GNKWS TKWM + EYKA
Sbjct  279  DPLSLHGGCPVIRGNKWSSTKWMHIHEYKA  308



>ref|XP_011074717.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011074718.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
Length=289

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 133/150 (89%), Gaps = 3/150 (2%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR+IEKRIAD+TFIPAEHGEGLQ+LHYEVGQKYEPHYDYFLD++NTKNGGQRIAT+
Sbjct  143  RDKVIRDIEKRIADYTFIPAEHGEGLQVLHYEVGQKYEPHYDYFLDEFNTKNGGQRIATI  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGN  + P    L ECGK GL+VKPKMGDALL WSM+PD SL
Sbjct  203  LMYLSDVEEGGETIFPSAKGNFSSAP---NLSECGKRGLAVKPKMGDALLFWSMRPDASL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM V EYK 
Sbjct  260  DPSSLHGGCPVIKGNKWSSTKWMHVGEYKV  289



>ref|XP_010683036.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Beta vulgaris subsp. 
vulgaris]
Length=291

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RD IIR IE+RIADFTF+P EHGEGLQ+LHYEVGQKYEPH+DYFL+DY+T  GGQRIATV
Sbjct  142  RDTIIRAIEQRIADFTFLPVEHGEGLQVLHYEVGQKYEPHFDYFLEDYSTVTGGQRIATV  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI  VP+WNEL +CG+ GL+VKPKMGDALL WS+KPD SL
Sbjct  202  LMYLSDVEEGGETVFPSAKGNISDVPYWNELSKCGQEGLAVKPKMGDALLFWSLKPDASL  261

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLH GCPVI+G+KWS TKW+RV EY
Sbjct  262  DPSSLHAGCPVIRGDKWSATKWIRVNEY  289



>ref|XP_006661912.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Oryza brachyantha]
Length=221

 Score =   259 bits (661),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            DKII  IEKRI+D+TFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NTKNGGQRIAT+ 
Sbjct  73   DKIISTIEKRISDYTFIPVENGEGLQVLHYEVGQKYEPHFDYFHDEFNTKNGGQRIATLL  132

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP +K N  + P++NEL EC K GLSVKPKMGDALL WSM+PDGSLD
Sbjct  133  MYLSDVEEGGETVFPTSKANSSSSPFYNELSECAKRGLSVKPKMGDALLFWSMRPDGSLD  192

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            PSSLHGGCPVIKGNKWS TKWMRV EYK
Sbjct  193  PSSLHGGCPVIKGNKWSSTKWMRVHEYK  220



>ref|NP_001159002.1| prolyl 4-hydroxylase alpha-2 subunit [Zea mays]
 ref|XP_008643888.1| PREDICTED: prolyl 4-hydroxylase alpha-2 subunit isoform X1 [Zea 
mays]
 gb|ACG35031.1| prolyl 4-hydroxylase alpha-2 subunit precursor [Zea mays]
 gb|AEP37757.1| prolyl 4-hydroxylase 8 [Zea mays]
 gb|AEP37758.1| prolyl 4-hydroxylase 8-1 [Zea mays]
 gb|AFW74120.1| prolyl 4-hydroxylase alpha-2 subunit isoform 1 [Zea mays]
 gb|AFW74121.1| prolyl 4-hydroxylase alpha-2 subunit isoform 2 [Zea mays]
 gb|AFW74122.1| prolyl 4-hydroxylase alpha-2 subunit isoform 3 [Zea mays]
 gb|AFW74123.1| prolyl 4-hydroxylase alpha-2 subunit isoform 4 [Zea mays]
Length=307

 Score =   261 bits (668),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+
Sbjct  158  RDKVIRAIEKRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATL  217

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL +C K GLSVKPKMGDALL WSMKPD +L
Sbjct  218  LMYLSDVEEGGETIFPDANVNASSLPWYNELSDCAKRGLSVKPKMGDALLFWSMKPDATL  277

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKWM + EYKA
Sbjct  278  DPLSLHGGCPVIKGNKWSSTKWMHIHEYKA  307



>dbj|BAJ85763.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score =   261 bits (667),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKI+R IEKRI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF DD+NTKNGGQRIATV
Sbjct  151  QDKIVRTIEKRISDFTFIPVENGEGLQVLHYEVGQKYEPHFDYFHDDFNTKNGGQRIATV  210

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  ++P++NEL EC K G+SVKPKMGDALL WSM+PDG+L
Sbjct  211  LMYLSDVEEGGETVFPSAKVNSSSIPFYNELSECAKRGISVKPKMGDALLFWSMRPDGTL  270

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP+SLHGGCPVIKG+KWS TKW+RV EYK 
Sbjct  271  DPTSLHGGCPVIKGDKWSSTKWIRVHEYKV  300



>dbj|BAK01841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=315

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IE+RIAD+TFIPAEHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  166  RDKVIRAIERRIADYTFIPAEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATI  225

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSD+EEGGET+FP A  N  ++PW+NEL EC + GL+VKPKMGDALL WSMKPD +L
Sbjct  226  LMYLSDIEEGGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATL  285

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKW+ V EYKA
Sbjct  286  DPLSLHGGCPVIKGNKWSSTKWLHVGEYKA  315



>gb|KJB58040.1| hypothetical protein B456_009G191400 [Gossypium raimondii]
Length=265

 Score =   259 bits (663),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII +IEKRIAD+TFIP E+GEGLQ+LHYEV QKY+ H+DYFLD+ NTKNGGQR+ATV
Sbjct  116  QDKIIMDIEKRIADYTFIPVENGEGLQVLHYEVEQKYDAHFDYFLDEINTKNGGQRMATV  175

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGN+ AVPWWNEL ECGK GL+VKPKMGDALL WSM+PD +L
Sbjct  176  LMYLSDVEEGGETIFPAAKGNVSAVPWWNELSECGKKGLAVKPKMGDALLFWSMRPDATL  235

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHGGCPVI GNKWS TKW+ V EYK
Sbjct  236  DPSSLHGGCPVISGNKWSSTKWLHVEEYK  264



>ref|XP_004954469.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Setaria 
italica]
Length=311

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  162  RDKVIRTIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATL  221

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL EC + GLS+KPKMGDALL +SMKPD +L
Sbjct  222  LMYLSDVEEGGETIFPDANVNSSSLPWYNELSECARRGLSIKPKMGDALLFYSMKPDATL  281

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVI GNKWS TKWM V EYKA
Sbjct  282  DPLSLHGGCPVINGNKWSSTKWMHVHEYKA  311



>ref|XP_006285542.1| hypothetical protein CARUB_v10006984mg [Capsella rubella]
 gb|EOA18440.1| hypothetical protein CARUB_v10006984mg [Capsella rubella]
Length=293

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+I+ +IEKRI+DFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIATV
Sbjct  144  QDEIVEDIEKRISDFTFIPIEHGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATV  203

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI  VPWW+EL ECGK GLSV PK  DALL WSM+PD SL
Sbjct  204  LMYLSDVEEGGETVFPTAKGNISDVPWWDELSECGKTGLSVLPKKRDALLFWSMQPDASL  263

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW  V EYKA
Sbjct  264  DPSSLHGGCPVIKGNKWSSTKWFHVHEYKA  293



>ref|XP_009386075.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009386076.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=288

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRIAD+TFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+
Sbjct  139  QDKIIRTIEKRIADYTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATL  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  ++P +NEL +C K G+SVKPKMGDALL WSM+PD +L
Sbjct  199  LMYLSDVEEGGETVFPSAKVNSSSLPGYNELSDCAKKGISVKPKMGDALLFWSMRPDATL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLH GCPVIKGNKWS TKWMR+ EY+A
Sbjct  259  DPSSLHAGCPVIKGNKWSSTKWMRIHEYRA  288



>ref|XP_008778312.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=308

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR IEKRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  152  RDKIIRAIEKRIADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATL  211

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET FP AK N  ++PW+NEL ECGK GLSVKPKMGDALL WSMKPD +L
Sbjct  212  LMYLSDVEEGGETGFPSAKVNSSSLPWFNELSECGKKGLSVKPKMGDALLFWSMKPDATL  271

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVRE  255
            DP SLHGGCP+IKGNKWS TKW+RV E
Sbjct  272  DPLSLHGGCPLIKGNKWSATKWIRVHE  298



>ref|XP_006828848.1| hypothetical protein AMTR_s00001p00155640 [Amborella trichopoda]
 gb|ERM96264.1| hypothetical protein AMTR_s00001p00155640 [Amborella trichopoda]
Length=286

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII++IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIATV
Sbjct  137  QDKIIQSIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATV  196

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYL++VE+GGETVFP +K N  +VPWW+EL +C K G+SV+P+MGDALL WSM+PD +L
Sbjct  197  LMYLTNVEKGGETVFPSSKVNSSSVPWWDELSDCAKTGVSVRPRMGDALLFWSMRPDATL  256

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLH GCPVI+GNKWS TKW+ V EYK 
Sbjct  257  DPSSLHAGCPVIQGNKWSSTKWLHVTEYKV  286



>ref|XP_002467008.1| hypothetical protein SORBIDRAFT_01g018200 [Sorghum bicolor]
 gb|EER94006.1| hypothetical protein SORBIDRAFT_01g018200 [Sorghum bicolor]
Length=307

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII+ IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF DDYNTKNGGQRIAT+
Sbjct  158  QDKIIQTIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFHDDYNTKNGGQRIATL  217

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVE+GGETVFP +  N  + P++NEL EC KGGLSVKPKMGDALL WSMKPDGS+
Sbjct  218  LMYLSDVEDGGETVFPSSTTNSSSSPFYNELSECAKGGLSVKPKMGDALLFWSMKPDGSM  277

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D +SLHGGCPVIKGNKWS TKWMRV EYKA
Sbjct  278  DSTSLHGGCPVIKGNKWSSTKWMRVHEYKA  307



>ref|XP_002510597.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
 gb|EEF52784.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis]
Length=289

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIEKRIADF+FIP EHGEGLQ+LHYEVGQKYE HYDYFLD++NTKNGGQR AT+
Sbjct  140  RDKIIRNIEKRIADFSFIPIEHGEGLQVLHYEVGQKYEAHYDYFLDEFNTKNGGQRTATL  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK NI  VP WNEL EC + GLSVKPKMG+ALL WS +PD +L
Sbjct  200  LMYLSDVEEGGETVFPAAKANISNVPSWNELSECARQGLSVKPKMGNALLFWSTRPDATL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP+SLHG CPVI+GNKWS TKWM + EY
Sbjct  260  DPASLHGSCPVIRGNKWSATKWMHLGEY  287



>ref|NP_001241694.1| prolyl 4-hydroxylase 8-4 [Zea mays]
 gb|AEP37761.1| prolyl 4-hydroxylase 8-4 [Zea mays]
Length=307

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            R+K+IR IEKRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+
Sbjct  158  RNKVIRAIEKRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATL  217

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL +C K GLSVKPKMGDALL WSMKPD +L
Sbjct  218  LMYLSDVEEGGETIFPDANVNASSLPWYNELSDCAKRGLSVKPKMGDALLFWSMKPDATL  277

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKWM + EYKA
Sbjct  278  DPLSLHGGCPVIKGNKWSSTKWMHIHEYKA  307



>gb|ABK24739.1| unknown [Picea sitchensis]
Length=303

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DK IR+IEKRIADFTFIPAEHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIATV
Sbjct  154  QDKTIRSIEKRIADFTFIPAEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATV  213

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVE+GGETVFP +K N  +VPWW+EL EC K G+SV+P+MGDALL WSM+PD  L
Sbjct  214  LMYLSDVEKGGETVFPASKVNSSSVPWWDELSECAKAGISVRPRMGDALLFWSMRPDAEL  273

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLH GCPVI+G+KWS TKW+ V EYK 
Sbjct  274  DPSSLHAGCPVIQGDKWSATKWIHVGEYKV  303



>gb|EPS68098.1| hypothetical protein M569_06675 [Genlisea aurea]
Length=283

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 130/150 (87%), Gaps = 3/150 (2%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RD +IR+IEKRIADFTFIP EHGEGLQ+LHYE GQKYEPH+DYFLD+YNTKNGGQRIAT+
Sbjct  137  RDAVIRDIEKRIADFTFIPVEHGEGLQVLHYEQGQKYEPHFDYFLDEYNTKNGGQRIATL  196

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGN  A P   EL ECGK GLSVKP+MGDALL WSM PD +L
Sbjct  197  LMYLSDVEEGGETIFPAAKGNFSAAP---ELSECGKRGLSVKPRMGDALLFWSMHPDATL  253

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWM V EYK 
Sbjct  254  DPSSLHGGCPVIKGNKWSSTKWMHVGEYKV  283



>ref|XP_011083428.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083429.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083430.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
 ref|XP_011083431.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Sesamum indicum]
Length=292

 Score =   259 bits (661),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR+IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD++NT+NGGQR+ATV
Sbjct  143  RDKVIRDIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTRNGGQRVATV  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GN  ++P WNE  EC K GLS+KPKMGDALL WSM PD +L
Sbjct  203  LMYLSDVEEGGETVFPAARGNYSSLPGWNERSECAKRGLSLKPKMGDALLFWSMHPDATL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLHG CPVI+GNKWS TKWM V EY
Sbjct  263  DPSSLHGSCPVIRGNKWSSTKWMHVGEY  290



>ref|XP_002307750.2| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE94746.2| oxidoreductase family protein [Populus trichocarpa]
Length=288

 Score =   259 bits (661),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D++IR IEKRIADF+FIP EHGEGLQ+LHYEVGQKYE H+DYFLD++NTKNGGQR AT+ 
Sbjct  140  DRVIREIEKRIADFSFIPVEHGEGLQVLHYEVGQKYEAHFDYFLDEFNTKNGGQRTATLL  199

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP A  NI AVPWWNEL EC K GLS+KPKMG+ALL WS +PD +LD
Sbjct  200  MYLSDVEEGGETVFPAANMNISAVPWWNELSECAKQGLSLKPKMGNALLFWSTRPDATLD  259

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            PSSLHG CPVI+GNKWS TKWM + EYK
Sbjct  260  PSSLHGSCPVIRGNKWSATKWMHLGEYK  287



>ref|NP_001131953.1| uncharacterized protein LOC100193348 [Zea mays]
 gb|ACF80592.1| unknown [Zea mays]
 gb|AEP37741.1| prolyl 4-hydroxylase 1 [Zea mays]
 tpg|DAA49455.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=307

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRIAD+TFIP E GEGLQ+LHYEVGQKYEPH+DYF DDYNTKNGGQRIAT+
Sbjct  158  QDKIIRTIEKRIADYTFIPVEQGEGLQVLHYEVGQKYEPHFDYFHDDYNTKNGGQRIATL  217

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVE+GGETVFP +  N  + P++NEL EC KGGLSVKPKMGDALL WSMKPDGSL
Sbjct  218  LMYLSDVEDGGETVFPSSTTNSSSSPFYNELSECAKGGLSVKPKMGDALLFWSMKPDGSL  277

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP+SLHGGCPVIKGNKWS TKWMRV EYK 
Sbjct  278  DPTSLHGGCPVIKGNKWSSTKWMRVHEYKV  307



>ref|NP_001241695.1| prolyl 4-hydroxylase 8-5 [Zea mays]
 gb|AEP37762.1| prolyl 4-hydroxylase 8-5 [Zea mays]
Length=307

 Score =   259 bits (661),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIP +HGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQRIAT+
Sbjct  158  RDKVIRAIEKRIADYTFIPVDHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRIATL  217

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL +C K GLSVKPKMGDALL WSMKP  +L
Sbjct  218  LMYLSDVEEGGETIFPDANVNASSLPWYNELSDCAKRGLSVKPKMGDALLFWSMKPGATL  277

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKWM + EYKA
Sbjct  278  DPLSLHGGCPVIKGNKWSSTKWMHIHEYKA  307



>emb|CDY07826.1| BnaC03g47960D [Brassica napus]
Length=293

 Score =   258 bits (659),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  145  DEIVETIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  205  MYLSDVDDGGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  264

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  265  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  293



>tpg|DAA49456.1| TPA: hypothetical protein ZEAMMB73_536273 [Zea mays]
Length=364

 Score =   260 bits (665),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRIAD+TFIP E GEGLQ+LHYEVGQKYEPH+DYF DDYNTKNGGQRIAT+
Sbjct  215  QDKIIRTIEKRIADYTFIPVEQGEGLQVLHYEVGQKYEPHFDYFHDDYNTKNGGQRIATL  274

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVE+GGETVFP +  N  + P++NEL EC KGGLSVKPKMGDALL WSMKPDGSL
Sbjct  275  LMYLSDVEDGGETVFPSSTTNSSSSPFYNELSECAKGGLSVKPKMGDALLFWSMKPDGSL  334

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DP+SLHGGCPVIKGNKWS TKWMRV EYK
Sbjct  335  DPTSLHGGCPVIKGNKWSSTKWMRVHEYK  363



>ref|XP_006409254.1| hypothetical protein EUTSA_v10022796mg [Eutrema salsugineum]
 gb|ESQ50707.1| hypothetical protein EUTSA_v10022796mg [Eutrema salsugineum]
Length=290

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  142  DEVVETIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  201

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  202  MYLSDVDDGGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  261

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  262  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  290



>ref|XP_009150770.1| PREDICTED: prolyl 4-hydroxylase 5 isoform X1 [Brassica rapa]
Length=293

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  145  DEVVETIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  205  MYLSDVDDGGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  264

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  265  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  293



>ref|XP_003570489.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Brachypodium distachyon]
Length=318

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IE+RIAD+TFIPAEHGEGLQ+LHYEVGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  169  RDKVIRAIERRIADYTFIPAEHGEGLQVLHYEVGQKYEPHFDYFLDEFNTKNGGQRMATI  228

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW NEL EC + GL+VKPKMGDALL WSM PD +L
Sbjct  229  LMYLSDVEEGGETIFPDANVNSSSLPWHNELSECARKGLAVKPKMGDALLFWSMNPDATL  288

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DP SLHGGCPVI+GNKWS TKWM V EYK
Sbjct  289  DPLSLHGGCPVIRGNKWSSTKWMHVGEYK  317



>emb|CDY29194.1| BnaA06g25630D [Brassica napus]
Length=293

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  145  DEVVETIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  205  MYLSDVDDGGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  264

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  265  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  293



>ref|XP_009150771.1| PREDICTED: prolyl 4-hydroxylase 5 isoform X2 [Brassica rapa]
Length=292

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  144  DEVVETIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  203

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  204  MYLSDVDDGGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  263

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  264  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  292



>ref|XP_009394475.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=293

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH DYF D++NTKNGGQRIAT 
Sbjct  144  RDKIIRSIEKRIADYTFIPVEHGEGLQVLHYEVGQKYEPHLDYFADEFNTKNGGQRIATF  203

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  ++P +NEL +CGK GL++KPKMGDALL WSMKPD ++
Sbjct  204  LMYLSDVEEGGETVFPNAKVNSSSLPGYNELSDCGKAGLALKPKMGDALLFWSMKPDATM  263

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHG CPVIKGNKWS  KWMR+ EYKA
Sbjct  264  DPLSLHGACPVIKGNKWSAPKWMRLHEYKA  293



>ref|XP_011003088.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Populus euphratica]
 ref|XP_011003089.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Populus euphratica]
Length=288

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RD+ IR IEKRIADF+FIP EHGEGLQ+LHYEVGQKYE H+DYFLD++NTKNGGQR AT+
Sbjct  139  RDRFIREIEKRIADFSFIPVEHGEGLQVLHYEVGQKYEAHFDYFLDEFNTKNGGQRTATL  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  NI AVPWWNEL EC K GLS+KPK G+ALL WS +PD +L
Sbjct  199  LMYLSDVEEGGETVFPAANVNISAVPWWNELSECAKQGLSLKPKRGNALLFWSTRPDATL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DPSSLHG CPVI+GNKWS TKWM + EYK
Sbjct  259  DPSSLHGSCPVIRGNKWSATKWMHLGEYK  287



>ref|XP_009121088.1| PREDICTED: prolyl 4-hydroxylase 5-like [Brassica rapa]
Length=293

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IE+RI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  145  DEVVERIEQRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWN+L ECGK GLSV PK  DALL W+M+PD SLD
Sbjct  205  MYLSDVDDGGETVFPAAKGNISAVPWWNQLSECGKEGLSVLPKKRDALLFWNMRPDASLD  264

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  265  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  293



>ref|XP_006298248.1| hypothetical protein CARUB_v10014309mg [Capsella rubella]
 gb|EOA31146.1| hypothetical protein CARUB_v10014309mg [Capsella rubella]
Length=289

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  141  DEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  200

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  201  MYLSDVDDGGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  260

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  261  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  289



>ref|NP_179363.1| prolyl 4-hydroxylase 5 [Arabidopsis thaliana]
 sp|Q24JN5.1|P4H5_ARATH RecName: Full=Prolyl 4-hydroxylase 5; Flags: Precursor [Arabidopsis 
thaliana]
 pir||F84555 similar to prolyl 4-hydroxylase alpha subunit [imported] - Arabidopsis 
thaliana
 gb|ABD65585.1| At2g17720 [Arabidopsis thaliana]
 dbj|BAF01353.1| similar to prolyl 4-hydroxylase alpha subunit [Arabidopsis thaliana]
 gb|AEC06673.1| prolyl 4-hydroxylase 5 [Arabidopsis thaliana]
Length=291

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  143  DEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  202

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP A+GNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  203  MYLSDVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  262

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  263  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  291



>ref|XP_010266057.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Nelumbo nucifera]
Length=311

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            DKI+R+IE+RIA  TFIP EHGEGL +L YE+GQ YEPH+DYFLD++N KNGGQR+ATV 
Sbjct  163  DKIVRSIEERIAKSTFIPVEHGEGLHVLRYELGQMYEPHFDYFLDEFNPKNGGQRMATVL  222

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGNI AVPWWNEL EC K GLSVKPKMGDA+L WSMKPD +LD
Sbjct  223  MYLSDVEEGGETVFPDAKGNISAVPWWNELSECAKKGLSVKPKMGDAILFWSMKPDATLD  282

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            PSSLHG CPVIKG KWS  KWMRV EY+
Sbjct  283  PSSLHGACPVIKGTKWSCAKWMRVNEYQ  310



>ref|XP_010446875.1| PREDICTED: prolyl 4-hydroxylase 5-like [Camelina sativa]
Length=293

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            DK++ +IE RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIATV 
Sbjct  145  DKVVEDIENRISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATVL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGN+  VPWWNEL +CGK GLSV PK  DALL WS+KPD SLD
Sbjct  205  MYLSDVEEGGETVFPSAKGNVSDVPWWNELSQCGKTGLSVLPKKRDALLFWSIKPDASLD  264

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPVIKGNKWS TKW  V EYKA
Sbjct  265  PSSLHGGCPVIKGNKWSSTKWFHVHEYKA  293



>emb|CDY20811.1| BnaC07g06600D [Brassica napus]
Length=293

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IE+RI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  145  DEVVERIEQRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWN+L ECGK GLSV PK  DALL W+M+PD SLD
Sbjct  205  MYLSDVDDGGETVFPAAKGNISAVPWWNQLSECGKEGLSVLPKKRDALLFWNMRPDASLD  264

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  265  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  293



>gb|AAM65040.1| putative prolyl 4-hydroxylase, alpha subunit [Arabidopsis thaliana]
Length=291

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  143  DEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  202

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP A+GNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  203  MYLSDVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKXRDALLFWNMRPDASLD  262

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  263  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  291



>emb|CDY24364.1| BnaA07g02890D [Brassica napus]
Length=293

 Score =   256 bits (655),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IE+RI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  145  DEVVERIEQRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWN+L ECGK GLSV PK  DALL W+M+PD SLD
Sbjct  205  MYLSDVDDGGETVFPAAKGNISAVPWWNQLSECGKEGLSVLPKKRDALLFWNMRPDASLD  264

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  265  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  293



>ref|XP_010266056.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Nelumbo nucifera]
Length=309

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DK++R+IEKRIADF+FIP EHGEGLQIL YE+GQKYEPH+DYF+D+ NTKNGG R+AT+
Sbjct  160  QDKVVRSIEKRIADFSFIPVEHGEGLQILRYELGQKYEPHFDYFVDELNTKNGGNRMATL  219

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP  KGNI AVPWWNEL  CGK GLSVKPKMGDA+L WSMKPD +L
Sbjct  220  LMYLSDVEEGGETVFPNVKGNISAVPWWNELSACGKRGLSVKPKMGDAILFWSMKPDATL  279

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHG CPVIKG KWS  KWM V EYK 
Sbjct  280  DPLSLHGACPVIKGTKWSCAKWMHVNEYKV  309



>ref|XP_010489402.1| PREDICTED: prolyl 4-hydroxylase 5 [Camelina sativa]
Length=291

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  143  DEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  202

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  203  MYLSDVDDGGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  262

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  263  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  291



>ref|XP_010514697.1| PREDICTED: prolyl 4-hydroxylase 5-like [Camelina sativa]
Length=291

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  143  DEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  202

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  203  MYLSDVDDGGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  262

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  263  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  291



>ref|XP_010467565.1| PREDICTED: prolyl 4-hydroxylase 5 [Camelina sativa]
Length=291

 Score =   256 bits (653),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  143  DEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  202

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP AKGNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  203  MYLSDVDDGGETVFPAAKGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  262

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  263  PSSLHGGCPVVKGNKWSSTKWYHVHEFKV  291



>ref|XP_002884079.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60338.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=291

 Score =   256 bits (653),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+++  IEKRI+DFTFIP E+GEGLQ+LHY+VGQKYEPHYDYFLD++NTKNGGQRIATV 
Sbjct  143  DEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDEFNTKNGGQRIATVL  202

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV++GGETVFP A+GNI AVPWWNEL +CGK GLSV PK  DALL W+M+PD SLD
Sbjct  203  MYLSDVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDASLD  262

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPV+KGNKWS TKW  V E+K 
Sbjct  263  PSSLHGGCPVVKGNKWSSTKWFHVHEFKV  291



>ref|XP_009397948.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=288

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII  IEKRIAD+TFIP EHGEGLQ+LHYEVGQKY+PHYDYF D++NTKNGGQRIAT+
Sbjct  139  KDKIICAIEKRIADYTFIPVEHGEGLQVLHYEVGQKYDPHYDYFNDEFNTKNGGQRIATL  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP  K N  ++PW+NEL +C K  LSVKPKMGDALL WSM+PD + 
Sbjct  199  LMYLSDVEEGGETVFPSVKVNSSSLPWYNELSDCAKQCLSVKPKMGDALLFWSMRPDATP  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKWMR+ EY+A
Sbjct  259  DPSSLHGGCPVIKGNKWSSTKWMRMHEYRA  288



>ref|XP_010437420.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X2 [Camelina sativa]
Length=289

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
             D+I+ +IE RI+DFTFIP E+GEGL +LHYEVGQKYEPH+DYF D++NT+ GGQRIATV
Sbjct  140  HDEIVEDIENRISDFTFIPIENGEGLHVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN+  VPWW+EL ECGK GLSV PK  DALL WSMKPD SL
Sbjct  200  LMYLSDVEEGGETVFPSAKGNVSDVPWWDELSECGKTGLSVLPKKRDALLFWSMKPDASL  259

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW  V EYKA
Sbjct  260  DPSSLHGGCPVIKGNKWSSTKWFHVHEYKA  289



>ref|XP_010437419.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Camelina sativa]
Length=290

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
             D+I+ +IE RI+DFTFIP E+GEGL +LHYEVGQKYEPH+DYF D++NT+ GGQRIATV
Sbjct  141  HDEIVEDIENRISDFTFIPIENGEGLHVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATV  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN+  VPWW+EL ECGK GLSV PK  DALL WSMKPD SL
Sbjct  201  LMYLSDVEEGGETVFPSAKGNVSDVPWWDELSECGKTGLSVLPKKRDALLFWSMKPDASL  260

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW  V EYKA
Sbjct  261  DPSSLHGGCPVIKGNKWSSTKWFHVHEYKA  290



>ref|XP_003629237.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03713.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
 gb|AFK44766.1| unknown [Medicago truncatula]
 gb|AFK46234.1| unknown [Medicago truncatula]
Length=275

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+ NIEKRIADFTFIP EHGE   +LHYEVGQKYEPHYDYFLD ++T++ GQRIAT+ 
Sbjct  129  DEIVSNIEKRIADFTFIPVEHGESFNVLHYEVGQKYEPHYDYFLDTFSTRHAGQRIATML  188

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGKGGLS+KPKMG+A+L WSMKPD +LD
Sbjct  189  MYLSDVEEGGETVFPNAKGNFSSVPWWNELSDCGKGGLSIKPKMGNAILFWSMKPDATLD  248

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREY  252
            PSSLHG CPVIKG+KWS  KWM   EY
Sbjct  249  PSSLHGACPVIKGDKWSCAKWMHADEY  275



>ref|XP_010432225.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X3 [Camelina sativa]
Length=294

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+ +IE RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIAT+ 
Sbjct  146  DEIVEDIENRISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATLL  205

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGN+  VPWW+EL +CGK GLSV PK  DALL WSMKPD +LD
Sbjct  206  MYLSDVEEGGETVFPSAKGNVSDVPWWDELSQCGKTGLSVLPKKRDALLFWSMKPDAALD  265

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPVIKGNKWS TKW  V EYKA
Sbjct  266  PSSLHGGCPVIKGNKWSSTKWFHVHEYKA  294



>ref|XP_010432226.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X4 [Camelina sativa]
Length=293

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+ +IE RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIAT+ 
Sbjct  145  DEIVEDIENRISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATLL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGN+  VPWW+EL +CGK GLSV PK  DALL WSMKPD +LD
Sbjct  205  MYLSDVEEGGETVFPSAKGNVSDVPWWDELSQCGKTGLSVLPKKRDALLFWSMKPDAALD  264

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLHGGCPVIKGNKWS TKW  V EYKA
Sbjct  265  PSSLHGGCPVIKGNKWSSTKWFHVHEYKA  293



>ref|XP_008456352.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
 ref|XP_008456362.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
 ref|XP_008456370.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
melo]
Length=284

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII NIEKRIADFTFIP EHGE +QILHY VGQKY+ HYD+F+D+YN K+ GQR+AT+
Sbjct  136  QDKIISNIEKRIADFTFIPIEHGEDIQILHYAVGQKYDAHYDFFVDEYNLKSVGQRMATL  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL ECGK GLS+KPKMGDALL WSMKPD +L
Sbjct  196  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSECGKSGLSIKPKMGDALLFWSMKPDTTL  255

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP+SLHG CPVI+GNKWS TKW+ V +Y
Sbjct  256  DPTSLHGACPVIRGNKWSCTKWIHVNKY  283



>ref|XP_004167095.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cucumis 
sativus]
Length=249

 Score =   251 bits (642),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKI+ NIEKRIADFTFIP EHGEGLQILHYEVGQKY+ HYD+F D++N K  GQR+AT+
Sbjct  101  QDKIVSNIEKRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDFFDDEFNLKEIGQRMATL  160

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  161  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSKCGKGGLSVKPKMGDALLFWSMKPDTTL  220

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVRE  255
            DP+SLHG CPVI+GNKWS TKW+ V +
Sbjct  221  DPTSLHGACPVIRGNKWSCTKWIHVNQ  247



>gb|KHG08442.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum]
Length=296

 Score =   253 bits (646),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 2/147 (1%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII +IEKRIA+++FIP EHGEGLQ+LHYEVGQKYEPH+DYF+D+YNT++GGQR+AT 
Sbjct  137  QDKIISDIEKRIAEYSFIPIEHGEGLQVLHYEVGQKYEPHFDYFVDEYNTRHGGQRMAT-  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             M +SDVEEGGET+FP AKGNI AVPWW+EL ECGKGGL+VKPKMGDALL WSMKPD ++
Sbjct  196  -MLMSDVEEGGETIFPNAKGNISAVPWWDELSECGKGGLAVKPKMGDALLFWSMKPDATV  254

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVRE  255
            DPSSLHGGCPVI G+KWS TKWM V E
Sbjct  255  DPSSLHGGCPVIVGDKWSSTKWMHVNE  281



>ref|XP_009392830.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392831.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=301

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRI+D+TFIP E+GEGLQ+LHYEVGQKYEPH+DYFLD++NT NGGQR+AT+
Sbjct  152  QDKIIRVIEKRISDYTFIPVENGEGLQVLHYEVGQKYEPHFDYFLDEFNTMNGGQRMATL  211

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AK N  ++P +NEL ECGK G+SV+PKMGDALL WSMKPD +L
Sbjct  212  LMYLSDVEEGGETIFPNAKINSSSLPLYNELSECGKKGISVRPKMGDALLFWSMKPDATL  271

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVI+GNKWS TKWM V EYK 
Sbjct  272  DPLSLHGGCPVIRGNKWSSTKWMHVHEYKV  301



>ref|XP_009418644.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=301

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 130/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DK IR IEKRIA++TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YN KNGGQRIAT+
Sbjct  152  QDKTIRAIEKRIAEYTFIPIEHGEGLQVLHYEVGQKYEPHFDYFLDEYNAKNGGQRIATL  211

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AK +  ++ W NEL +CG+ GLS+KPKMGDALL WSMKPD SL
Sbjct  212  LMYLSDVEEGGETIFPDAKISSRSLSWSNELSKCGEKGLSIKPKMGDALLFWSMKPDASL  271

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHGGCPVIKGNKWS TKWM V EYK 
Sbjct  272  DPLSLHGGCPVIKGNKWSCTKWMHVHEYKV  301



>gb|EEE51215.1| hypothetical protein OsJ_32038 [Oryza sativa Japonica Group]
Length=222

 Score =   248 bits (633),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRI+D+TFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NTKNGGQRIAT+
Sbjct  73   QDKIIRTIEKRISDYTFIPVENGEGLQVLHYEVGQKYEPHFDYFHDEFNTKNGGQRIATL  132

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP +K N  + P++NEL EC K GL+VKPKMGDALL WSM+PDGSL
Sbjct  133  LMYLSDVEEGGETIFPSSKANSSSSPFYNELSECAKKGLAVKPKMGDALLFWSMRPDGSL  192

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            D +SLHGGCPVIKGNKWS TKWMRV EYK
Sbjct  193  DATSLHGGCPVIKGNKWSSTKWMRVHEYK  221



>ref|XP_010446308.1| PREDICTED: probable prolyl 4-hydroxylase 10 [Camelina sativa]
Length=178

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  647  FIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEGGETVFP  468
              PAEHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV MYLSDVEEGGETVFP
Sbjct  45   IFPAEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSDVEEGGETVFP  104

Query  467  XAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCPVIKGNK  288
             AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +LDPSSLHGGC VIKGNK
Sbjct  105  AAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGCAVIKGNK  164

Query  287  WSXTKWMRVREYKA  246
            WS TKW+RV EYK 
Sbjct  165  WSSTKWLRVHEYKV  178


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  503  SDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLS  396
            SDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLS
Sbjct  7    SDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLS  42



>ref|NP_001064962.1| Os10g0497800 [Oryza sativa Japonica Group]
 gb|ABB47828.1| prolyl 4-hydroxylase alpha subunit, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26876.1| Os10g0497800 [Oryza sativa Japonica Group]
 dbj|BAH00081.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67248.1| hypothetical protein OsI_34188 [Oryza sativa Indica Group]
Length=321

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRI+D+TFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NTKNGGQRIAT+
Sbjct  172  QDKIIRTIEKRISDYTFIPVENGEGLQVLHYEVGQKYEPHFDYFHDEFNTKNGGQRIATL  231

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP +K N  + P++NEL EC K GL+VKPKMGDALL WSM+PDGSL
Sbjct  232  LMYLSDVEEGGETIFPSSKANSSSSPFYNELSECAKKGLAVKPKMGDALLFWSMRPDGSL  291

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            D +SLHGGCPVIKGNKWS TKWMRV EYK
Sbjct  292  DATSLHGGCPVIKGNKWSSTKWMRVHEYK  320



>gb|EYU17561.1| hypothetical protein MIMGU_mgv1a0210091mg, partial [Erythranthe 
guttata]
Length=193

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
             D +I  IEKRIAD++ IP EHGEG+Q+LHYEVGQKYEPHYDYFLD+++TKNG QR+AT+
Sbjct  46   HDSVIGAIEKRIADYSQIPLEHGEGIQVLHYEVGQKYEPHYDYFLDEFHTKNGDQRVATL  105

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  ++P WNE+ EC K GLSVKPKMGDALL WS+KPD +L
Sbjct  106  LMYLSDVEEGGETVFPVAKGNFSSLPGWNEMSECAKKGLSVKPKMGDALLFWSLKPDATL  165

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DPSSLHG CPVI+GNKWS TKWM + EY
Sbjct  166  DPSSLHGACPVIRGNKWSATKWMHLHEY  193



>emb|CDX69169.1| BnaC01g02840D [Brassica napus]
Length=292

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+R IE +I+DFTFIP E+GE LQ+LHYEVGQKYEPH+DYF D+ N K GGQR+ATV 
Sbjct  144  DEIVREIENKISDFTFIPVENGESLQVLHYEVGQKYEPHHDYFTDELNVKRGGQRVATVL  203

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSD++EGGETVFP AKGNI  VPWWNEL +CGK GLSV PK  DALL WSM+PDGSLD
Sbjct  204  MYLSDIDEGGETVFPLAKGNISDVPWWNELSQCGKEGLSVLPKKRDALLFWSMRPDGSLD  263

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            PSSLHGGCPVIKGNKWS TKW+ V EY+
Sbjct  264  PSSLHGGCPVIKGNKWSSTKWLHVHEYR  291



>gb|KCW70504.1| hypothetical protein EUGRSUZ_F03711 [Eucalyptus grandis]
Length=284

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKI+R IEKRIADFT IP EHGEGLQIL Y  GQKY+ H+DYF D +NT+NGGQR+AT+
Sbjct  135  QDKIVRAIEKRIADFTHIPVEHGEGLQILQYGHGQKYDAHHDYFSDSFNTRNGGQRMATM  194

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  AVPWWNEL ECGK GLSVKPKMG+A+L WSMKPDG+L
Sbjct  195  LMYLSDVEEGGETVFPAAKANFSAVPWWNELSECGKRGLSVKPKMGNAVLFWSMKPDGTL  254

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DP+SLHG CPVIKG KWS  KWMRV+ Y+
Sbjct  255  DPTSLHGACPVIKGTKWSAPKWMRVQNYR  283



>gb|KJB43228.1| hypothetical protein B456_007G190600 [Gossypium raimondii]
Length=266

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIRNIE+RIADFTFIP EHGEGLQ+LHYEVGQKYEPH+DYF+D++NTKNGGQRIATV
Sbjct  140  RDKIIRNIEQRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFMDEFNTKNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPSAKGNISAVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHG  315
            DPSSLHG
Sbjct  260  DPSSLHG  266



>ref|XP_010935631.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Elaeis guineensis]
Length=297

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            ++KII++IEKRIAD+TFIP EHGEGLQ+LHY VGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  148  QNKIIQDIEKRIADYTFIPVEHGEGLQVLHYGVGQKYEPHFDYFLDEFNTKNGGQRMATL  207

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP  K N  ++P +NEL ECGK GLSVKPKMGDALL WSMKPD  +
Sbjct  208  LMYLSDVEEGGETVFPSVKVNSSSLPSYNELSECGKKGLSVKPKMGDALLFWSMKPDAVV  267

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHG CPVIKGNKWS TKWM + +Y+A
Sbjct  268  DPLSLHGACPVIKGNKWSCTKWMHIHKYEA  297



>ref|XP_008802391.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X2 [Phoenix 
dactylifera]
Length=303

 Score =   248 bits (633),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII+ IEKRIAD+TFIP EHGEGLQ+LHY VGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  154  QDKIIQYIEKRIADYTFIPVEHGEGLQVLHYGVGQKYEPHFDYFLDEFNTKNGGQRMATL  213

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP  K N  ++P +NEL ECGK GLSVKPKMGDALL WSMKPD  +
Sbjct  214  LMYLSDVEEGGETIFPSVKVNSSSLPSYNELSECGKKGLSVKPKMGDALLFWSMKPDAIV  273

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHG CPVIKGNKWS TKWM + EY+ 
Sbjct  274  DPLSLHGACPVIKGNKWSCTKWMHIHEYEV  303



>emb|CDX75528.1| BnaA01g01740D [Brassica napus]
Length=292

 Score =   248 bits (632),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+R IE +I+DFTFIP E+GE LQ+LHYEVGQKYEPH+DYF D++N K GGQR+ATV 
Sbjct  144  DEIVREIENKISDFTFIPVENGESLQVLHYEVGQKYEPHHDYFTDEFNVKRGGQRVATVL  203

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLS+VEEGGETVFP AKGNI  VPWWNEL +CGK GLSV PK  DALL WSM+PDGSLD
Sbjct  204  MYLSEVEEGGETVFPLAKGNISDVPWWNELSQCGKEGLSVLPKKRDALLFWSMRPDGSLD  263

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREY  252
            PSSLHGGCPVI+GNKWS TKW+   EY
Sbjct  264  PSSLHGGCPVIRGNKWSSTKWLHAHEY  290



>ref|XP_008802369.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802377.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802385.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X1 [Phoenix 
dactylifera]
Length=306

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII+ IEKRIAD+TFIP EHGEGLQ+LHY VGQKYEPH+DYFLD++NTKNGGQR+AT+
Sbjct  157  QDKIIQYIEKRIADYTFIPVEHGEGLQVLHYGVGQKYEPHFDYFLDEFNTKNGGQRMATL  216

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP  K N  ++P +NEL ECGK GLSVKPKMGDALL WSMKPD  +
Sbjct  217  LMYLSDVEEGGETIFPSVKVNSSSLPSYNELSECGKKGLSVKPKMGDALLFWSMKPDAIV  276

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP SLHG CPVIKGNKWS TKWM + EY+ 
Sbjct  277  DPLSLHGACPVIKGNKWSCTKWMHIHEYEV  306



>ref|XP_003629236.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03712.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=326

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I++NIE+RIADFTFIP EHGE   +LHYEVGQKYEPHYDYF+D ++T   GQRIAT+ 
Sbjct  178  DRIVKNIERRIADFTFIPVEHGENFNVLHYEVGQKYEPHYDYFMDTFSTTYAGQRIATML  237

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGKGGLS+KPKMG+A+L WSMKPD +LD
Sbjct  238  MYLSDVEEGGETVFPNAKGNFSSVPWWNELSDCGKGGLSIKPKMGNAILFWSMKPDATLD  297

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            PSSLHG CPVIKG+KW   KWM V E+K
Sbjct  298  PSSLHGACPVIKGDKWLCAKWMHVGEFK  325



>ref|XP_002869059.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45318.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=290

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+  IE RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++N + GGQRIATV 
Sbjct  143  DEIVEEIENRISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNVRKGGQRIATVL  202

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV+EGGETVFP AKGNI  VPWW+EL +CGK GLSV PK  DALL WSMKPD SLD
Sbjct  203  MYLSDVDEGGETVFPAAKGNISDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLD  262

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREY  252
            PSSLHGGCPVIKGNKWS TKW  V EY
Sbjct  263  PSSLHGGCPVIKGNKWSSTKWFHVHEY  289



>ref|XP_010432223.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Camelina sativa]
Length=299

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 129/154 (84%), Gaps = 5/154 (3%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+ +IE RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIAT+ 
Sbjct  146  DEIVEDIENRISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATLL  205

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGN+  VPWW+EL +CGK GLSV PK  DALL WSMKPD +LD
Sbjct  206  MYLSDVEEGGETVFPSAKGNVSDVPWWDELSQCGKTGLSVLPKKRDALLFWSMKPDAALD  265

Query  332  PSSLH-----GGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLH     GGCPVIKGNKWS TKW  V EYKA
Sbjct  266  PSSLHGERERGGCPVIKGNKWSSTKWFHVHEYKA  299



>ref|XP_010432224.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X2 [Camelina sativa]
Length=298

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 129/154 (84%), Gaps = 5/154 (3%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+ +IE RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NT+ GGQRIAT+ 
Sbjct  145  DEIVEDIENRISDFTFIPIENGEGLQVLHYEVGQKYEPHHDYFFDEFNTRKGGQRIATLL  204

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGN+  VPWW+EL +CGK GLSV PK  DALL WSMKPD +LD
Sbjct  205  MYLSDVEEGGETVFPSAKGNVSDVPWWDELSQCGKTGLSVLPKKRDALLFWSMKPDAALD  264

Query  332  PSSLH-----GGCPVIKGNKWSXTKWMRVREYKA  246
            PSSLH     GGCPVIKGNKWS TKW  V EYKA
Sbjct  265  PSSLHGERERGGCPVIKGNKWSSTKWFHVHEYKA  298



>emb|CDY24822.1| BnaA08g14880D [Brassica napus]
Length=293

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+I+  IE RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D+YN K GG RIATV
Sbjct  144  QDEIVEEIENRISDFTFIPVENGEGLQVLHYEVGQKYEPHHDYFSDEYNVKRGGNRIATV  203

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI  VPWWNEL +CG+ GLSV PK  DALL WS +PD SL
Sbjct  204  LMYLSDVEEGGETVFPAAKGNISDVPWWNELSQCGREGLSVLPKKRDALLFWSARPDASL  263

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW    EY A
Sbjct  264  DPSSLHGGCPVIKGNKWSSTKWFHFNEYTA  293



>ref|XP_009109263.1| PREDICTED: prolyl 4-hydroxylase 5-like [Brassica rapa]
Length=292

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+I+  IE RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D+YN K GG RIATV
Sbjct  143  QDEIVEEIENRISDFTFIPVENGEGLQVLHYEVGQKYEPHHDYFSDEYNVKRGGNRIATV  202

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI  VPWWNEL +CG+ GLSV PK  DALL WS +PD SL
Sbjct  203  LMYLSDVEEGGETVFPAAKGNISDVPWWNELSQCGREGLSVLPKKRDALLFWSARPDASL  262

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHGGCPVIKGNKWS TKW    EY A
Sbjct  263  DPSSLHGGCPVIKGNKWSSTKWFHFNEYTA  292



>ref|NP_195306.2| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AEE86574.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=290

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+  IE RI+DFTFIP E+GEGLQ+LHYEVGQ+YEPH+DYF D++N + GGQRIATV 
Sbjct  143  DEIVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEFNVRKGGQRIATVL  202

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV+EGGETVFP AKGN+  VPWW+EL +CGK GLSV PK  DALL WSMKPD SLD
Sbjct  203  MYLSDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLD  262

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREY  252
            PSSLHGGCPVIKGNKWS TKW  V EY
Sbjct  263  PSSLHGGCPVIKGNKWSSTKWFHVHEY  289



>ref|XP_002978409.1| hypothetical protein SELMODRAFT_418273 [Selaginella moellendorffii]
 gb|EFJ20395.1| hypothetical protein SELMODRAFT_418273 [Selaginella moellendorffii]
Length=256

 Score =   244 bits (624),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+II  IE+RIA FTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D  NTKNGGQR+ATV
Sbjct  108  QDEIISRIEERIAKFTFIPKEHGEGLQVLHYEVGQKYDAHHDYFHDKVNTKNGGQRVATV  167

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  +VPWW+EL ECGK G+SVKP+ GDALL WSM PD  L
Sbjct  168  LMYLSDVEEGGETVFPSAKVNSSSVPWWDELSECGKKGVSVKPRKGDALLFWSMSPDAEL  227

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP SLHGGCPVIKGNKWS TKWM +REY
Sbjct  228  DPFSLHGGCPVIKGNKWSATKWMHLREY  255



>ref|XP_002970251.1| hypothetical protein SELMODRAFT_411114 [Selaginella moellendorffii]
 gb|EFJ28381.1| hypothetical protein SELMODRAFT_411114 [Selaginella moellendorffii]
Length=256

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+II  IE+RIA FTFIP EHGEGLQ+LHYEVGQKY+ H+DYF D  NTKNGGQR+ATV
Sbjct  108  QDEIISRIEERIAKFTFIPKEHGEGLQVLHYEVGQKYDAHHDYFHDKVNTKNGGQRVATV  167

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AK N  +VPWW+EL EC K G+SVKP+ GDALL WSM PD  L
Sbjct  168  LMYLSDVEEGGETVFPSAKVNSSSVPWWDELSECAKKGVSVKPRKGDALLFWSMSPDAEL  227

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP SLHGGCPVIKGNKWS TKWM +REY
Sbjct  228  DPFSLHGGCPVIKGNKWSATKWMHLREY  255



>ref|XP_002866777.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43036.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  139  RDKTIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  199  LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL  258

Query  335  DPSSLHG  315
            DPSSLHG
Sbjct  259  DPSSLHG  265



>dbj|BAB10411.1| prolyl 4-hydroxylase, alpha subunit-like protein [Arabidopsis 
thaliana]
Length=267

 Score =   242 bits (617),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK IR IEKRI+DFTFIP EHGEGLQ+LHYE+GQKYEPHYDYF+D+YNT+NGGQRIATV
Sbjct  140  RDKTIREIEKRISDFTFIPVEHGEGLQVLHYEIGQKYEPHYDYFMDEYNTRNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  AVPWWNEL ECGKGGLSVKPKMGDALL WSM PD +L
Sbjct  200  LMYLSDVEEGGETVFPAAKGNYSAVPWWNELSECGKGGLSVKPKMGDALLFWSMTPDATL  259

Query  335  DPSSLHG  315
            DPSSLHG
Sbjct  260  DPSSLHG  266



>dbj|BAE92293.1| putative prolyl 4-hydroxylase, alpha subunit [Cryptomeria japonica]
Length=302

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRIADF+ IP EHGEGL +LHYEV QKY+ HYDYF D  N KNGGQR AT+
Sbjct  153  QDKIIRRIEKRIADFSHIPVEHGEGLHVLHYEVEQKYDAHYDYFSDTINVKNGGQRGATM  212

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVE+GGETVFP +K N  +VPWW+EL ECG+ GLSV+PKMGDALL WS+KPD SL
Sbjct  213  LMYLSDVEKGGETVFPQSKVNSSSVPWWDELSECGRSGLSVRPKMGDALLFWSVKPDASL  272

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLHG CPVI+GNKWS TKWMR+ +Y  
Sbjct  273  DPSSLHGSCPVIQGNKWSATKWMRLNKYSV  302



>ref|XP_009149485.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Brassica rapa]
 ref|XP_009149555.1| PREDICTED: prolyl 4-hydroxylase 5-like isoform X1 [Brassica rapa]
Length=292

 Score =   241 bits (614),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I++ IE +I+DFTFIP E+GE LQ+LHYEVGQKYEPH+DYF D++N K GGQR+ATV 
Sbjct  144  DEIVKEIEDKISDFTFIPVENGESLQVLHYEVGQKYEPHHDYFTDEFNVKRGGQRVATVL  203

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLS+VEEGGETVFP AKGNI  VPWWNEL +CGK GLSV PK  DALL WS +P GSLD
Sbjct  204  MYLSEVEEGGETVFPLAKGNISDVPWWNELSQCGKEGLSVLPKKRDALLFWSRRPHGSLD  263

Query  332  PSSLHGGCPVIKGNKWSXTKWMRVREY  252
            PSSLHGGCPVI+GNKWS TKW+   EY
Sbjct  264  PSSLHGGCPVIRGNKWSSTKWLHAHEY  290



>ref|XP_004982729.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Setaria 
italica]
Length=308

 Score =   241 bits (614),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  659  ADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEGGE  480
            AD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYF DDYNTKNGGQRIAT+ MYLSDVE+GGE
Sbjct  171  ADYTFIPVEHGEGLQVLHYEVGQKYEPHFDYFHDDYNTKNGGQRIATLLMYLSDVEDGGE  230

Query  479  TVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCPVI  300
            TVFP A  N  + P+++EL  C K GLSVKPKMGDALL WSMKPDGSLDP+SLHGGCPVI
Sbjct  231  TVFPSATVNSSSSPFYSELSACAKRGLSVKPKMGDALLFWSMKPDGSLDPTSLHGGCPVI  290

Query  299  KGNKWSXTKWMRVREYK  249
            KGNKWS TKWMRV EYK
Sbjct  291  KGNKWSSTKWMRVHEYK  307



>ref|XP_006425362.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
 gb|ESR38602.1| hypothetical protein CICLE_v10026208mg [Citrus clementina]
Length=265

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF+P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  139  RDKIIRDIEKRIADFTFLPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD SL
Sbjct  199  LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASL  258

Query  335  DPSSLHG  315
            DPSSLHG
Sbjct  259  DPSSLHG  265



>ref|XP_003520105.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Glycine 
max]
Length=296

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKI+RNIE RIADFTFIP ++GE LQ+LHY+VG+KY PH+DYF+DD NT NGG RIAT+
Sbjct  147  RDKIVRNIENRIADFTFIPVDNGEELQVLHYQVGEKYVPHHDYFMDDINTANGGDRIATM  206

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  ++P WNEL  CGK GLS+KPKM +ALL WS+KPD + 
Sbjct  207  LMYLSDVEEGGETVFPDAKGNFSSMPGWNELSVCGKKGLSIKPKMRNALLFWSIKPDATY  266

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            DP SLHG CPVIKGNKWS TKW+R+ E+K
Sbjct  267  DPLSLHGSCPVIKGNKWSSTKWIRIGEHK  295



>gb|KDO71356.1| hypothetical protein CISIN_1g023009mg [Citrus sinensis]
Length=265

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKIIR+IEKRIADFTF P E+GEGLQ+LHYE GQKYEPH+DYF+D++NTKNGGQR+ATV
Sbjct  139  RDKIIRDIEKRIADFTFFPLENGEGLQVLHYEAGQKYEPHFDYFMDEFNTKNGGQRMATV  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+GNI AVPWWNEL ECGK GLS+KPKMGDALL WSMKPD SL
Sbjct  199  LMYLSDVEEGGETVFPNAQGNISAVPWWNELSECGKTGLSIKPKMGDALLFWSMKPDASL  258

Query  335  DPSSLHG  315
            DPSSLHG
Sbjct  259  DPSSLHG  265



>ref|XP_003520111.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Glycine 
max]
Length=286

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+I+RNIEKRIAD TFIP E+GE + ++HYEVGQ Y+PHYDYF+DD+N +NGGQRIAT+
Sbjct  136  QDEIVRNIEKRIADVTFIPIENGEPIYVIHYEVGQYYDPHYDYFIDDFNIENGGQRIATM  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLS+VEEGGET+FP AK N  +VPWWNEL  CGK GLS+KPKMGDALL WSMKP+ +L
Sbjct  196  LMYLSNVEEGGETMFPRAKANFSSVPWWNELSNCGKMGLSIKPKMGDALLFWSMKPNATL  255

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            D  +LH  CPVIKGNKWS TKWM   E+K
Sbjct  256  DALTLHSACPVIKGNKWSCTKWMHPTEFK  284



>gb|KJB48236.1| hypothetical protein B456_008G061800 [Gossypium raimondii]
Length=266

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII++IEKRIADFTFIP EHGEGLQ+LHYEVGQKYEPHYDYF D+ NT+NGGQRIATV
Sbjct  140  RDKIIKSIEKRIADFTFIPVEHGEGLQVLHYEVGQKYEPHYDYFKDEVNTRNGGQRIATV  199

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI AVPWWNEL ECGKGGLSV+PKMGDALL WSMKPD +L
Sbjct  200  LMYLSDVEEGGETVFPSAKGNISAVPWWNELSECGKGGLSVRPKMGDALLFWSMKPDATL  259

Query  335  DPSSLHG  315
            D SSLHG
Sbjct  260  DLSSLHG  266



>ref|XP_007017903.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY15128.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 2 [Theobroma cacao]
Length=260

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  638  AEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEGGETVFPXAK  459
            +EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+ MYLSDVEEGGET+FP AK
Sbjct  130  SEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATMLMYLSDVEEGGETIFPAAK  189

Query  458  GNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCPVIKGNKWSX  279
            GN  AVPWWNEL ECGK GLSVKPKMGDALL WSM+PD +LDPSSLHGGCPVI GNKWS 
Sbjct  190  GNFSAVPWWNELSECGKQGLSVKPKMGDALLFWSMRPDATLDPSSLHGGCPVIMGNKWSS  249

Query  278  TKWMRVREYKA  246
            TKW+ V EYK 
Sbjct  250  TKWIHVEEYKV  260



>ref|XP_001754091.1| predicted protein [Physcomitrella patens]
 gb|EDQ80992.1| predicted protein, partial [Physcomitrella patens]
Length=214

 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D +I+ IEKRIADFTFIPAE GEGLQ+L Y+  +KYEPHYDYF D YNTKNGGQRIATV
Sbjct  65   QDPVIKRIEKRIADFTFIPAEQGEGLQVLQYKESEKYEPHYDYFHDAYNTKNGGQRIATV  124

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLS+VEEGGETVFP A+ N   VP W++L EC + GLSV+P+MGDALL WSMKPD +L
Sbjct  125  LMYLSNVEEGGETVFPAAQVNKTEVPDWDKLSECAQKGLSVRPRMGDALLFWSMKPDATL  184

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D +SLHGGCPVIKG KWS TKW+ V  Y A
Sbjct  185  DSTSLHGGCPVIKGTKWSATKWLHVENYAA  214



>ref|XP_003629231.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
 gb|AET03707.1| prolyl 4-hydroxylase alpha-like protein [Medicago truncatula]
Length=279

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            DKI+ +IEKRIADFTFIP EHGE + ILHYEVGQKY+ H DYF D+ NTK+GG+RIAT+ 
Sbjct  133  DKILSDIEKRIADFTFIPVEHGEDVNILHYEVGQKYDFHTDYFEDEVNTKHGGERIATML  192

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGETVFP AKGN  +VPWWNEL +CGK GLS+KPKMG+A+L W MKPD ++D
Sbjct  193  MYLSDVEEGGETVFPSAKGNFSSVPWWNELSDCGKKGLSIKPKMGNAILFWGMKPDATVD  252

Query  332  PSSLHGGCPVIKGNKWSXTKWMRV  261
            P S+HG CPVIKG+KWS TKWMRV
Sbjct  253  PLSVHGACPVIKGDKWSCTKWMRV  276



>gb|AGP04974.1| prolyl-4-hydroxylase 5 [Physcomitrella patens]
Length=280

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D +I+ IEKRIADFTFIPAE GEGLQ+L Y+  +KYEPHYDYF D YNTKNGGQRIATV
Sbjct  131  QDPVIKRIEKRIADFTFIPAEQGEGLQVLQYKESEKYEPHYDYFHDAYNTKNGGQRIATV  190

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLS+VEEGGETVFP A+ N   VP W++L EC + GLSV+P+MGDALL WSMKPD +L
Sbjct  191  LMYLSNVEEGGETVFPAAQVNKTEVPDWDKLSECAQKGLSVRPRMGDALLFWSMKPDATL  250

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            D +SLHGGCPVIKG KWS TKW+ V  Y A
Sbjct  251  DSTSLHGGCPVIKGTKWSATKWLHVENYAA  280



>gb|AGP04976.1| prolyl-4-hydroxylase 6_b [Physcomitrella patens]
Length=283

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D II+ IEKRIADFTFIP E GEGLQ+L Y   +KYEPHYDYF D +NTKNGGQRIATV
Sbjct  133  QDHIIKRIEKRIADFTFIPVEQGEGLQVLQYRESEKYEPHYDYFHDAFNTKNGGQRIATV  192

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVE+GGETVFP +K N   VP W++  EC K GLSV+P+MGDALL WSMKPD  L
Sbjct  193  LMYLSDVEKGGETVFPASKVNASEVPDWDQRSECAKRGLSVRPRMGDALLFWSMKPDAKL  252

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP+SLHG CPVI+G KWS TKW+ V +Y A
Sbjct  253  DPTSLHGACPVIQGTKWSATKWLHVEKYAA  282



>ref|XP_007017904.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 3 [Theobroma cacao]
 gb|EOY15129.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 3 [Theobroma cacao]
Length=284

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR+IEKRIAD+TFIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+
Sbjct  138  QDKIIRDIEKRIADYTFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATM  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGN  AVPWWNEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETIFPAAKGNFSAVPWWNELSECGKQGLSVKPKMGDALLFWSMRPDATL  257

Query  335  DPSSLHG  315
            DPSSLHG
Sbjct  258  DPSSLHG  264



>ref|XP_001782374.1| predicted protein [Physcomitrella patens]
 gb|EDQ52828.1| predicted protein, partial [Physcomitrella patens]
Length=211

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D II+ IEKRIADFTFIP E GEGLQ+L Y   +KYEPHYDYF D +NTKNGGQRIATV
Sbjct  64   QDHIIKRIEKRIADFTFIPVEQGEGLQVLQYRESEKYEPHYDYFHDAFNTKNGGQRIATV  123

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVE+GGETVFP +K N   VP W++  EC K GLSV+P+MGDALL WSMKPD  L
Sbjct  124  LMYLSDVEKGGETVFPASKVNASEVPDWDQRSECAKRGLSVRPRMGDALLFWSMKPDAKL  183

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREY  252
            DP+SLHG CPVI+G KWS TKW+ V +Y
Sbjct  184  DPTSLHGACPVIQGTKWSATKWLHVEKY  211



>ref|XP_008456383.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like isoform 
X1 [Cucumis melo]
Length=290

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII NIEKRIADFTFIP EHGEGLQILHYEVGQKY+ HYDYF+D+YN K GGQR+AT+
Sbjct  136  QDKIISNIEKRIADFTFIPIEHGEGLQILHYEVGQKYDAHYDYFVDEYNIKKGGQRMATL  195

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGN  +VPWWNEL ECGKGGLSVKPKMGDALL WSMKPD +L
Sbjct  196  LMYLSDVEEGGETVFPAAKGNFSSVPWWNELSECGKGGLSVKPKMGDALLFWSMKPDATL  255

Query  335  DPSSLHG  315
            DP+SLHG
Sbjct  256  DPTSLHG  262



>ref|XP_006598732.1| PREDICTED: uncharacterized protein LOC100782154 isoform X1 [Glycine 
max]
 ref|XP_006598733.1| PREDICTED: uncharacterized protein LOC100782154 isoform X2 [Glycine 
max]
 gb|KHN35553.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja]
Length=295

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKI+RNIEKRIAD TFIP EHGE L ++ Y VGQ YEPH DYF ++++  NGGQRIAT+
Sbjct  146  KDKIVRNIEKRIADVTFIPIEHGEPLHVIRYAVGQYYEPHVDYFEEEFSLVNGGQRIATM  205

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLS+VE GGETVFP A  N  +VPWWNEL ECG+ GLS+KPKMGDALL WSMKPD +L
Sbjct  206  LMYLSNVEGGGETVFPIANANFSSVPWWNELSECGQTGLSIKPKMGDALLFWSMKPDATL  265

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP +LH  CPVIKGNKWS TKWM   EY+ 
Sbjct  266  DPLTLHRACPVIKGNKWSCTKWMHANEYET  295



>gb|KJB59734.1| hypothetical protein B456_009G269000 [Gossypium raimondii]
Length=294

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKII++IEKRIAD++FIP EHGEGLQ+LHYEVGQKY+ H+DYFLD++NTKNGGQR+AT+
Sbjct  138  QDKIIKDIEKRIADYSFIPVEHGEGLQVLHYEVGQKYDAHFDYFLDEFNTKNGGQRMATM  197

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP AKGNI +VPWWNEL ECGK GL+VKPKMGDALL WSM+PD +L
Sbjct  198  LMYLSDVEEGGETIFPAAKGNISSVPWWNELSECGKQGLAVKPKMGDALLFWSMRPDATL  257

Query  335  DPSSLHGGCP  306
            DPSSLHG  P
Sbjct  258  DPSSLHGLLP  267



>emb|CDY41627.1| BnaC03g62570D [Brassica napus]
Length=284

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 120/150 (80%), Gaps = 4/150 (3%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+I+  IE RI+DFTFIP E+GEGLQ+LHYEVGQKYEPH+DYF D+YN K GG RIATV
Sbjct  139  QDEIVEEIENRISDFTFIPVENGEGLQVLHYEVGQKYEPHHDYFSDEYNVKRGGNRIATV  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP AKGNI  VPWWNEL +CG+ GLSV PK  DALL WS +PD +L
Sbjct  199  LMYLSDVEEGGETVFPAAKGNISDVPWWNELSQCGREGLSVLPKKRDALLFWSARPDATL  258

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DPSSLH    VIKGNKWS TKW    EY A
Sbjct  259  DPSSLH----VIKGNKWSSTKWFHFNEYTA  284



>ref|XP_008809399.1| PREDICTED: probable prolyl 4-hydroxylase 3 isoform X3 [Phoenix 
dactylifera]
Length=267

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRIADFTFIP EHGEGLQILHYEVGQKYEPH+DYFLD++N KNGGQRIAT+
Sbjct  141  QDKIIRTIEKRIADFTFIPVEHGEGLQILHYEVGQKYEPHFDYFLDEFNIKNGGQRIATL  200

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A+ N  ++PW+NEL ECGK GLSVKPKMGDALL WSM+PD +L
Sbjct  201  LMYLSDVEEGGETVFPAARVNSSSLPWYNELSECGKKGLSVKPKMGDALLFWSMRPDATL  260

Query  335  DPSSLHG  315
            DPSSLHG
Sbjct  261  DPSSLHG  267



>gb|AGP04975.1| prolyl-4-hydroxylase 6_a [Physcomitrella patens]
Length=343

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D II+ IEKRIADFTFIP E GEGLQ+L Y   +KYEPHYDYF D +NTKNGGQRIATV
Sbjct  193  QDHIIKRIEKRIADFTFIPVEQGEGLQVLQYRESEKYEPHYDYFHDAFNTKNGGQRIATV  252

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVE+GGETVFP +K N   VP W++  EC K GLSV+P+MGDALL WSMKPD  L
Sbjct  253  LMYLSDVEKGGETVFPASKVNASEVPDWDQRSECAKRGLSVRPRMGDALLFWSMKPDAKL  312

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYKA  246
            DP+SLHG CPVI+G KWS TKW+ V +Y A
Sbjct  313  DPTSLHGACPVIQGTKWSATKWLHVEKYAA  342



>ref|XP_002989495.1| hypothetical protein SELMODRAFT_129912, partial [Selaginella 
moellendorffii]
 gb|EFJ09371.1| hypothetical protein SELMODRAFT_129912, partial [Selaginella 
moellendorffii]
Length=213

 Score =   224 bits (572),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D++I  IE +IA  TFIP +HGEG+Q+LHYE GQKY+ H+D+F D  NT+NGGQRIAT+
Sbjct  64   QDRVISEIEDKIAKLTFIPKDHGEGIQVLHYEPGQKYDAHHDFFYDTVNTRNGGQRIATL  123

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYL+DVEEGGETVFP +  N  ++PW N+L ECG+ G+SV+PK GDALL WSM PD  L
Sbjct  124  LMYLTDVEEGGETVFPKSAKNSSSLPWHNQLSECGRRGVSVRPKRGDALLFWSMSPDAQL  183

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            D SSLHGGCPVIKG+KWS TKWMRV EYK
Sbjct  184  DHSSLHGGCPVIKGDKWSATKWMRVSEYK  212



>ref|XP_002964648.1| hypothetical protein SELMODRAFT_82355, partial [Selaginella moellendorffii]
 gb|EFJ34981.1| hypothetical protein SELMODRAFT_82355, partial [Selaginella moellendorffii]
Length=225

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D++I  IE +IA  TFIP +HGEG+Q+LHYE GQKY+ H+D+F D  NT+NGGQRIAT+
Sbjct  76   QDRVISEIEDKIAKLTFIPKDHGEGIQVLHYEPGQKYDAHHDFFYDTVNTRNGGQRIATL  135

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYL+DVEEGGETVFP +  N  ++PW N+L ECG+ G+SV+PK GDALL WSM PD  L
Sbjct  136  LMYLTDVEEGGETVFPKSAKNSSSLPWHNQLSECGRRGVSVRPKRGDALLFWSMSPDAQL  195

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRVREYK  249
            D SSLHGGCPVIKG+KWS TKWMRV EYK
Sbjct  196  DHSSLHGGCPVIKGDKWSATKWMRVSEYK  224



>ref|XP_009400627.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Musa acuminata subsp. 
malaccensis]
Length=131

 Score =   220 bits (561),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  635  EHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVXMYLSDVEEGGETVFPXAKG  456
            EHGEGLQ+LHYEVGQKYEPHYDYF+D++NT+NGGQR+AT+ MYLSDVEEGGETVFP AK 
Sbjct  2    EHGEGLQVLHYEVGQKYEPHYDYFVDEFNTRNGGQRLATLLMYLSDVEEGGETVFPSAKV  61

Query  455  NIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLDPSSLHGGCPVIKGNKWSXT  276
               ++P + EL ECGK GLS+KPKMGDALL WS +PD +LDPSSLHGGCPVI+GNKWS T
Sbjct  62   FSSSLPRYTELSECGKKGLSIKPKMGDALLFWSTRPDATLDPSSLHGGCPVIRGNKWSST  121

Query  275  KWMRVREYKA  246
            KWM +RE++A
Sbjct  122  KWMHIREFRA  131



>ref|XP_010480555.1| PREDICTED: probable prolyl 4-hydroxylase 3 [Camelina sativa]
Length=272

 Score =   224 bits (571),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDKII+ IEKRIAD+TFIPA+HGEGLQ+LHYE GQKYEPHYDYF+D +NTKNGGQR+AT+
Sbjct  142  RDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDTFNTKNGGQRMATM  201

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +VPW+NEL ECGK GLSVKP+MGDALL WSM+PD +L
Sbjct  202  LMYLSDVEEGGETVFPSANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATL  261

Query  335  DPSSLH  318
            DP+SLH
Sbjct  262  DPTSLH  267



>gb|KDO75954.1| hypothetical protein CISIN_1g0230532mg [Citrus sinensis]
Length=266

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +D+IIR IEKRIADFTFIP EHGEG+Q+LHYEVGQKY+ HYDYFLD++NTKNGGQR+AT+
Sbjct  139  QDRIIRGIEKRIADFTFIPMEHGEGIQVLHYEVGQKYDAHYDYFLDEFNTKNGGQRMATL  198

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGETVFP A  N  +V WWNEL ECGK GLSVKPK GDALL WSM+PD +L
Sbjct  199  LMYLSDVEEGGETVFPAANANFTSVRWWNELSECGKQGLSVKPKRGDALLFWSMRPDATL  258

Query  335  DPSSLHG  315
            DPSSLHG
Sbjct  259  DPSSLHG  265



>ref|NP_001242181.1| uncharacterized protein LOC100782154 [Glycine max]
 gb|ACU22735.1| unknown [Glycine max]
Length=285

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKI+RNIEKRIAD TFIP EHGE L ++ Y VGQ YEPH DYF ++++  NGGQRIAT+
Sbjct  145  KDKIVRNIEKRIADVTFIPIEHGEPLHVIRYAVGQYYEPHVDYFEEEFSLVNGGQRIATM  204

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLS+VE GGETVFP A  N  +VPWWNEL ECG+ GLS+KPKMGDALL WSMKPD +L
Sbjct  205  LMYLSNVEGGGETVFPIANANFSSVPWWNELSECGQTGLSIKPKMGDALLFWSMKPDATL  264

Query  335  DPSSLHGGCPVIKGNKWSXTK  273
            DP +LH  CPVIKGNKWS TK
Sbjct  265  DPLTLHRACPVIKGNKWSCTK  285



>ref|XP_004487245.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Cicer arietinum]
Length=282

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            DKI+ NIEKRIA  + IP EHGEGLQ+LHY+VGQKY+ H D+F+D+++ ++GGQRIAT+ 
Sbjct  134  DKIVSNIEKRIAQVSLIPIEHGEGLQVLHYKVGQKYDTHGDFFMDNFSVRHGGQRIATML  193

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDVEEGGET+FP A  N  +VPWWN+L +CGK GLS+KPKMGDALL WSM P+ +LD
Sbjct  194  MYLSDVEEGGETMFPYANRNFSSVPWWNQLSDCGKLGLSIKPKMGDALLFWSMNPNATLD  253

Query  332  PSSLHGGCPVIKGNKWSXTKWMRV  261
             SS HG CPVIKG+KWS  KWM  
Sbjct  254  LSSAHGSCPVIKGDKWSCAKWMHT  277



>ref|XP_003629235.1| Prolyl 4-hydroxylase alpha-2 subunit [Medicago truncatula]
Length=196

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 116/145 (80%), Gaps = 13/145 (9%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
             DKI+RNIE+RIADFTFIP E+GE + ILHYEVGQKYEPH D+F D+ NTKNGG      
Sbjct  58   HDKILRNIEQRIADFTFIPVENGESVNILHYEVGQKYEPHPDFFTDEINTKNGG------  111

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
                   E+GGETVFP A+GN  +VPWWNEL +CGK GLS+KPKMGDALL WSMKPDG+L
Sbjct  112  -------EQGGETVFPFAEGNFSSVPWWNELSDCGKKGLSIKPKMGDALLFWSMKPDGTL  164

Query  335  DPSSLHGGCPVIKGNKWSXTKWMRV  261
            DP S+HG CPVIKG+KWS TKWMRV
Sbjct  165  DPLSMHGACPVIKGDKWSCTKWMRV  189



>gb|AET03711.2| prolyl 4-hydroxylase alpha subunit, putative [Medicago truncatula]
Length=227

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 116/144 (81%), Gaps = 13/144 (9%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            DKI+RNIE+RIADFTFIP E+GE + ILHYEVGQKYEPH D+F D+ NTKNGG       
Sbjct  90   DKILRNIEQRIADFTFIPVENGESVNILHYEVGQKYEPHPDFFTDEINTKNGG-------  142

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
                  E+GGETVFP A+GN  +VPWWNEL +CGK GLS+KPKMGDALL WSMKPDG+LD
Sbjct  143  ------EQGGETVFPFAEGNFSSVPWWNELSDCGKKGLSIKPKMGDALLFWSMKPDGTLD  196

Query  332  PSSLHGGCPVIKGNKWSXTKWMRV  261
            P S+HG CPVIKG+KWS TKWMRV
Sbjct  197  PLSMHGACPVIKGDKWSCTKWMRV  220



>gb|EEE58093.1| hypothetical protein OsJ_08962 [Oryza sativa Japonica Group]
Length=387

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQR+AT+
Sbjct  161  RDKVIRAIEKRIADYTFIPMEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRMATL  220

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL EC + GL+VKPKMGDALL WSMKPD +L
Sbjct  221  LMYLSDVEEGGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATL  280

Query  335  DPSSLH  318
            DP SLH
Sbjct  281  DPLSLH  286



>gb|EEC74283.1| hypothetical protein OsI_09531 [Oryza sativa Indica Group]
Length=376

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            RDK+IR IEKRIAD+TFIP EHGEGLQ+LHYEVGQKYEPH+DYFLD+YNTKNGGQR+AT+
Sbjct  161  RDKVIRAIEKRIADYTFIPMEHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRMATL  220

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP A  N  ++PW+NEL EC + GL+VKPKMGDALL WSMKPD +L
Sbjct  221  LMYLSDVEEGGETIFPDANVNSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATL  280

Query  335  DPSSLH  318
            DP SLH
Sbjct  281  DPLSLH  286



>gb|AAL58274.1|AC068923_16 putative prolyl 4-hydroxylase, alpha subunit [Oryza sativa Japonica 
Group]
Length=343

 Score =   211 bits (538),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  695  RDKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATV  516
            +DKIIR IEKRI+D+TFIP E+GEGLQ+LHYEVGQKYEPH+DYF D++NTKNGGQRIAT+
Sbjct  172  QDKIIRTIEKRISDYTFIPVENGEGLQVLHYEVGQKYEPHFDYFHDEFNTKNGGQRIATL  231

Query  515  XMYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSL  336
             MYLSDVEEGGET+FP +K N  + P++NEL EC K GL+VKPKMGDALL WSM+PDGSL
Sbjct  232  LMYLSDVEEGGETIFPSSKANSSSSPFYNELSECAKKGLAVKPKMGDALLFWSMRPDGSL  291

Query  335  DPSSLHGGCPVI  300
            D +SLHG  P++
Sbjct  292  DATSLHGEIPIL  303



>emb|CAA21467.1| putative protein [Arabidopsis thaliana]
 emb|CAB81490.1| putative protein [Arabidopsis thaliana]
Length=307

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  692  DKIIRNIEKRIADFTFIPAEHGEGLQILHYEVGQKYEPHYDYFLDDYNTKNGGQRIATVX  513
            D+I+  IE RI+DFTFIP E+GEGLQ+LHYEVGQ+YEPH+DYF D++N + GGQRIATV 
Sbjct  174  DEIVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDEFNVRKGGQRIATVL  233

Query  512  MYLSDVEEGGETVFPXAKGNIXAVPWWNELXECGKGGLSVKPKMGDALLXWSMKPDGSLD  333
            MYLSDV+EGGETVFP AKGN+  VPWW+EL +CGK GLSV PK  DALL WSMKPD SLD
Sbjct  234  MYLSDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLD  293

Query  332  PSSLHG  315
            PSSLHG
Sbjct  294  PSSLHG  299



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160