BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020D10

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001274907.1|  epoxide hydrolase                                  324   9e-107   Solanum tuberosum [potatoes]
ref|XP_004239806.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    320   2e-105   
ref|NP_001274962.1|  epoxide hydrolase                                  319   6e-105   Solanum tuberosum [potatoes]
ref|NP_001275417.1|  epoxide hydrolase                                  317   3e-104   Solanum tuberosum [potatoes]
pdb|2CJP|A  Chain A, Structure Of Potato (Solanum Tuberosum) Epox...    317   5e-104   Solanum tuberosum [potatoes]
pdb|3CXU|A  Chain A, Structure Of A Y149f Mutant Of Epoxide Hydro...    316   1e-103   Solanum tuberosum [potatoes]
ref|XP_004239808.1|  PREDICTED: bifunctional epoxide hydrolase 2        315   3e-103   Solanum lycopersicum
ref|XP_009598630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    311   5e-102   
ref|XP_009775927.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    310   4e-101   Nicotiana sylvestris
gb|EYU21013.1|  hypothetical protein MIMGU_mgv1a010239mg                305   2e-99    Erythranthe guttata [common monkey flower]
gb|EYU43973.1|  hypothetical protein MIMGU_mgv1a010247mg                305   2e-99    Erythranthe guttata [common monkey flower]
ref|XP_011090999.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    301   5e-98    Sesamum indicum [beniseed]
ref|NP_001275381.1|  epoxide hydrolase                                  300   1e-97    Solanum tuberosum [potatoes]
ref|XP_009622776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    298   2e-96    Nicotiana tomentosiformis
gb|AAA81893.1|  epoxide hydrolase                                       296   2e-96    Solanum tuberosum [potatoes]
ref|XP_004239805.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    296   4e-96    Solanum lycopersicum
ref|XP_010024724.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    296   5e-96    Eucalyptus grandis [rose gum]
emb|CAJ19276.1|  putative epoxide hydrolase                             296   6e-96    Solanum commersonii
ref|XP_010024723.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    295   3e-95    Eucalyptus grandis [rose gum]
gb|KDO71745.1|  hypothetical protein CISIN_1g017221mg                   293   4e-94    Citrus sinensis [apfelsine]
emb|CDO98838.1|  unnamed protein product                                291   4e-94    Coffea canephora [robusta coffee]
ref|XP_003550367.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    291   6e-94    Glycine max [soybeans]
ref|XP_006489040.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    291   4e-93    Citrus sinensis [apfelsine]
ref|XP_006419515.1|  hypothetical protein CICLE_v10005186mg             291   4e-93    Citrus clementina [clementine]
ref|XP_006342824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    288   9e-93    Solanum tuberosum [potatoes]
ref|XP_009622179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    288   1e-92    Nicotiana tomentosiformis
ref|XP_004508197.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    288   4e-92    Cicer arietinum [garbanzo]
ref|XP_004229258.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    286   9e-92    
ref|XP_010105136.1|  Epoxide hydrolase 2                                286   2e-91    
ref|XP_009757467.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    285   2e-91    Nicotiana sylvestris
ref|XP_006349824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    285   2e-91    
ref|XP_008789846.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    284   3e-91    Phoenix dactylifera
ref|XP_007154300.1|  hypothetical protein PHAVU_003G106900g             284   4e-91    Phaseolus vulgaris [French bean]
ref|XP_009788447.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    283   6e-91    Nicotiana sylvestris
gb|EYU43974.1|  hypothetical protein MIMGU_mgv1a009814mg                282   3e-90    Erythranthe guttata [common monkey flower]
gb|KHG21329.1|  Epoxide hydrolase 2                                     283   4e-90    Gossypium arboreum [tree cotton]
ref|XP_004252913.1|  PREDICTED: bifunctional epoxide hydrolase 2        281   4e-90    Solanum lycopersicum
emb|CDP10752.1|  unnamed protein product                                281   4e-90    Coffea canephora [robusta coffee]
ref|XP_010039619.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    281   4e-90    Eucalyptus grandis [rose gum]
ref|XP_009391487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    280   1e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921626.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    280   2e-89    Elaeis guineensis
gb|KJB72716.1|  hypothetical protein B456_011G192300                    281   3e-89    Gossypium raimondii
ref|XP_010911257.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    279   3e-89    
ref|XP_004296863.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    278   5e-89    Fragaria vesca subsp. vesca
ref|XP_010649574.1|  PREDICTED: bifunctional epoxide hydrolase 2        278   5e-89    Vitis vinifera
ref|XP_009352305.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    278   6e-89    Pyrus x bretschneideri [bai li]
gb|KDP27824.1|  hypothetical protein JCGZ_18904                         278   6e-89    Jatropha curcas
gb|KFK41013.1|  hypothetical protein AALP_AA2G073900                    278   7e-89    Arabis alpina [alpine rockcress]
ref|XP_010105137.1|  Epoxide hydrolase 2                                278   1e-88    Morus notabilis
ref|XP_008784769.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    278   1e-88    Phoenix dactylifera
ref|XP_010693594.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    279   1e-88    
ref|XP_006414412.1|  hypothetical protein EUTSA_v10025488mg             279   1e-88    Eutrema salsugineum [saltwater cress]
emb|CAZ86692.1|  epoxide hydrolase 1                                    277   2e-88    Prunus persica
ref|XP_010088294.1|  Epoxide hydrolase 2                                277   2e-88    Morus notabilis
ref|XP_007222693.1|  hypothetical protein PRUPE_ppa008676mg             277   2e-88    
ref|XP_007222764.1|  hypothetical protein PRUPE_ppa008756mg             277   2e-88    
gb|KJB35646.1|  hypothetical protein B456_006G123000                    276   3e-88    Gossypium raimondii
gb|AAM28292.1|  epoxide hydrolase                                       276   5e-88    Ananas comosus
ref|XP_009411662.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    275   9e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011091000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    275   1e-87    Sesamum indicum [beniseed]
ref|XP_006654297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    272   1e-87    
ref|XP_009620847.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    275   2e-87    Nicotiana tomentosiformis
ref|XP_009771842.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    274   2e-87    Nicotiana sylvestris
ref|XP_006489041.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    274   2e-87    Citrus sinensis [apfelsine]
ref|XP_008784771.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    275   3e-87    
ref|XP_008784772.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    274   3e-87    Phoenix dactylifera
ref|XP_007050977.1|  Alpha/beta-Hydrolases superfamily protein          274   3e-87    Theobroma cacao [chocolate]
ref|XP_010088295.1|  Epoxide hydrolase 2                                273   4e-87    Morus notabilis
ref|XP_006414587.1|  hypothetical protein EUTSA_v10025505mg             275   5e-87    Eutrema salsugineum [saltwater cress]
ref|XP_010914487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    273   5e-87    Elaeis guineensis
ref|XP_003554527.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    273   5e-87    Glycine max [soybeans]
ref|XP_008223222.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    273   6e-87    
ref|XP_008775993.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    273   6e-87    Phoenix dactylifera
ref|XP_009350800.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    273   6e-87    Pyrus x bretschneideri [bai li]
ref|XP_008784770.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    274   7e-87    Phoenix dactylifera
ref|XP_006600362.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    274   9e-87    Glycine max [soybeans]
ref|XP_008341331.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    273   9e-87    
ref|XP_006419522.1|  hypothetical protein CICLE_v10005425mg             273   1e-86    Citrus clementina [clementine]
ref|XP_010039627.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    272   1e-86    Eucalyptus grandis [rose gum]
gb|KDP27825.1|  hypothetical protein JCGZ_18905                         272   1e-86    Jatropha curcas
ref|XP_010043042.1|  PREDICTED: bifunctional epoxide hydrolase 2        272   1e-86    Eucalyptus grandis [rose gum]
emb|CDY09722.1|  BnaC07g33390D                                          273   1e-86    Brassica napus [oilseed rape]
ref|XP_008807392.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    272   1e-86    
ref|XP_004290776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    272   2e-86    Fragaria vesca subsp. vesca
ref|XP_002516953.1|  epoxide hydrolase, putative                        272   2e-86    
ref|XP_004240550.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    271   2e-86    Solanum lycopersicum
ref|XP_011079631.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    271   3e-86    Sesamum indicum [beniseed]
emb|CDO98837.1|  unnamed protein product                                271   3e-86    Coffea canephora [robusta coffee]
ref|XP_006355815.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    271   3e-86    Solanum tuberosum [potatoes]
ref|XP_011006450.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    271   4e-86    Populus euphratica
emb|CDX90550.1|  BnaA03g42310D                                          271   4e-86    
gb|KDP27828.1|  hypothetical protein JCGZ_18908                         271   4e-86    Jatropha curcas
ref|XP_009136735.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    272   7e-86    Brassica rapa
ref|NP_001055069.1|  Os05g0273800                                       271   8e-86    
ref|XP_007200440.1|  hypothetical protein PRUPE_ppa008875mg             270   1e-85    
gb|KEH32298.1|  epoxide hydrolase                                       271   1e-85    Medicago truncatula
ref|XP_002314368.1|  hypothetical protein POPTR_0010s01430g             270   1e-85    Populus trichocarpa [western balsam poplar]
ref|XP_008454325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    270   1e-85    Cucumis melo [Oriental melon]
emb|CDY65636.1|  BnaAnng20810D                                          270   2e-85    Brassica napus [oilseed rape]
ref|XP_009111296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    269   2e-85    Brassica rapa
ref|XP_011006451.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    270   2e-85    Populus euphratica
gb|EYU46741.1|  hypothetical protein MIMGU_mgv1a009984mg                269   2e-85    Erythranthe guttata [common monkey flower]
ref|XP_008235117.1|  PREDICTED: bifunctional epoxide hydrolase 2        269   2e-85    Prunus mume [ume]
ref|XP_002314371.1|  hypothetical protein POPTR_0010s01440g             269   2e-85    
ref|XP_006489255.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    267   2e-85    
ref|XP_009414133.1|  PREDICTED: bifunctional epoxide hydrolase 2        270   3e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007031041.1|  Alpha/beta-Hydrolases superfamily protein          269   3e-85    
ref|XP_007221833.1|  hypothetical protein PRUPE_ppa020197mg             269   3e-85    
emb|CDY50394.1|  BnaCnng19260D                                          268   3e-85    Brassica napus [oilseed rape]
ref|XP_002283462.1|  PREDICTED: bifunctional epoxide hydrolase 2        268   3e-85    Vitis vinifera
ref|XP_010038235.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    269   4e-85    Eucalyptus grandis [rose gum]
ref|XP_010038230.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    268   4e-85    Eucalyptus grandis [rose gum]
ref|XP_008246047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    267   5e-85    
ref|XP_008223225.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   5e-85    
ref|XP_008371325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    268   5e-85    
ref|XP_006378063.1|  hypothetical protein POPTR_0010s01420g             268   6e-85    
ref|XP_007035641.1|  Alpha/beta-Hydrolases superfamily protein          270   6e-85    
gb|KJB35639.1|  hypothetical protein B456_006G122800                    268   7e-85    Gossypium raimondii
ref|XP_008361962.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    268   8e-85    
ref|XP_004967831.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    268   9e-85    Setaria italica
ref|XP_010102979.1|  Epoxide hydrolase 2                                267   1e-84    Morus notabilis
dbj|BAJ99775.1|  predicted protein                                      267   1e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008454330.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    267   1e-84    Cucumis melo [Oriental melon]
gb|KDP28184.1|  hypothetical protein JCGZ_13955                         267   1e-84    Jatropha curcas
ref|XP_009622181.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    267   2e-84    Nicotiana tomentosiformis
gb|EMT09897.1|  hypothetical protein F775_52362                         267   2e-84    
ref|XP_007147004.1|  hypothetical protein PHAVU_006G088600g             266   2e-84    Phaseolus vulgaris [French bean]
gb|KGN66047.1|  hypothetical protein Csa_1G569240                       266   2e-84    Cucumis sativus [cucumbers]
ref|XP_002455386.1|  hypothetical protein SORBIDRAFT_03g009830          266   2e-84    Sorghum bicolor [broomcorn]
ref|XP_010269590.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   2e-84    Nelumbo nucifera [Indian lotus]
ref|XP_002874922.1|  hypothetical protein ARALYDRAFT_490337             266   3e-84    
ref|XP_004494384.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   3e-84    Cicer arietinum [garbanzo]
gb|AFZ93648.1|  epoxide hydrolase                                       266   3e-84    Euphorbia lathyris
ref|XP_006342825.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    267   3e-84    Solanum tuberosum [potatoes]
dbj|BAK07144.1|  predicted protein                                      267   3e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT04118.1|  hypothetical protein F775_13984                         266   3e-84    
ref|XP_011010960.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   3e-84    Populus euphratica
ref|XP_011010961.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   4e-84    Populus euphratica
ref|XP_004152361.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   4e-84    Cucumis sativus [cucumbers]
ref|XP_006288215.1|  hypothetical protein CARUB_v10001452mg             266   4e-84    Capsella rubella
ref|XP_008340789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   5e-84    
ref|XP_008355493.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    265   5e-84    Malus domestica [apple tree]
ref|NP_567228.1|  putative epoxide hydrolase                            266   5e-84    Arabidopsis thaliana [mouse-ear cress]
gb|AFK41660.1|  unknown                                                 265   6e-84    Lotus japonicus
ref|XP_002271210.1|  PREDICTED: bifunctional epoxide hydrolase 2        265   6e-84    Vitis vinifera
ref|XP_006433457.1|  hypothetical protein CICLE_v10001881mg             265   7e-84    Citrus clementina [clementine]
ref|XP_006419517.1|  hypothetical protein CICLE_v10005451mg             265   8e-84    Citrus clementina [clementine]
ref|XP_008386679.1|  PREDICTED: bifunctional epoxide hydrolase 2        265   8e-84    
ref|XP_004152245.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    265   8e-84    Cucumis sativus [cucumbers]
ref|XP_010684348.1|  PREDICTED: bifunctional epoxide hydrolase 2        265   9e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006604802.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    265   1e-83    
gb|AFK34299.1|  unknown                                                 265   1e-83    Lotus japonicus
ref|XP_010556730.1|  PREDICTED: bifunctional epoxide hydrolase 2        264   2e-83    Tarenaya hassleriana [spider flower]
ref|XP_010693593.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    266   2e-83    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006396441.1|  hypothetical protein EUTSA_v10028814mg             264   2e-83    Eutrema salsugineum [saltwater cress]
ref|XP_003632381.1|  PREDICTED: bifunctional epoxide hydrolase 2        264   2e-83    Vitis vinifera
ref|XP_003626243.1|  Epoxide hydrolase                                  264   2e-83    Medicago truncatula
gb|KHG07158.1|  Epoxide hydrolase 2                                     264   2e-83    Gossypium arboreum [tree cotton]
emb|CDP17111.1|  unnamed protein product                                264   2e-83    Coffea canephora [robusta coffee]
ref|XP_002523108.1|  epoxide hydrolase, putative                        264   3e-83    
ref|XP_007163124.1|  hypothetical protein PHAVU_001G208300g             264   3e-83    Phaseolus vulgaris [French bean]
ref|XP_006444386.1|  hypothetical protein CICLE_v10023691mg             263   3e-83    Citrus clementina [clementine]
ref|XP_010914488.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    263   3e-83    Elaeis guineensis
ref|XP_003563920.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    265   3e-83    Brachypodium distachyon [annual false brome]
gb|KDP28186.1|  hypothetical protein JCGZ_13957                         263   3e-83    Jatropha curcas
ref|XP_009335707.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    263   4e-83    Pyrus x bretschneideri [bai li]
ref|XP_009775353.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    263   5e-83    Nicotiana sylvestris
ref|XP_007015342.1|  Alpha/beta-Hydrolases superfamily protein          263   5e-83    
ref|XP_009629123.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    263   6e-83    Nicotiana tomentosiformis
ref|XP_010094462.1|  Epoxide hydrolase 2                                263   6e-83    Morus notabilis
ref|XP_008454327.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    263   7e-83    Cucumis melo [Oriental melon]
ref|XP_011092097.1|  PREDICTED: bifunctional epoxide hydrolase 2        262   8e-83    Sesamum indicum [beniseed]
ref|XP_010456047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    263   9e-83    Camelina sativa [gold-of-pleasure]
gb|KJB23306.1|  hypothetical protein B456_004G091300                    262   1e-82    Gossypium raimondii
ref|XP_010104146.1|  Epoxide hydrolase 2                                262   1e-82    Morus notabilis
gb|KHG24497.1|  Epoxide hydrolase 2                                     262   1e-82    Gossypium arboreum [tree cotton]
ref|XP_010422608.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    262   1e-82    Camelina sativa [gold-of-pleasure]
emb|CDP17206.1|  unnamed protein product                                261   2e-82    Coffea canephora [robusta coffee]
ref|XP_004229259.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    262   2e-82    Solanum lycopersicum
ref|XP_010434902.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    263   2e-82    Camelina sativa [gold-of-pleasure]
ref|NP_193331.6|  alpha/beta-Hydrolases superfamily protein             263   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152242.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    261   2e-82    Cucumis sativus [cucumbers]
gb|EMS55500.1|  Epoxide hydrolase 2                                     259   2e-82    Triticum urartu
ref|XP_004290809.1|  PREDICTED: bifunctional epoxide hydrolase 2        261   3e-82    Fragaria vesca subsp. vesca
ref|XP_010544298.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    261   3e-82    Tarenaya hassleriana [spider flower]
ref|XP_010039296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    261   3e-82    Eucalyptus grandis [rose gum]
ref|NP_001042622.1|  Os01g0255100                                       261   3e-82    
ref|XP_002523107.1|  epoxide hydrolase, putative                        261   4e-82    Ricinus communis
ref|XP_006644009.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    261   4e-82    Oryza brachyantha
ref|XP_010429523.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    261   4e-82    Camelina sativa [gold-of-pleasure]
ref|XP_004134492.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    261   5e-82    Cucumis sativus [cucumbers]
gb|ACU19478.1|  unknown                                                 260   5e-82    Glycine max [soybeans]
ref|XP_002443185.1|  hypothetical protein SORBIDRAFT_08g014640          262   5e-82    Sorghum bicolor [broomcorn]
ref|XP_010921625.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    256   6e-82    
gb|KEH24395.1|  epoxide hydrolase                                       260   6e-82    Medicago truncatula
ref|XP_007015353.1|  Alpha/beta-Hydrolases superfamily protein          260   8e-82    
ref|XP_003554633.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    261   8e-82    Glycine max [soybeans]
ref|NP_001132040.1|  uncharacterized protein LOC100193450               261   9e-82    Zea mays [maize]
ref|XP_010039280.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    260   1e-81    Eucalyptus grandis [rose gum]
gb|KDP23458.1|  hypothetical protein JCGZ_23291                         259   1e-81    Jatropha curcas
gb|ACN28644.1|  unknown                                                 258   1e-81    Zea mays [maize]
gb|KFK30821.1|  hypothetical protein AALP_AA6G030400                    259   2e-81    Arabis alpina [alpine rockcress]
ref|XP_010038231.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    259   2e-81    Eucalyptus grandis [rose gum]
ref|NP_001240943.1|  uncharacterized protein LOC100803974               259   2e-81    Glycine max [soybeans]
ref|XP_009757465.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    259   2e-81    Nicotiana sylvestris
ref|XP_008454322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    259   2e-81    Cucumis melo [Oriental melon]
gb|KJB45332.1|  hypothetical protein B456_007G301800                    259   2e-81    Gossypium raimondii
ref|NP_001148885.1|  epoxide hydrolase 2                                259   2e-81    
emb|CDM82646.1|  unnamed protein product                                259   3e-81    Triticum aestivum [Canadian hard winter wheat]
gb|AFW56302.1|  hypothetical protein ZEAMMB73_530848                    261   3e-81    
ref|XP_008438903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    260   3e-81    Cucumis melo [Oriental melon]
ref|XP_004965308.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    260   3e-81    Setaria italica
ref|XP_003566463.1|  PREDICTED: bifunctional epoxide hydrolase 2        258   3e-81    Brachypodium distachyon [annual false brome]
gb|EPS69728.1|  epoxide hydrolase                                       258   3e-81    Genlisea aurea
ref|XP_006480000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   4e-81    Citrus sinensis [apfelsine]
gb|KHN03961.1|  Epoxide hydrolase 2                                     258   4e-81    Glycine soja [wild soybean]
ref|XP_009386486.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   4e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393199.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   5e-81    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN43314.1|  Epoxide hydrolase 2                                     258   7e-81    Glycine soja [wild soybean]
ref|XP_002318980.2|  epoxide hydrolase family protein                   258   7e-81    Populus trichocarpa [western balsam poplar]
ref|XP_011041992.1|  PREDICTED: bifunctional epoxide hydrolase 2        257   7e-81    Populus euphratica
ref|XP_006344695.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    257   8e-81    Solanum tuberosum [potatoes]
ref|XP_010038234.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   8e-81    Eucalyptus grandis [rose gum]
ref|XP_002270853.1|  PREDICTED: bifunctional epoxide hydrolase 2        257   9e-81    
ref|XP_006359858.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    257   9e-81    Solanum tuberosum [potatoes]
tpg|DAA53983.1|  TPA: epoxide hydrolase 2                               257   1e-80    
emb|CAA55294.1|  epoxide hydrolase                                      258   1e-80    Glycine max [soybeans]
ref|NP_001238563.1|  epoxide hydrolase                                  258   1e-80    Glycine max [soybeans]
ref|XP_006472971.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    265   1e-80    
ref|XP_010449872.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    259   1e-80    Camelina sativa [gold-of-pleasure]
ref|XP_009393200.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    256   2e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002320333.2|  epoxide hydrolase family protein                   256   2e-80    Populus trichocarpa [western balsam poplar]
emb|CAD31713.1|  epoxide hydrolase                                      255   2e-80    Cicer arietinum [garbanzo]
ref|XP_006397371.1|  hypothetical protein EUTSA_v10022504mg             256   2e-80    Eutrema salsugineum [saltwater cress]
gb|AES82420.2|  epoxide hydrolase                                       256   2e-80    Medicago truncatula
gb|ACU23321.1|  unknown                                                 256   2e-80    Glycine max [soybeans]
ref|XP_008775992.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    256   2e-80    Phoenix dactylifera
ref|XP_003554635.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    256   2e-80    Glycine max [soybeans]
emb|CDY05187.1|  BnaC05g46160D                                          257   2e-80    
gb|EMS45147.1|  Epoxide hydrolase 2                                     252   3e-80    Triticum urartu
gb|KCW50060.1|  hypothetical protein EUGRSUZ_K03501                     256   3e-80    Eucalyptus grandis [rose gum]
ref|XP_006444387.1|  hypothetical protein CICLE_v10021228mg             256   4e-80    Citrus clementina [clementine]
gb|KEH24503.1|  epoxide hydrolase                                       256   4e-80    Medicago truncatula
gb|ACU19450.1|  unknown                                                 255   4e-80    Glycine max [soybeans]
ref|NP_001276233.1|  bifunctional epoxide hydrolase 2-like              255   4e-80    
gb|ACE82565.1|  epoxide hydrolase                                       255   6e-80    Nicotiana benthamiana
ref|XP_004230258.1|  PREDICTED: bifunctional epoxide hydrolase 2        255   7e-80    Solanum lycopersicum
emb|CDY65635.1|  BnaAnng20800D                                          255   7e-80    Brassica napus [oilseed rape]
ref|XP_010674075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    254   9e-80    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004981166.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    255   1e-79    Setaria italica
gb|AES82458.2|  epoxide hydrolase                                       254   1e-79    Medicago truncatula
gb|KHN20253.1|  Epoxide hydrolase 2                                     254   1e-79    Glycine soja [wild soybean]
gb|KDP28185.1|  hypothetical protein JCGZ_13956                         254   1e-79    Jatropha curcas
gb|KEH24510.1|  epoxide hydrolase                                       254   1e-79    Medicago truncatula
ref|XP_009147218.1|  PREDICTED: bifunctional epoxide hydrolase 2        254   2e-79    Brassica rapa
ref|XP_009111297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    254   2e-79    Brassica rapa
ref|XP_002302724.1|  epoxide hydrolase family protein                   254   2e-79    Populus trichocarpa [western balsam poplar]
ref|XP_009629075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    253   2e-79    Nicotiana tomentosiformis
emb|CDY27752.1|  BnaA05g31610D                                          254   3e-79    Brassica napus [oilseed rape]
ref|XP_004247402.1|  PREDICTED: bifunctional epoxide hydrolase 2        253   3e-79    Solanum lycopersicum
gb|KJB83594.1|  hypothetical protein B456_013G254400                    253   4e-79    Gossypium raimondii
ref|XP_008450607.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    253   4e-79    Cucumis melo [Oriental melon]
ref|XP_006408053.1|  hypothetical protein EUTSA_v100212090mg            251   5e-79    
ref|XP_010914485.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    253   6e-79    Elaeis guineensis
emb|CAD30841.1|  soluble epoxide hydrolase                              253   6e-79    Brassica napus [oilseed rape]
ref|XP_003626245.1|  Epoxide hydrolase                                  253   6e-79    Medicago truncatula
gb|KJB83597.1|  hypothetical protein B456_013G254700                    253   6e-79    Gossypium raimondii
emb|CBI22970.3|  unnamed protein product                                248   9e-79    Vitis vinifera
ref|XP_011015179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    252   1e-78    Populus euphratica
ref|XP_006283220.1|  hypothetical protein CARUB_v10004250mg             263   1e-78    
ref|NP_001042621.1|  Os01g0255000                                       252   1e-78    
gb|ACJ84958.1|  unknown                                                 251   1e-78    Medicago truncatula
gb|KFK32480.1|  hypothetical protein AALP_AA6G247900                    251   1e-78    Arabis alpina [alpine rockcress]
ref|XP_009140747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    251   1e-78    Brassica rapa
gb|KFK37968.1|  hypothetical protein AALP_AA3G053200                    252   2e-78    Arabis alpina [alpine rockcress]
ref|XP_010100621.1|  Epoxide hydrolase 2                                250   2e-78    
gb|ACJ85188.1|  unknown                                                 251   2e-78    Medicago truncatula
ref|XP_003556522.1|  PREDICTED: bifunctional epoxide hydrolase 2 ...    251   2e-78    
ref|XP_009788536.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    251   3e-78    Nicotiana sylvestris
ref|XP_003626244.1|  Epoxide hydrolase                                  251   3e-78    
gb|ACE82566.1|  epoxide hydrolase                                       251   3e-78    
emb|CDY48181.1|  BnaA04g15450D                                          251   4e-78    
gb|EYU46742.1|  hypothetical protein MIMGU_mgv1a010264mg                250   4e-78    
ref|XP_003626241.1|  Epoxide hydrolase                                  250   4e-78    
ref|XP_006650836.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    250   6e-78    
gb|AFK45529.1|  unknown                                                 250   7e-78    
ref|XP_004494576.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    250   7e-78    
ref|XP_010038233.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    250   8e-78    
ref|XP_002884518.1|  hypothetical protein ARALYDRAFT_317420             249   1e-77    
gb|KDO87161.1|  hypothetical protein CISIN_1g048209mg                   250   1e-77    
ref|XP_010546737.1|  PREDICTED: bifunctional epoxide hydrolase 2        249   1e-77    
ref|XP_011023717.1|  PREDICTED: bifunctional epoxide hydrolase 2        249   2e-77    
ref|XP_002463580.1|  hypothetical protein SORBIDRAFT_01g002410          249   2e-77    
gb|KJB83596.1|  hypothetical protein B456_013G254600                    248   3e-77    
ref|XP_007147005.1|  hypothetical protein PHAVU_006G088700g             248   3e-77    
gb|AFK46740.1|  unknown                                                 248   3e-77    
gb|AFK39155.1|  unknown                                                 248   4e-77    
gb|ACJ84799.1|  unknown                                                 248   4e-77    
gb|AFK39700.1|  unknown                                                 248   5e-77    
ref|NP_001150215.1|  epoxide hydrolase 2                                248   5e-77    
gb|ACF83934.1|  unknown                                                 248   5e-77    
ref|XP_006299381.1|  hypothetical protein CARUB_v10015540mg             248   5e-77    
ref|XP_003604118.1|  Epoxide hydrolase                                  247   7e-77    
ref|NP_001051780.1|  Os03g0829100                                       248   9e-77    
ref|NP_187211.1|  alpha/beta-Hydrolases superfamily protein             247   1e-76    
ref|XP_002868171.1|  hypothetical protein ARALYDRAFT_329917             253   1e-76    
ref|XP_002880830.1|  predicted protein                                  246   1e-76    
ref|XP_002512456.1|  epoxide hydrolase, putative                        246   2e-76    
ref|XP_003626202.1|  Epoxide hydrolase                                  256   2e-76    
gb|KHG22415.1|  Epoxide hydrolase 2                                     246   2e-76    
ref|XP_010524544.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    248   2e-76    
gb|AAO27849.1|AF482450_1  soluble epoxide hydrolase                     245   4e-76    
ref|XP_007147001.1|  hypothetical protein PHAVU_006G088400g             245   4e-76    
gb|EPS62395.1|  hypothetical protein M569_12392                         245   6e-76    
gb|KJB83595.1|  hypothetical protein B456_013G254500                    244   8e-76    
ref|NP_180243.1|  alpha/beta-hydrolases superfamily protein             244   1e-75    
ref|XP_010417820.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    244   2e-75    
emb|CAB46034.1|  putative epoxide hydrolase                             250   2e-75    
ref|XP_003626240.1|  Epoxide hydrolase                                  255   2e-75    
ref|XP_010449873.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    244   2e-75    
ref|XP_006296031.1|  hypothetical protein CARUB_v10025176mg             243   3e-75    
ref|XP_006414415.1|  hypothetical protein EUTSA_v10025689mg             243   3e-75    
ref|XP_011079630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    243   4e-75    
ref|NP_180242.1|  soluble epoxide hydrolase                             243   5e-75    
gb|KFK41012.1|  hypothetical protein AALP_AA2G073800                    243   5e-75    
ref|XP_010557474.1|  PREDICTED: bifunctional epoxide hydrolase 2        242   5e-75    
ref|XP_007144960.1|  hypothetical protein PHAVU_007G198000g             243   5e-75    
dbj|BAK06387.1|  predicted protein                                      243   6e-75    
ref|XP_007147002.1|  hypothetical protein PHAVU_006G088500g             242   6e-75    
ref|XP_010464087.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    243   6e-75    
ref|XP_010544295.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    241   2e-74    
ref|XP_004494951.1|  PREDICTED: uncharacterized protein LOC101500941    249   2e-74    
gb|ADP68585.1|  epoxide hydrolase A                                     241   2e-74    
ref|XP_006414584.1|  hypothetical protein EUTSA_v10025778mg             240   3e-74    
ref|XP_010429482.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    241   4e-74    
emb|CDY09727.1|  BnaC07g33340D                                          240   4e-74    
gb|KJB83576.1|  hypothetical protein B456_013G253700                    240   4e-74    
ref|XP_006299523.1|  hypothetical protein CARUB_v10015695mg             240   5e-74    
gb|KHG16220.1|  Epoxide hydrolase 2                                     240   5e-74    
ref|XP_004494577.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    240   9e-74    
ref|XP_010486015.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    239   1e-73    
ref|XP_002880829.1|  predicted protein                                  238   1e-73    
ref|XP_004152243.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    239   1e-73    
ref|XP_009136732.1|  PREDICTED: bifunctional epoxide hydrolase 2        239   1e-73    
ref|XP_010434903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    239   2e-73    
emb|CDX90553.1|  BnaA03g42280D                                          239   2e-73    
ref|XP_004152244.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    238   2e-73    
ref|XP_010473058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    238   2e-73    
gb|ABR16314.1|  unknown                                                 238   3e-73    
ref|XP_002306333.2|  hypothetical protein POPTR_0005s08280g             238   5e-73    
ref|XP_010440228.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    238   6e-73    
ref|XP_011021885.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    238   6e-73    
ref|XP_010229424.1|  PREDICTED: uncharacterized protein LOC100841009    248   7e-73    
gb|EPS67066.1|  pectinesterase                                          250   7e-73    
ref|XP_004156834.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    236   1e-72    
ref|XP_011039566.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    236   3e-72    
emb|CDY50393.1|  BnaCnng19250D                                          232   7e-72    
emb|CDP17110.1|  unnamed protein product                                234   1e-71    
gb|EPS69185.1|  hypothetical protein M569_05583                         233   1e-71    
gb|EYU42746.1|  hypothetical protein MIMGU_mgv1a010198mg                233   2e-71    
ref|XP_010548981.1|  PREDICTED: bifunctional epoxide hydrolase 2        233   3e-71    
dbj|BAJ91671.1|  predicted protein                                      233   3e-71    
ref|XP_008454324.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    233   4e-71    
gb|EMT29558.1|  hypothetical protein F775_27882                         229   5e-71    
ref|XP_010649601.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    233   5e-71    
ref|XP_010544465.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    231   6e-71    
dbj|BAJ89155.1|  predicted protein                                      232   1e-70    
gb|EAZ11286.1|  hypothetical protein OsJ_01142                          231   6e-70    
gb|KHN43502.1|  Epoxide hydrolase 2                                     225   8e-70    
gb|ABK21215.1|  unknown                                                 228   2e-69    
gb|EYU42194.1|  hypothetical protein MIMGU_mgv1a010473mg                227   4e-69    
emb|CBI39538.3|  unnamed protein product                                226   5e-69    
ref|XP_010440227.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    226   3e-68    
ref|XP_004981168.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    225   4e-68    
gb|EAY73347.1|  hypothetical protein OsI_01224                          225   4e-68    
gb|EAY92418.1|  hypothetical protein OsI_14152                          223   2e-67    
ref|XP_004981167.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    222   5e-67    
ref|XP_002459617.1|  hypothetical protein SORBIDRAFT_02g007580          221   2e-66    
ref|XP_002979677.1|  hypothetical protein SELMODRAFT_111571             219   4e-66    
ref|XP_006645722.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    216   5e-66    
emb|CDY57860.1|  BnaC08g47760D                                          218   8e-66    
gb|EAY92419.1|  hypothetical protein OsI_14153                          219   2e-65    
gb|EAZ29152.1|  hypothetical protein OsJ_13213                          216   4e-65    
gb|KHG02720.1|  Epoxide hydrolase 2                                     226   8e-65    
gb|AFW67077.1|  hypothetical protein ZEAMMB73_214444                    212   2e-64    
ref|NP_001051781.1|  Os03g0829200                                       216   2e-64    
ref|XP_002960490.1|  hypothetical protein SELMODRAFT_266570             214   9e-64    
ref|XP_002985384.1|  hypothetical protein SELMODRAFT_181715             213   1e-63    
ref|NP_001151201.1|  epoxide hydrolase 2                                213   3e-63    
ref|XP_008680999.1|  PREDICTED: uncharacterized protein LOC100191...    213   3e-63    
ref|XP_002967234.1|  hypothetical protein SELMODRAFT_87385              212   3e-63    
ref|XP_006650837.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    212   4e-63    
dbj|BAJ90007.1|  predicted protein                                      212   4e-63    
ref|NP_001154238.1|  alpha/beta-Hydrolases superfamily protein          211   6e-63    
emb|CDJ26688.1|  unnamed protein product                                210   2e-62    
gb|ACG46051.1|  epoxide hydrolase 2                                     210   3e-62    
emb|CBI36880.3|  unnamed protein product                                204   5e-62    
emb|CDJ26419.1|  unnamed protein product                                209   6e-62    
ref|XP_003577254.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    206   6e-61    
gb|KHG17815.1|  Epoxide hydrolase 2                                     204   7e-61    
ref|XP_003577188.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    206   7e-61    
emb|CBI22973.3|  unnamed protein product                                201   1e-60    
ref|XP_010275536.1|  PREDICTED: bifunctional epoxide hydrolase 2        204   2e-60    
ref|XP_006380777.1|  hypothetical protein POPTR_0007s13460g             201   4e-60    
ref|XP_006296069.1|  hypothetical protein CARUB_v10025219mg             202   6e-60    
gb|EMT01002.1|  hypothetical protein F775_32452                         204   7e-60    
gb|KCW84776.1|  hypothetical protein EUGRSUZ_B015791                    197   3e-59    
ref|XP_002310826.2|  epoxide hydrolase family protein                   200   1e-58    
gb|KHG02721.1|  Epoxide hydrolase 2                                     198   2e-58    
ref|XP_010513335.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    195   3e-58    
ref|XP_008338037.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    199   4e-58    
gb|KDP37443.1|  hypothetical protein JCGZ_08284                         198   7e-58    
ref|XP_008644360.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    198   1e-57    
ref|XP_006382453.1|  hypothetical protein POPTR_0005s02320g             194   1e-57    
ref|XP_006838631.1|  hypothetical protein AMTR_s00002p00235860          197   2e-57    
ref|XP_007046807.1|  Alpha/beta-Hydrolases superfamily protein is...    197   2e-57    
ref|XP_006838632.1|  hypothetical protein AMTR_s00002p00236030          197   2e-57    
ref|XP_003626242.1|  Epoxide hydrolase                                  202   6e-57    
ref|XP_001753609.1|  predicted protein                                  196   6e-57    
gb|AES82460.2|  epoxide hydrolase                                       202   6e-57    
ref|XP_009346065.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    196   7e-57    
ref|XP_009346066.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    196   7e-57    
ref|XP_011025873.1|  PREDICTED: bifunctional epoxide hydrolase 2        195   1e-56    
ref|XP_008354646.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    195   1e-56    
ref|XP_008354647.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    194   3e-56    
ref|XP_004287856.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    194   5e-56    
ref|XP_008337725.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    193   6e-56    
ref|XP_010107837.1|  Epoxide hydrolase 2                                193   9e-56    
gb|EMS55414.1|  Epoxide hydrolase 2                                     189   1e-55    
ref|XP_009598691.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    191   1e-55    
ref|XP_002451255.1|  hypothetical protein SORBIDRAFT_05g026560          192   1e-55    
ref|XP_006838629.1|  hypothetical protein AMTR_s00002p00235200          192   3e-55    
ref|XP_002521508.1|  epoxide hydrolase, putative                        191   3e-55    
gb|KJB43430.1|  hypothetical protein B456_007G199500                    191   7e-55    
ref|XP_006444395.1|  hypothetical protein CICLE_v10024303mg             189   7e-55    
gb|EAY73346.1|  hypothetical protein OsI_01223                          189   1e-54    
ref|XP_008241748.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    189   2e-54    
ref|XP_008241747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    188   2e-54    
ref|XP_010679802.1|  PREDICTED: bifunctional epoxide hydrolase 2        189   4e-54    
ref|XP_010254690.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    188   7e-54    
gb|EMS59633.1|  Epoxide hydrolase 2                                     187   8e-54    
ref|XP_003520282.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    188   8e-54    
ref|XP_004963323.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    187   8e-54    
ref|XP_010275537.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    187   1e-53    
ref|XP_007202253.1|  hypothetical protein PRUPE_ppa008854mg             187   2e-53    
gb|AGV54241.1|  epoxide hydrolase 2-like protein                        186   4e-53    
ref|XP_011100955.1|  PREDICTED: bifunctional epoxide hydrolase 2        186   4e-53    
emb|CBI22971.3|  unnamed protein product                                181   7e-53    
ref|NP_190669.1|  alpha/beta-Hydrolases superfamily protein             185   9e-53    
gb|KHG08034.1|  Epoxide hydrolase 2                                     184   1e-52    
dbj|BAK08144.1|  predicted protein                                      185   1e-52    
ref|XP_004287855.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    185   2e-52    
ref|XP_003557340.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    184   2e-52    
gb|EMT14639.1|  hypothetical protein F775_19531                         185   2e-52    
ref|XP_007156093.1|  hypothetical protein PHAVU_003G257900g             184   2e-52    
ref|XP_004963322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    183   4e-52    
ref|NP_001240134.1|  uncharacterized protein LOC100809053               183   4e-52    
dbj|BAJ98388.1|  predicted protein                                      183   6e-52    
gb|KHN27037.1|  Epoxide hydrolase 2                                     182   1e-51    
ref|XP_007046808.1|  Alpha/beta-Hydrolases superfamily protein is...    181   1e-51    
emb|CAN77654.1|  hypothetical protein VITISV_032325                     182   1e-51    
ref|XP_002275186.1|  PREDICTED: bifunctional epoxide hydrolase 2        182   1e-51    
ref|XP_006403966.1|  hypothetical protein EUTSA_v10010546mg             182   2e-51    
ref|XP_004509321.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    182   2e-51    
gb|AFK36273.1|  unknown                                                 182   2e-51    
ref|XP_010028623.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    181   2e-51    
emb|CDX77049.1|  BnaC04g38440D                                          176   3e-51    
gb|KJB43429.1|  hypothetical protein B456_007G199400                    181   4e-51    
ref|XP_002877783.1|  hypothetical protein ARALYDRAFT_485452             181   4e-51    
ref|NP_001147768.1|  LOC100281378                                       181   4e-51    
gb|KEH20402.1|  epoxide hydrolase                                       180   7e-51    
gb|AFK46496.1|  unknown                                                 180   9e-51    
ref|XP_006444388.1|  hypothetical protein CICLE_v10021228mg             175   1e-50    
ref|XP_002443655.1|  hypothetical protein SORBIDRAFT_08g022970          179   1e-50    
ref|XP_006291410.1|  hypothetical protein CARUB_v10017549mg             180   1e-50    
gb|KGN52820.1|  hypothetical protein Csa_4G001870                       174   1e-50    
ref|XP_010547454.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    179   2e-50    
ref|XP_010426641.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    179   3e-50    
gb|AFK43935.1|  unknown                                                 178   3e-50    
ref|XP_010649095.1|  PREDICTED: bifunctional epoxide hydrolase 2        178   4e-50    
ref|XP_010515481.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    178   5e-50    
gb|KHN02949.1|  Epoxide hydrolase 2                                     176   5e-50    
ref|XP_009346058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    177   8e-50    
ref|XP_003579088.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    177   1e-49    
emb|CDY33304.1|  BnaA01g19710D                                          176   2e-49    
emb|CDY26530.1|  BnaC01g23690D                                          176   2e-49    
gb|AFK43554.1|  unknown                                                 176   4e-49    
ref|XP_008366789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    175   5e-49    
ref|XP_009136579.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    175   8e-49    
ref|XP_008662613.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    173   3e-48    
ref|XP_010033445.1|  PREDICTED: bifunctional epoxide hydrolase 2        174   3e-48    
gb|AFK41347.1|  unknown                                                 172   3e-48    
ref|XP_009115780.1|  PREDICTED: bifunctional epoxide hydrolase 2        173   4e-48    
ref|XP_006388575.1|  hypothetical protein POPTR_0150s00200g             167   4e-48    
ref|XP_006423389.1|  hypothetical protein CICLE_v10028838mg             173   4e-48    
gb|KDO49467.1|  hypothetical protein CISIN_1g020621mg                   172   6e-48    
ref|NP_001067364.1|  Os12g0636400                                       172   6e-48    
ref|XP_006487348.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    172   7e-48    
emb|CDP01962.1|  unnamed protein product                                172   8e-48    
emb|CDX77971.1|  BnaA09g31660D                                          172   1e-47    



>ref|NP_001274907.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81891.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   324 bits (830),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 179/221 (81%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAWHLC+FRPDKVKALVN SVHF PR+P ++ VEG +A+YG DHYI RFQ P
Sbjct  102  VAHDWGALIAWHLCLFRPDKVKALVNSSVHFLPRNPKMNTVEGLKAVYGEDHYISRFQVP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFAPIG K+ L+ I+  F  P P YFPK KG     D   AL +WL EE+LDYY 
Sbjct  162  GEIEAEFAPIGAKSVLKKIL-TFRDPAPFYFPKGKGLEALPDAPVALSSWLSEEELDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++E+TGFTGGVNYYRAL ++WELTAPW+G++V VPTKFIVG+ DLVY IPGAKEYIHNG
Sbjct  221  NKFEQTGFTGGVNYYRALSINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VVVL+G AHF+NQE P E++ HI +F+ KF
Sbjct  281  GFKKDVPLLEEVVVLEGAAHFVNQERPHEISKHIYDFIQKF  321



>ref|XP_004239806.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 180/221 (81%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAWHLC+FRPDKVKALVN SVHFFPR+P+++ VEG +A+YG DHYI RFQ P
Sbjct  102  VAHDWGALIAWHLCLFRPDKVKALVNSSVHFFPRNPNMNTVEGLKAVYGEDHYISRFQVP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G+IEAEFAPIG K+ L+ I+  F    P YFPK KG     D   AL +WL EE+LDYY 
Sbjct  162  GDIEAEFAPIGAKSVLKKIL-TFRDTAPFYFPKGKGLEALPDAPVALSSWLSEEELDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++EKTGFTGGVNYYRAL ++WELTAPW+G+++ VPTKFIVG+ DLVY IPGAKEYIHNG
Sbjct  221  NKFEKTGFTGGVNYYRALPINWELTAPWTGAQLKVPTKFIVGEFDLVYHIPGAKEYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G KNDVPLLE+VVVL+G AHF+NQE P E++ HI +F+  F
Sbjct  281  GFKNDVPLLEEVVVLEGAAHFVNQERPHEISKHIYDFIQNF  321



>ref|NP_001274962.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81889.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   319 bits (818),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 178/221 (81%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAWHLC+FRPDKVKALVNLSVHF PR+P ++ VE  +A+YG DHYI RFQ P
Sbjct  102  VAHDWGALIAWHLCLFRPDKVKALVNLSVHFLPRNPKMNTVEWLKAIYGEDHYISRFQVP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFAPIG K+ L+ I+  +  P P YFPK KG     D   AL +WL EE+LDYY 
Sbjct  162  GEIEAEFAPIGAKSILKKIL-TYRDPAPFYFPKGKGLEALPDAPVALSSWLSEEELDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++E+TGFTGGVNYYRAL + WELTAPW+G++V VPTKFIVG+ DLVY IPGAKEYIHNG
Sbjct  221  NKFEQTGFTGGVNYYRALPISWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VVVL+G AHF+NQE P E++ HI +F+ KF
Sbjct  281  GFKEDVPLLEEVVVLEGSAHFVNQERPHEISKHIYDFIQKF  321



>ref|NP_001275417.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81892.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 179/221 (81%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAWHLC+FRPDKVKALVNLSVHF  R+P +++VEG +A+YG DHYI RFQ P
Sbjct  102  VAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFAPIG K+ L+ I+  +  P P YFPK KG     D   AL +WL EE+LDYY 
Sbjct  162  GEIEAEFAPIGAKSVLKKIL-TYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++E+TGFTG VNYYRAL ++WELTAPW+G++V VPTKFIVG+ DLVY IPGAKEYIHNG
Sbjct  221  NKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VVVL+G AHF++QE P E++ HI +F+ KF
Sbjct  281  GFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF  321



>pdb|2CJP|A Chain A, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
 pdb|2CJP|B Chain B, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
Length=328

 Score =   317 bits (812),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 179/221 (81%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAWHLC+FRPDKVKALVNLSVHF  R+P +++VEG +A+YG DHYI RFQ P
Sbjct  109  VAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVP  168

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFAPIG K+ L+ I+  +  P P YFPK KG     D   AL +WL EE+LDYY 
Sbjct  169  GEIEAEFAPIGAKSVLKKIL-TYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYA  227

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++E+TGFTG VNYYRAL ++WELTAPW+G++V VPTKFIVG+ DLVY IPGAKEYIHNG
Sbjct  228  NKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNG  287

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VVVL+G AHF++QE P E++ HI +F+ KF
Sbjct  288  GFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF  328



>pdb|3CXU|A Chain A, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
 pdb|3CXU|B Chain B, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
Length=328

 Score =   316 bits (810),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 179/221 (81%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAWHLC+FRPDKVKALVNLSVHF  R+P +++VEG +A++G DHYI RFQ P
Sbjct  109  VAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIFGEDHYISRFQVP  168

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFAPIG K+ L+ I+  +  P P YFPK KG     D   AL +WL EE+LDYY 
Sbjct  169  GEIEAEFAPIGAKSVLKKIL-TYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYA  227

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++E+TGFTG VNYYRAL ++WELTAPW+G++V VPTKFIVG+ DLVY IPGAKEYIHNG
Sbjct  228  NKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNG  287

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VVVL+G AHF++QE P E++ HI +F+ KF
Sbjct  288  GFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF  328



>ref|XP_004239808.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=321

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 175/221 (79%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAIIAWHLC+FRPDKVKALVNLSVHF  R+P ++ VEG +A+YG DHYI RFQ P
Sbjct  102  VAHDWGAIIAWHLCLFRPDKVKALVNLSVHFPRRNPKMNTVEGLKAIYGEDHYISRFQVP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFAPIG K+ L+ I+  +    PLYFPK  G     D   AL +WL EE+LDYY 
Sbjct  162  GEIEAEFAPIGAKSVLKKIL-TYRDTAPLYFPKGSGLDALPDAPAALSSWLSEEELDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N+YE+TGFTG VNYYRA  ++WELTAPW+G++V VPTKFIVG+ DLVY IPG KEYIHNG
Sbjct  221  NKYEQTGFTGAVNYYRAFPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGVKEYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VVVL+G AHF+NQE P E+N HI +F+ KF
Sbjct  281  GFKKDVPLLEEVVVLEGAAHFVNQERPHEINKHIYDFIQKF  321



>ref|XP_009598630.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=321

 Score =   311 bits (798),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 178/221 (81%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAWHLC+FRPDKVKALVNLS+H+FP +P ++ V+G RA+YG+DHY+ RFQ P
Sbjct  102  VGHDWGAIIAWHLCLFRPDKVKALVNLSIHYFPTNPQMNTVDGLRAIYGDDHYVWRFQVP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKG---FTDGSTALPAWLPEEDLDYYV  418
            GEIEAEFAPIGVK+ L+  +  F    P YFPK KG     D    L +WL EEDLDYY 
Sbjct  162  GEIEAEFAPIGVKSVLKKFL-RFRDSAPFYFPKGKGVEAIPDAPIELSSWLTEEDLDYYS  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++E+TGFTGGVNYYRA  ++WELTAPW+G++V VP KF+VG+LDLVY IPGAK+YIHNG
Sbjct  221  SKFEQTGFTGGVNYYRAFPINWELTAPWTGAQVKVPAKFMVGELDLVYHIPGAKDYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              K DVPLLE+VVVL+G AHF+NQE P E+N HI +F+ KF
Sbjct  281  EFKKDVPLLEEVVVLEGAAHFVNQERPDEINKHIFDFIQKF  321



>ref|XP_009775927.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009775928.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=321

 Score =   310 bits (793),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 177/221 (80%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAWHL +FRPDK+KALVNLSVH+FPR+P ++ V+G RA+YG+DHY+ RFQ P
Sbjct  102  VGHDWGALIAWHLSLFRPDKLKALVNLSVHYFPRNPQMNTVDGLRAIYGDDHYVWRFQVP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKG---FTDGSTALPAWLPEEDLDYYV  418
            GEIEAEF+PIG K+ L+  +  F   EP+YFPK KG     D    L +WL EEDLDYY 
Sbjct  162  GEIEAEFSPIGAKSVLKKFL-RFRGSEPIYFPKGKGVEAIPDAPIELSSWLTEEDLDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++E+TGFTGGVNYYRA  + WE TAPW+G+KV VP KFIVG+LDLVY IPGAK+YIHNG
Sbjct  221  SKFEQTGFTGGVNYYRAFPISWEFTAPWTGAKVKVPAKFIVGELDLVYHIPGAKDYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              K DVPLLE+VVVL+G AHF+NQE P E++ HI +F+ KF
Sbjct  281  EFKKDVPLLEEVVVLEGAAHFVNQERPDEISKHIFDFIQKF  321



>gb|EYU21013.1| hypothetical protein MIMGU_mgv1a010239mg [Erythranthe guttata]
Length=318

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AWHLCM+RPD+VKALVNLSV F PR P ++ V+  R++YG DHYICRFQEP
Sbjct  103  VGHDWGAFVAWHLCMYRPDRVKALVNLSVAFIPRDPEMNPVQKMRSLYGEDHYICRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G+IEAEF  IGVK  L+NI+ AF  P PLYFPK KGFT  +   P WL EE+LDYYV ++
Sbjct  163  GDIEAEFEKIGVKEVLKNIL-AFRNPAPLYFPKGKGFTYSADRAP-WLTEEELDYYVTKF  220

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            EKTGFTGG+NYYRA  L WEL APW+G++V VPTKFIVG+LDLVY  PG K++IH GG K
Sbjct  221  EKTGFTGGINYYRAFGLSWELNAPWAGAQVNVPTKFIVGELDLVYHTPGTKDFIHKGGFK  280

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              VPLL+++VVL+G AHF+NQE   E+N HI  FL +F
Sbjct  281  KFVPLLQEIVVLEGAAHFVNQERADEINQHIYAFLQQF  318



>gb|EYU43973.1| hypothetical protein MIMGU_mgv1a010247mg [Erythranthe guttata]
Length=318

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 172/218 (79%), Gaps = 2/218 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AWHLCM+RPD+VKALVNLSV F PR P ++ V+  R++YG DHYICRFQEP
Sbjct  103  VGHDWGAFVAWHLCMYRPDRVKALVNLSVAFIPRDPEMNPVQKMRSLYGEDHYICRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G+IEAEF  IGVK  L+NI+ AF  P PLYFPK KGFT  +   P WL EE+LDYYV ++
Sbjct  163  GDIEAEFEKIGVKEVLKNIL-AFRNPAPLYFPKGKGFTYSADRAP-WLTEEELDYYVTKF  220

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            EKTGFTGG+NYYRA  L WEL APW+G++V VPTKFIVG+LDLVY  PG K++IH GG K
Sbjct  221  EKTGFTGGINYYRAFGLSWELNAPWAGAQVNVPTKFIVGELDLVYHTPGTKDFIHKGGFK  280

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              VPLL+++VVL+G AHF+NQE   E+N HI  FL +F
Sbjct  281  KFVPLLQEIVVLEGAAHFVNQERADEINEHIYAFLQQF  318



>ref|XP_011090999.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 173/218 (79%), Gaps = 2/218 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AWHLC++RPD+VKALVNLSV F+PR+P ++ VE  R +YG+DHYICRFQEP
Sbjct  102  VGHDWGALVAWHLCLYRPDRVKALVNLSVAFYPRNPEVNPVEMFRGLYGDDHYICRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G+IEAEFA IGVK  ++NI FAF  P P YFPK KGF       P WL EEDLDYYV+ +
Sbjct  162  GDIEAEFANIGVKEVVKNI-FAFRTPGPFYFPKGKGFGYSLERAP-WLTEEDLDYYVSTF  219

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            E+TGFTGGVNYYRA  L+WEL APWSG++V VP KFIVG+ D+ Y +PG K++IH GG K
Sbjct  220  EQTGFTGGVNYYRAFGLNWELNAPWSGAQVKVPAKFIVGEFDITYHVPGTKDHIHKGGFK  279

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              VPLL++VVVL+G AHF+NQE P E+N HI  FL +F
Sbjct  280  KFVPLLQEVVVLEGAAHFINQERPDEINEHIYAFLKQF  317



>ref|NP_001275381.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81890.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 174/221 (79%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAWHLC+FRPDKVKALVNLSVH+ PR+ +++ +EG +A+YG D+YICRFQ P
Sbjct  102  VAHDWGALIAWHLCLFRPDKVKALVNLSVHYHPRNSNMNPIEGLKALYGEDYYICRFQVP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAEFAPIG K+ L+ ++  +  P P YFPK KG     D    L  WL EE+LDYY 
Sbjct  162  GEIEAEFAPIGAKSVLKKML-TYRDPAPFYFPKGKGLEAIADAPIVLSTWLSEEELDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++E+TGFTG +NYYRAL ++ ELTAPW+G++V VPTKFIVG+ DL Y + GAKEYIHNG
Sbjct  221  NKFEQTGFTGALNYYRALSINSELTAPWTGAQVNVPTKFIVGEFDLAYHMRGAKEYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVVL+G AHF+NQE P E++ HI +F+ KF
Sbjct  281  GFKKYVPLLEEVVVLEGAAHFVNQERPHEISKHIYDFIQKF  321



>ref|XP_009622776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=323

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 168/218 (77%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW LC+FRPDKVKALVNLSV F PR+P    +E  RA+YG D+Y+ RFQEP
Sbjct  103  VGHDWGAIIAWALCLFRPDKVKALVNLSVAFSPRNPKRKPLETLRAVYGEDYYVVRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            GEIEAEFA IG K  L+N + ++  P PLY PK K F D    LP+WLPE+++DY  ++Y
Sbjct  163  GEIEAEFAKIGTKKVLENFL-SYRNPGPLYLPKSKLFDDSPVILPSWLPEKEVDYVASKY  221

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            EK GFTGGVNYYRA+ L+WELTA W+G+KV VP KFIVGDLDL Y  PG K+Y+H GG+K
Sbjct  222  EKAGFTGGVNYYRAIDLNWELTAAWTGAKVKVPVKFIVGDLDLTYNAPGVKDYVHKGGMK  281

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLLE+VV+L+ V HFL QE P E+N HI +F + F
Sbjct  282  KDVPLLEEVVILENVGHFLQQEKPDEINKHIYDFFHGF  319



>gb|AAA81893.1| epoxide hydrolase, partial [Solanum tuberosum]
Length=305

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 172/221 (78%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA IAWHLC+FRPDKVKALVNLSVH+ PR+ +++ VEG +A+YG D+YICRFQ  
Sbjct  86   VAHDWGAFIAWHLCLFRPDKVKALVNLSVHYLPRNSNMNPVEGLKALYGEDYYICRFQVQ  145

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G+IEAEFAPIG K+ L+ ++  +  P P YFPK KG     D   AL  WL EE+LDYY 
Sbjct  146  GDIEAEFAPIGAKSVLKKML-TYRDPAPFYFPKGKGLEAIADAPIALSTWLSEEELDYYA  204

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++E+TGFTG +NYYRAL +D ELTAPW G++V VPTKFIVG+  LVY + GAKEYIHNG
Sbjct  205  SKFEQTGFTGALNYYRALSIDSELTAPWQGAEVKVPTKFIVGEFALVYHMRGAKEYIHNG  264

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVVL+G AHF+NQE P E++ HI +F+ KF
Sbjct  265  GFKKYVPLLEEVVVLEGAAHFVNQERPHEISKHIYDFIQKF  305



>ref|XP_004239805.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 173/221 (78%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA IAWHLC+FRPDKVKALVNLSVH+ PR+ +++ VEG +A+YG D+YICRFQE 
Sbjct  102  VAHDWGAFIAWHLCLFRPDKVKALVNLSVHYLPRNSNMNPVEGLKALYGEDYYICRFQEE  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G+IEAEFAPIG K+ L+ ++  +  P P  FPK KG     D  + L  WL EE+LDYY 
Sbjct  162  GDIEAEFAPIGAKSVLKKML-TYRDPAPFCFPKGKGLEAIADAPSDLSTWLSEEELDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++E TGFTG +NYYRAL ++ ELTAPW+G++V VPTKFIVG+ DLVY + GAKEYIHNG
Sbjct  221  NKFEHTGFTGALNYYRALSMNAELTAPWTGAQVNVPTKFIVGEFDLVYHMRGAKEYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVVL+G AHF+NQE P E++ HI +F+ KF
Sbjct  281  GFKKYVPLLEEVVVLEGAAHFVNQERPHEISKHIYDFIQKF  321



>ref|XP_010024724.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61194.1| hypothetical protein EUGRSUZ_H03958 [Eucalyptus grandis]
Length=323

 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 168/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI AWHLC+FRPD+VKALVNLSV F PRHP    +E  RA YG D+YICRFQEP
Sbjct  104  VGHDWGAIAAWHLCLFRPDRVKALVNLSVPFTPRHPARKPLESLRAAYGEDYYICRFQEP  163

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GE+EAEFA IG +  L+  +  +  P PL+ PK KGF   TD    LP+WL EED+DY+ 
Sbjct  164  GEMEAEFAQIGTRRVLEEFL-TYRNPGPLFLPKGKGFGHPTDTPIVLPSWLTEEDVDYFT  222

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++YE TGFTGG NYYRAL L+WELTAPW+G+++ VP KF+VGDLDL Y  PG K++IH G
Sbjct  223  SKYETTGFTGGFNYYRALDLNWELTAPWTGAQIRVPAKFMVGDLDLTYNSPGTKDFIHKG  282

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK  VP LEDVVV++GVAHF+++E PQEV  HI +F   F
Sbjct  283  GLKKYVPFLEDVVVMEGVAHFIHEERPQEVTQHIHDFFQMF  323



>emb|CAJ19276.1| putative epoxide hydrolase [Solanum commersonii]
Length=321

 Score =   296 bits (758),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 174/221 (79%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA IAWHLC+FRP+KVKALVNLSVH+ P++ +++ +EG +A+YG D+YICRFQ P
Sbjct  102  VAHDWGAFIAWHLCLFRPEKVKALVNLSVHYPPKNSNMNPIEGLKALYGEDYYICRFQVP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G+IEAEFAPIG K+ L+ ++  +  P P YFPK KG     D   AL  WL EE+LDYY 
Sbjct  162  GDIEAEFAPIGAKSVLKKML-TYRDPAPFYFPKGKGLEAIADAPIALSTWLSEEELDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++E+TGFTG +NYYRAL +  ELTAPW+G++V VPTKFIVG+ DLVY + GAKEYIHNG
Sbjct  221  SKFEQTGFTGALNYYRALSISSELTAPWTGAEVKVPTKFIVGEFDLVYHMQGAKEYIHNG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVVL+G AHF+NQE P E++ HI +F+ KF
Sbjct  281  GFKKYVPLLEEVVVLEGAAHFINQERPHEISKHIYDFIQKF  321



>ref|XP_010024723.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61193.1| hypothetical protein EUGRSUZ_H03957 [Eucalyptus grandis]
Length=323

 Score =   295 bits (754),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 169/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AWHL +FRPD+VKALVNLSV F PR+P    +E  RA YG D+YICRFQEP
Sbjct  104  VGHDWGAVVAWHLSLFRPDRVKALVNLSVPFTPRNPAQKPLESLRAGYGEDYYICRFQEP  163

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GE+EAEFA IG +  L+  +     P+ L+ PK K F    D    LP+WL EED+DYY 
Sbjct  164  GEMEAEFAQIGTRRVLEEFL-TIRNPDQLFLPKGKAFGYPMDDLIILPSWLTEEDVDYYA  222

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++YEKTGFTGG NYYRAL L+WELTAPW+G+++ VP KFIVGDLDL Y  PGAK+YIH G
Sbjct  223  SKYEKTGFTGGFNYYRALDLNWELTAPWTGAQIRVPAKFIVGDLDLTYTSPGAKDYIHRG  282

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK  VP LEDVVV+QGVAHF+++E PQEV +HI +F  KF
Sbjct  283  GLKKYVPFLEDVVVMQGVAHFIHEERPQEVTHHIHDFFGKF  323



>gb|KDO71745.1| hypothetical protein CISIN_1g017221mg [Citrus sinensis]
Length=375

 Score =   293 bits (751),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 173/221 (78%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LC+FRPD+VKALVNLSV F PR+P++  ++  +A+YG+D+YICRFQEP
Sbjct  156  VGHDWGALIAWYLCLFRPDRVKALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEP  215

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAEFA +G +T L+  +  +  P PL+ PK KGF    D   ALP+WL EED+ YY 
Sbjct  216  GEIEAEFAQMGTETVLKEFL-TYRNPGPLFLPKGKGFGHPPDAQIALPSWLSEEDVKYYA  274

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++YEK GFTGG+NYYR ++L+WEL APW+G+++ VP KFIVGDLDL Y  PG K+YI+ G
Sbjct  275  SKYEKAGFTGGINYYRNIELNWELLAPWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKG  334

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+V+V++GV HF+N+E P EVN HI NF  KF
Sbjct  335  GFKKAVPLLEEVIVMEGVGHFINEEKPDEVNKHIYNFFQKF  375



>emb|CDO98838.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 175/221 (79%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+LCMFRPDKVKALVN+SV F PR+P    VE  RA  G+D+YICRFQEP
Sbjct  102  VGHDWGAMVAWYLCMFRPDKVKALVNMSVAFIPRNPLAKPVEMLRAYGGDDYYICRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD---GSTALPAWLPEEDLDYYV  418
            G+IEAE A +G K  L+ ++ A+  P PL++PK KGF D   G   LP+WL EED+DYY 
Sbjct  162  GDIEAELAQMGCKDFLKKML-AYRTPGPLFWPKGKGFGDSPDGPVVLPSWLTEEDVDYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++++KTGFTGG+NYYRA+ L WELTAPW+G+K+ VPTKF+VG+LDL Y + G ++YIH G
Sbjct  221  SKFDKTGFTGGLNYYRAVNLHWELTAPWTGAKIKVPTKFVVGELDLTYYMRGVQDYIHKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G KNDVPLLEDVVV++  AHF+NQE P E+N HI +F+ ++
Sbjct  281  GFKNDVPLLEDVVVVKDAAHFINQERPDEINKHIYDFIQRY  321



>ref|XP_003550367.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Glycine 
max]
Length=319

 Score =   291 bits (745),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 168/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+ AW L ++RP++++ALVNLSV F PR+P    ++  RA+YGND+YICRFQEP
Sbjct  100  VGHDWGAMTAWSLSLYRPERIRALVNLSVVFTPRNPKRKPLDTLRAVYGNDYYICRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAEFA IG    L+  +  +  P PLY PK K F   TD   ALP+WL EE+ DYY 
Sbjct  160  GEIEAEFAQIGTARVLKEFL-TYRNPGPLYLPKGKAFAHPTDSPIALPSWLSEEECDYYA  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++Y+KTGFTGG+NYYR L L+WELTA W+G++V VP KFIVGDLDL Y  PGAKEYIH G
Sbjct  219  SKYDKTGFTGGLNYYRNLDLNWELTASWTGAQVKVPVKFIVGDLDLTYNAPGAKEYIHKG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLEDVVVL+G  HFL+QE P E++NHI +F  KF
Sbjct  279  GFKRDVPLLEDVVVLEGAGHFLHQERPDEISNHIYDFFKKF  319



>ref|XP_006489040.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=375

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 172/221 (78%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LC+FRPD+VKALVNLSV F PR+P++  ++  +A+YG+D+YICRFQEP
Sbjct  156  VGHDWGALIAWYLCLFRPDRVKALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEP  215

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAEFA +G +T L+  +  +  P PL+ PK KGF    D    LP+WL EED+ YY 
Sbjct  216  GEIEAEFAQMGTETVLKEFL-TYRNPGPLFLPKGKGFGHPPDARIDLPSWLSEEDVKYYA  274

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++YEK GFTGG+NYYR ++L+WEL APW+G+++ VP KFIVGDLDL Y  PG K+YI+ G
Sbjct  275  SKYEKAGFTGGINYYRNIELNWELLAPWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKG  334

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+V+V++GV HF+N+E P EVN HI NF  KF
Sbjct  335  GFKKAVPLLEEVIVMEGVGHFINEEKPDEVNKHIYNFFQKF  375



>ref|XP_006419515.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
 gb|ESR32755.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
Length=375

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 172/221 (78%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LC+FRPD+VKALVNLSV F PR+P++  ++  +A+YG+D+YICRFQEP
Sbjct  156  VGHDWGALIAWYLCLFRPDRVKALVNLSVVFNPRNPNMKPLQVFKAVYGDDYYICRFQEP  215

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAEFA +G +T L+  +  +  P PL+ PK KGF    D    LP+WL EED+ YY 
Sbjct  216  GEIEAEFAQMGTETVLKEFL-TYRNPGPLFLPKGKGFGHPPDARIDLPSWLSEEDVKYYA  274

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++YEK GFTGG+NYYR ++L+WEL APW+G+++ VP KFIVGDLDL Y  PG K+YI+ G
Sbjct  275  SKYEKAGFTGGINYYRNIELNWELLAPWTGAQIKVPVKFIVGDLDLTYNAPGTKDYINKG  334

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+V+V++GV HF+N+E P EVN HI NF  KF
Sbjct  335  GFKKAVPLLEEVIVMEGVGHFINEEKPDEVNKHIYNFFQKF  375



>ref|XP_006342824.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=325

 Score =   288 bits (737),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 164/218 (75%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW +C++RPDK+KALVN+SV FFPR+P +  +   RA+YG+++YI RFQEP
Sbjct  101  VGHDWGAMIAWDMCLYRPDKIKALVNMSVPFFPRNPIIRPIVALRAIYGDEYYIIRFQEP  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            GEIE EFA IG KT L+ ++     PEPL  PK K F D    LP WL E D+DYY  +Y
Sbjct  161  GEIEEEFAQIGTKTVLEKML-TIRDPEPLKLPKGKPFDDSPVILPPWLTETDVDYYATKY  219

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            E TGFTGG+NYYRAL L+WELTAPW+G+K+ VP KFIVGDLDL Y   G K YI+ GGLK
Sbjct  220  EHTGFTGGLNYYRALDLNWELTAPWTGAKIEVPVKFIVGDLDLTYNSAGVKFYINKGGLK  279

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             +VPLLEDVV+L+GVAHFL QE P EVN HI  F   F
Sbjct  280  KNVPLLEDVVILKGVAHFLQQEKPDEVNEHIHVFFQSF  317



>ref|XP_009622179.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=325

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 165/218 (76%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LC++RPDKVKALVN+SV F P++P +  +   RA YG+++YI RFQEP
Sbjct  105  VGHDWGAMIAWALCLYRPDKVKALVNMSVPFTPQNPIIRPIARLRATYGDEYYIIRFQEP  164

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            GEIE EFA IG KT L+ ++     PEPL  PK K F      LP WL E+++DYY  +Y
Sbjct  165  GEIEEEFAQIGTKTVLEKLL-TNRNPEPLKVPKGKPFDKSPVKLPPWLTEKEVDYYATKY  223

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            E+TGFTGG+NYYRAL L+WELTAPW+G+K+ VP KFIVGDLD+ Y   G K+YIH GGLK
Sbjct  224  EQTGFTGGLNYYRALDLNWELTAPWTGAKIKVPVKFIVGDLDITYNAAGVKDYIHKGGLK  283

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLLEDVV+L+GVAHFL QE P EVN HI  FL  F
Sbjct  284  KDVPLLEDVVILKGVAHFLQQEKPDEVNKHIHAFLQGF  321



>ref|XP_004508197.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=357

 Score =   288 bits (736),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 167/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LC++RP+++KA+VNLSV F PR+P    +E  RA+YGND+YI RFQEP
Sbjct  138  VGHDWGAMIAWSLCLYRPERIKAVVNLSVSFTPRNPKRKPLETLRAVYGNDYYISRFQEP  197

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G+IEAEFA IG    L+  +  +  P PLY PK KGF    D    LP+WL EE+ +YY 
Sbjct  198  GDIEAEFAEIGTARVLKEFL-TYRNPGPLYLPKGKGFGHPIDSPIVLPSWLSEEECNYYA  256

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++Y+KTGFTGG+NYYR L L+WELTAPWSG+K+ VP KFIVGD DL Y  PGAK+YI  G
Sbjct  257  SKYDKTGFTGGLNYYRNLDLNWELTAPWSGAKIKVPVKFIVGDQDLTYNAPGAKDYILKG  316

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G+K DVPLLEDVVV++G  HF++QE P E+N HI +F  KF
Sbjct  317  GMKRDVPLLEDVVVIEGAGHFIHQERPDEINKHIYDFFKKF  357



>ref|XP_004229258.2| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=325

 Score =   286 bits (731),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 166/216 (77%), Gaps = 1/216 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LC++RPDK+ ALVN+SV +FPR+P +  +E  RA+YG+++YI +FQEP
Sbjct  101  VGHDWGAMIAWALCLYRPDKINALVNMSVPYFPRNPIIRPIEALRAIYGDEYYIIKFQEP  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G+IEAEFA IG KT L+ I+     P+PL  PK K F D    LP WL EED+DYY  +Y
Sbjct  161  GKIEAEFAQIGTKTVLEKIL-TMRDPDPLKMPKGKPFDDSPVILPPWLTEEDVDYYATKY  219

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            E TGFTGG+NYYRA+ L+WELTAPW+G+K+ VP KFIVGDLDL Y + G K+YI+ GG K
Sbjct  220  EHTGFTGGLNYYRAIDLNWELTAPWTGAKIEVPVKFIVGDLDLTYNLVGVKDYINKGGFK  279

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLN  121
             +VPLLEDVV+L+GVAHFL QE P EVN HI  F  
Sbjct  280  KNVPLLEDVVILKGVAHFLQQEEPDEVNQHIHVFFQ  315



>ref|XP_010105136.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03944.1| Epoxide hydrolase 2 [Morus notabilis]
Length=347

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 169/220 (77%), Gaps = 4/220 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+I+W+LC+FRPD+VKALVNLSV F PR+P+    E  RA+YG+D+Y+CRFQEP
Sbjct  85   VGHDWGALISWYLCLFRPDRVKALVNLSVAFNPRNPNRKPYETLRALYGDDYYVCRFQEP  144

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAEFA IG  T ++   + +  P+PL+ PK K F    D   ALP+W+ EED+DYY 
Sbjct  145  GEIEAEFAEIGAATVIKEF-YTYRSPKPLFMPKGKCFGHPKDTPIALPSWVSEEDMDYYA  203

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR +  +WELTAPW+G+K+ VP KFIVGD DLVY + G K+YIH G
Sbjct  204  SKFEKTGFTGGINYYRNIDRNWELTAPWTGAKMQVPVKFIVGDQDLVYNLYGTKDYIHKG  263

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNK  118
            G K DVP L++VVV++GV HF+N+E   EV  HI +F +K
Sbjct  264  GFKRDVPFLQEVVVMEGVGHFVNEEKADEVTQHIYDFFSK  303



>ref|XP_009757467.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=340

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 164/218 (75%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LC +RPDKV ALVN++V F PR+P +  +   RA YG+++YI RFQEP
Sbjct  105  VGHDWGAMIAWALCFYRPDKVNALVNMTVPFAPRNPIIRPIARLRATYGDEYYIIRFQEP  164

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            GEIE EFA IG KT L+ ++     PEPL  PK K F +    LP WL E+D+DYY ++Y
Sbjct  165  GEIEEEFAKIGTKTVLEKLL-TNRNPEPLMLPKGKPFDESPVKLPPWLTEKDVDYYASKY  223

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            ++TGFTGG+NYYRAL L+WELTAPW+G+KV VP KFIVGDLD+ Y   G K+YIH GG K
Sbjct  224  QQTGFTGGLNYYRALDLNWELTAPWTGAKVKVPVKFIVGDLDITYSAAGVKDYIHKGGFK  283

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLLEDVV+ +GVAHFL QE P EVN  I++FL  F
Sbjct  284  KDVPLLEDVVIFKGVAHFLPQEKPDEVNKQILDFLQGF  321



>ref|XP_006349824.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Solanum 
tuberosum]
Length=323

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 165/218 (76%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LC+ RPDKVKALVN+SV F PR+P    +E  +A+YG+D+YI RFQEP
Sbjct  104  VGHDWGALIAWNLCLLRPDKVKALVNMSVPFSPRNPKRKPIESLKAIYGDDYYIVRFQEP  163

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G +EAEFA  G K  L+N +  +  P PLY PK K F D    LP+WL ++++DY+ ++Y
Sbjct  164  GVMEAEFAKTGTKKVLENYL-TYRNPGPLYLPKGKPFDDSPVILPSWLSQKEVDYFASKY  222

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            E+TGFTGG NYYRAL L+WELTA WSG+KV VP KFIVGDLDL Y  PGAK+YI+ GG+K
Sbjct  223  EQTGFTGGFNYYRALDLNWELTAAWSGAKVKVPVKFIVGDLDLTYNTPGAKDYINKGGMK  282

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLLE VV+L+ V HFL QE P E+N HI +F   F
Sbjct  283  KDVPLLEKVVILENVGHFLQQEKPDEINKHIHDFFKGF  320



>ref|XP_008789846.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LCM RPD+V+ALVN+SV F PR+P    V+  RA++G+DHYICRFQEP
Sbjct  98   VGHDWGAVVAWWLCMLRPDRVRALVNMSVAFSPRNPARRPVDSLRALFGDDHYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G +EAEFA I     L+  + A+ +PE L   K+KGF    D    LP+WL EED++YY 
Sbjct  158  GAVEAEFARISTALLLKKFL-AYRKPEALLVSKEKGFGGSPDTEITLPSWLTEEDVNYYT  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EK+GFTGG+NYYR L L+WELTAPW+G ++ VP KFIVGDLDL Y  PG ++Y+H G
Sbjct  217  SKFEKSGFTGGLNYYRCLNLNWELTAPWTGVQIKVPVKFIVGDLDLTYHTPGIQDYLHKG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L DVVV+QGV HFLNQE P E+++HI  F+ KF
Sbjct  277  GFKRDVPFLHDVVVMQGVGHFLNQEKPHEISDHIYEFIQKF  317



>ref|XP_007154300.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
 gb|ESW26294.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
Length=319

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+ AW L +FRPD+++ALVNLSV F PR+P    ++  +A+YGND+YICRFQEP
Sbjct  100  VGHDWGAMTAWVLSLFRPDRIRALVNLSVAFTPRNPKRKPLDTLKAVYGNDYYICRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEF  IG +  L+  +  +  P P+Y  + KGF    D    LP+WL EE+  YY 
Sbjct  160  GNIEAEFEQIGTERVLKEFL-TYRNPAPIYLHEGKGFGHPIDSPLKLPSWLSEEECHYYA  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++YEKTGFTGG+NYYR L L+WELTAPW+G+KV VP KFIVGDLDL Y  PGAK+YIH G
Sbjct  219  SKYEKTGFTGGLNYYRNLDLNWELTAPWTGAKVKVPVKFIVGDLDLTYNAPGAKDYIHKG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK DVPLLEDVVV+QG  HFL+QE P E+N HI +F+ KF
Sbjct  279  GLKRDVPLLEDVVVIQGAGHFLHQERPHEINQHIYDFVKKF  319



>ref|XP_009788447.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=323

 Score =   283 bits (725),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 162/218 (74%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW LC+FRPDKVKALVNLSV F  R+P    +E   A+YG D+YI RFQEP
Sbjct  103  VGHDWGAIIAWALCLFRPDKVKALVNLSVAFSLRNPKRKPLETLCAVYGEDYYIVRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            GEIEAEFA IG K  L+  + ++  P PLY PK K F D    LP+WLPE+D+DY  ++Y
Sbjct  163  GEIEAEFAKIGTKKVLEKFL-SYRNPGPLYLPKGKPFDDNPVILPSWLPEKDVDYIASKY  221

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            EK+GFTGGVNYYRA+ L+WELTA W+G KV VP KFIVGDLDL Y  PG K+Y+H G +K
Sbjct  222  EKSGFTGGVNYYRAIDLNWELTAAWTGGKVKVPVKFIVGDLDLTYNAPGVKDYVHKGRMK  281

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLLE+VV+L+ V HFL QE P  +N HI  F + F
Sbjct  282  KDVPLLEEVVILENVGHFLQQEKPDVINKHIHEFFHGF  319



>gb|EYU43974.1| hypothetical protein MIMGU_mgv1a009814mg [Erythranthe guttata]
Length=331

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 168/218 (77%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LC++RPDKVKALVNLSV F  R+P+   +E  R++YGN++YICRFQEP
Sbjct  106  VGHDWGAVMAWALCLYRPDKVKALVNLSVPFSRRNPNRKPIETLRSVYGNEYYICRFQEP  165

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G+IE EF+ IG K  L+N +  +  P PL+ PK K F+D  T+LP WL +ED++YY ++Y
Sbjct  166  GKIEQEFSQIGTKNVLKNFL-TYRNPGPLHLPKSKAFSDTETSLPPWLSDEDVNYYASKY  224

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            + TGFTG +NYYRAL ++WELT  WS  ++ V  KF+VGDLDL Y  PG KEYIHNGG K
Sbjct  225  DATGFTGALNYYRALDINWELTGAWSRGEIKVAVKFMVGDLDLTYNSPGTKEYIHNGGFK  284

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLL++VVV++ VAHF++QE P EVN +I++F N +
Sbjct  285  KDVPLLKEVVVMKDVAHFIHQEKPDEVNANILSFFNNY  322



>gb|KHG21329.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=386

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 167/220 (76%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LCMFRPD+VKALVN+SV F PR+P++  +EG RA+YG+D+YICRFQEP
Sbjct  168  VGHDWGALIAWWLCMFRPDRVKALVNMSVAFNPRNPNMKPLEGLRALYGDDYYICRFQEP  227

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK--GFTDGSTALPAWLPEEDLDYYVN  415
            G IEAEF  +G +  L+   F +  P PL  PK K  G  D   +LP+W  EED  YY++
Sbjct  228  GVIEAEFREMGYERVLKGF-FTYRDPCPLLIPKGKYFGQPDTPISLPSWFSEEDCKYYLS  286

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            +YEK GFTG +NYYR + L+W+LTAPW+GSKV VP KFIVGD DL Y  PG K+Y+H GG
Sbjct  287  QYEKKGFTGALNYYRNINLNWQLTAPWTGSKVKVPVKFIVGDQDLTYNGPGIKDYLHKGG  346

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK +VPLLE VVV++GVAHFL +E P EVN HI +F NKF
Sbjct  347  LKKNVPLLEQVVVMEGVAHFLQEENPDEVNKHIHDFFNKF  386



>ref|XP_004252913.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=323

 Score =   281 bits (720),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 162/218 (74%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW LC+ RPDKVKALVN+SV F PR+P    +E  +A+YG+D+Y+ RFQEP
Sbjct  104  VGHDWGAKIAWELCLLRPDKVKALVNMSVPFSPRNPKRKPIESLKAIYGDDYYVVRFQEP  163

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G +EAEFA IG K  L   +  +  P PLY PK K F D    LP+WL ++++DY+ ++Y
Sbjct  164  GVMEAEFAKIGTKKVLGKFL-TYRNPGPLYMPKGKPFDDSPVILPSWLSQKEVDYFASKY  222

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            E+TGFTGG NYYRAL L+WELTA WSG+KV VP KFIVGDLDL Y  PGAK+YI+ GG+K
Sbjct  223  EQTGFTGGFNYYRALDLNWELTAAWSGAKVKVPVKFIVGDLDLTYNAPGAKDYINKGGMK  282

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLLE VV+L+ V HFL QE P E+N HI +F   F
Sbjct  283  KDVPLLEKVVILENVGHFLQQEKPDEINKHIHDFFKGF  320



>emb|CDP10752.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 176/222 (79%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAWHLCMFRPDKV+ALVNLSV F PR+P   LVE  R+ YGND+Y+CRFQEP
Sbjct  102  VGHDWGAFIAWHLCMFRPDKVRALVNLSVAFIPRNPSCSLVESLRSAYGNDYYMCRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDG---STALPAWLPEEDLDYYV  418
            GEIEAEFA IGVK  ++ ++  +  P PL+FP+ KGF D       LP+WL +ED+DY+V
Sbjct  162  GEIEAEFAQIGVKNFIKKML-TYRTPGPLFFPQGKGFGDSPDTPVVLPSWLTDEDVDYFV  220

Query  417  NRYEKTGFTGGVNYYRAL-KLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            +++EKTGFTGGVNYYRAL  + WELTAPW+G++V VP KF++G+LDL Y +PG +EYIH 
Sbjct  221  SKFEKTGFTGGVNYYRALNNVTWELTAPWTGAQVKVPAKFVIGELDLTYHMPGVQEYIHK  280

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVPLLE+VVV++  AHF+NQE P EV+ HI +F+ +F
Sbjct  281  GGFKRDVPLLEEVVVVKDAAHFINQERPDEVSKHIHDFIKQF  322



>ref|XP_010039619.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW84772.1| hypothetical protein EUGRSUZ_B015792 [Eucalyptus grandis]
Length=317

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 172/221 (78%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA++AW+LC+ RPD+VKA+V+LSV + PR+P +  ++G+RA YG+D+Y+CRFQEP
Sbjct  98   VAHDWGALMAWYLCLLRPDRVKAMVSLSVPWMPRNPGMKPLDGYRAAYGDDYYMCRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEA+FA +G +  ++  +  +  P PL+F K KGF    D    LP+WL +ED+DYYV
Sbjct  158  GEIEAQFAEMGTRRVIEGFL-TYRIPGPLFFVKGKGFGHPVDDPVVLPSWLTQEDIDYYV  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++E+ GFTGG+NYYR L  +WEL APW G +V VP KFIVG+LDLVY +PG K++IH G
Sbjct  217  DKFEEKGFTGGINYYRNLNRNWELMAPWDGVQVKVPVKFIVGELDLVYHMPGVKDFIHKG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK  VPLLE+VVV++GVAHFLNQE PQ+   HI +FL+KF
Sbjct  277  GLKKTVPLLEEVVVMEGVAHFLNQERPQDTTQHIYDFLSKF  317



>ref|XP_009391487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LCMFRPDKVKALVNLSV F PR+P    VE  R  YG+D+Y+CRFQEP
Sbjct  98   VGHDWGALVAWCLCMFRPDKVKALVNLSVVFRPRNPTGKPVETLRTAYGDDYYVCRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDG---STALPAWLPEEDLDYYV  418
            G  EAEF  +G    ++  +  +  P P+  PK+KGF D      ALP+WL E+DL+Y+ 
Sbjct  158  GRTEAEFGRVGTSLIIKKFL-TYHDPGPVIVPKEKGFGDAPDKENALPSWLSEDDLNYFA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++EK+GFTGG+NYYRAL L+WELTAPW+G ++ VP KFIVGD DL Y  PG ++YI  G
Sbjct  217  GKFEKSGFTGGLNYYRALDLNWELTAPWTGVQIKVPVKFIVGDQDLAYHFPGVQDYISKG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLED+VV++GV HF+NQE PQE++N I+ F+ KF
Sbjct  277  GFKRDVPLLEDMVVMEGVGHFINQERPQEISNIILEFIKKF  317



>ref|XP_010921626.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LCMFRPDKV+ALVNLSV F PR P    VE  RA+YG+D+YIC FQEP
Sbjct  99   VGHDWGAMVAWSLCMFRPDKVRALVNLSVAFRPRSPDRKPVETLRAVYGDDYYICTFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G  EAEFA I     ++  +  +  P P+  PK+ GF    D    LP+WL EED++Y+ 
Sbjct  159  GRTEAEFACIPTALVIKKFL-TYHDPSPVIVPKENGFAASPDKEITLPSWLSEEDINYFA  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++++K+GFTGG+NYYRAL L+WELTAPW+G ++ VP KFIVG+ DL+Y IPG K+YIH G
Sbjct  218  SKFDKSGFTGGLNYYRALDLNWELTAPWTGMQIKVPVKFIVGNQDLMYNIPGVKDYIHKG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP LEDVVV++G  HF+NQE PQE  +HI  F+ KF
Sbjct  278  GFKKDVPFLEDVVVIEGAGHFINQEKPQETTDHIYEFIQKF  318



>gb|KJB72716.1| hypothetical protein B456_011G192300 [Gossypium raimondii]
Length=386

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 169/220 (77%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LCMFRPD+VKALVN+SV F PR+P++  +EG RA+YG+D+YICRFQEP
Sbjct  168  VGHDWGALIAWWLCMFRPDRVKALVNMSVAFNPRNPNMKPLEGLRALYGDDYYICRFQEP  227

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK--GFTDGSTALPAWLPEEDLDYYVN  415
            G IEAEF  +G +  L+  +  +  P PL  PK K  G  D   +LP+W  EED  YY++
Sbjct  228  GVIEAEFREMGYERVLKGFL-TYRDPCPLLIPKGKYFGQPDTPISLPSWFSEEDCKYYLS  286

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            +YEK GFTGG+NYYR + L+W+LTAPW+GSK+ VP KFIVGD DL Y  PG K+Y+H G 
Sbjct  287  QYEKKGFTGGLNYYRNINLNWQLTAPWTGSKIKVPVKFIVGDQDLTYNAPGIKDYLHKGS  346

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK +VPLLE+VVV++GVAHFL++E P EV+ HI +F NKF
Sbjct  347  LKKNVPLLEEVVVMEGVAHFLHEEKPDEVHKHIHDFFNKF  386



>ref|XP_010911257.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LCM RPD+V+ALVN+SV F PRHP    V+  +A++G+DHYICRFQEP
Sbjct  98   VGHDWGAVVAWWLCMLRPDRVRALVNMSVAFSPRHPARRPVDSLKALFGDDHYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G  EAEFA I     L+  +  + +P PL   K+KGF    +    LP+WL EED++YY 
Sbjct  158  GAAEAEFARINTALLLKKFL-TYRKPAPLLISKEKGFGGSPNTEITLPSWLTEEDVNYYT  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EK+GFTGG+NYYR L L+WELTAPW+G ++ VP KFIVGDLDL Y  PG +++IH G
Sbjct  217  SKFEKSGFTGGLNYYRCLNLNWELTAPWTGVQIKVPVKFIVGDLDLTYHTPGIQDHIHKG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K +VP L+DV+V+QGV HF+NQE P E+++HI  F+ KF
Sbjct  277  GFKREVPFLQDVIVMQGVGHFINQERPHEISDHIYEFIRKF  317



>ref|XP_004296863.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=319

 Score =   278 bits (712),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 167/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LC+FRPD+VKALVNLSV F PR+P     E  RA+YG+D+Y+CRFQEP
Sbjct  100  VGHDWGALIAWYLCLFRPDRVKALVNLSVAFSPRNPQRKTTEMLRAVYGDDYYMCRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFA IG    ++  +  +  P PL+ PK KGF    D    LP+WL E+D++YYV
Sbjct  160  GEIEAEFAQIGTARVMKEFL-TYRHPGPLFLPKGKGFRHPPDAPIPLPSWLSEDDVNYYV  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            + +EK GFTGG+NYYR    +WELTAPW+G+++ VP KFIVGD DLVY   GAK++IH G
Sbjct  219  SFFEKKGFTGGINYYRNFDRNWELTAPWTGARIKVPVKFIVGDQDLVYNSLGAKDFIHKG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVV++GV HF+N+E P E++ HI +F+ KF
Sbjct  279  GFKKYVPLLEEVVVMEGVGHFINEERPNEISEHIHDFIKKF  319



>ref|XP_010649574.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
 emb|CBI22972.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   278 bits (712),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 169/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW+LC+FRPD+VKALVN+SV +FPR+P    +E +R +YG+D Y+CRFQEP
Sbjct  98   VGHDWGAIIAWYLCLFRPDRVKALVNMSVAYFPRNPMHKPLEIYRHLYGDDFYVCRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTA---LPAWLPEEDLDYYV  418
            G+IE E A +G  T L++I FA   P P   PK K F D S A   LP WLPEE++++YV
Sbjct  158  GQIEIEIAEVGTATALKSI-FANRDPSPPCLPKGKAFQDVSGAPIVLPPWLPEEEVNFYV  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++E+TGFTGG+NYYR    +WELTAPW+GS++ VPTKF+VGD+DL Y   GAKEYIH+G
Sbjct  217  TKFEETGFTGGINYYRNFDRNWELTAPWTGSQIKVPTKFMVGDMDLTYHFAGAKEYIHSG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              K +VPLLE+VVV++GV HFL++E   E+N HI +F  KF
Sbjct  277  EFKKNVPLLEEVVVMEGVGHFLHEEKADEINKHIHDFFQKF  317



>ref|XP_009352305.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   278 bits (712),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWG+IIAW+LC+FRPD++KALV+LSV F PR+P   +++  +A+YG+D+YICRFQEP
Sbjct  102  VAHDWGSIIAWYLCLFRPDRLKALVSLSVAFSPRNPQRKIIKSLQAVYGDDYYICRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA +G    L+  +  +  P PL+ PK KGF   TD    LP+WL E++++YY 
Sbjct  162  GVIEAEFAQMGTTRILKEFL-TYRNPGPLFLPKGKGFGRPTDAPIVLPSWLSEDEVNYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++EKTGFTGG+NYYR L L+WELT  W+G++V VP KFIVGD DLVY  PGAK++IH G
Sbjct  221  TKFEKTGFTGGINYYRNLDLNWELTTAWTGAQVKVPVKFIVGDQDLVYNSPGAKDFIHKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K   PLLE VVV++GVAHFL QE P E+N HI +F+  F
Sbjct  281  GFKKYAPLLEQVVVMEGVAHFLQQEKPDEINTHIHDFIKNF  321



>gb|KDP27824.1| hypothetical protein JCGZ_18904 [Jatropha curcas]
Length=321

 Score =   278 bits (711),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAWHLC+FRPD+VKALVNLSV F  R+P+   +E  RA+YG+D+Y+CRFQEP
Sbjct  102  VGHDWGAYIAWHLCLFRPDRVKALVNLSVVFALRNPNGKRIEVMRAVYGDDYYMCRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFA +G +  L+   F +  P P++ PK K F+   +    LP+W  EED+ YY 
Sbjct  162  GEIEAEFAELGTERILKEF-FTYRHPGPIFLPKGKAFSRLPETPLVLPSWFSEEDVQYYT  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++EK GFTGG+NYYR L  +WELTAPW+G++V VP KFIVGD DL Y   GAK+YI  G
Sbjct  221  NKFEKKGFTGGLNYYRILDRNWELTAPWNGAQVKVPAKFIVGDQDLTYNSFGAKDYIEKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VP LE+VV+++GVAHFLNQE P+E+N HI +F  KF
Sbjct  281  GFKKAVPFLEEVVIMEGVAHFLNQEKPEEINKHIYDFFQKF  321



>gb|KFK41013.1| hypothetical protein AALP_AA2G073900 [Arabis alpina]
Length=325

 Score =   278 bits (711),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LCM+RP+KVKALVN+SV F PR+P    V   R ++G+D+YICRFQ+P
Sbjct  105  VGHDWGAMIAWQLCMYRPEKVKALVNMSVVFTPRNPDRVPVPTLRRVFGDDYYICRFQKP  164

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKD---KGFTDGSTALPAWLPEEDLDYYV  418
            GEIEAEF  +G +  L+  +  +  P+PL+ PK    KG  + + ALP WL +EDLDYY 
Sbjct  165  GEIEAEFKKLGTEKVLKEFL-TYKTPKPLFIPKGELFKGSENAAAALPHWLTQEDLDYYT  223

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +YEK GFTG +NYYR L   WELTAPW+G+K+ VP KFIVGD DL Y  PGAKEYIH G
Sbjct  224  TKYEKRGFTGAINYYRNLDRSWELTAPWTGAKIAVPVKFIVGDQDLTYNSPGAKEYIHGG  283

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLL++ VVL+G+ HFL++E P+E+N HI +F  KF
Sbjct  284  GFKKDVPLLDETVVLEGLGHFLHEENPEEINQHIHSFFQKF  324



>ref|XP_010105137.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03945.1| Epoxide hydrolase 2 [Morus notabilis]
Length=319

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LC+FRPD+VKALVNLSV F PR+P    +   RA+ G+++YICRFQE 
Sbjct  100  VGHDWGALIAWYLCLFRPDRVKALVNLSVAFNPRNPRRRPIHSMRAVCGDNYYICRFQEF  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAE   IG+   L+  +  +  P PL+ PK KGF    D   +LP WL EEDL YYV
Sbjct  160  GEIEAELEKIGIDRVLREFL-TYRHPGPLFLPKGKGFERPVDVPISLPDWLSEEDLKYYV  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR +  +WEL APW+G+ + VP KFIVGDLDL Y   GAK+Y+H G
Sbjct  219  SKFEKTGFTGGINYYRNIDRNWELVAPWTGTPIKVPVKFIVGDLDLTYNSFGAKDYVHKG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L++VV+++GV HF+NQE PQE+N+HI +F NKF
Sbjct  279  GFKRDVPFLQEVVIMEGVGHFINQERPQEINHHIYDFFNKF  319



>ref|XP_008784769.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=322

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LC+FRPDKV+ALVNLSV F PR P    VE  RA+YG+D+YIC FQEP
Sbjct  103  VGHDWGALVAWSLCLFRPDKVRALVNLSVAFRPRSPDRKPVETFRALYGDDYYICTFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G  EAEFA I     ++  +  +  P P+   K+ GF    D    LP+WL EED+DY+ 
Sbjct  163  GRTEAEFARIPTALVIKKFL-TYHDPGPVIVSKENGFAASPDKEITLPSWLSEEDVDYFA  221

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++++K+GFTGG+NYYRAL L+WELTAPW+G ++ VP KFIVG+ DL+Y IPG K+YIH G
Sbjct  222  SKFDKSGFTGGLNYYRALDLNWELTAPWTGMQIKVPVKFIVGNQDLIYNIPGVKDYIHKG  281

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G + DVP LEDVVV++G  HF+NQE PQE+ +HI  F+ KF
Sbjct  282  GFERDVPFLEDVVVIEGAGHFINQEKPQEITDHIYEFIQKF  322



>ref|XP_010693594.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=362

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 166/218 (76%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+I W LC+FRPD+VKA V++SV F PR+P++ L++   A YG D+YICRFQ P
Sbjct  146  VGHDWGAVIGWWLCLFRPDRVKAFVSMSVAFSPRNPNMKLLDMLCAAYGPDYYICRFQVP  205

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            GEIE+E A  G    L   IF+F  P PL  PK K FTD ++  P WL +E+  YYV+++
Sbjct  206  GEIESEIAEAGGADKLLRKIFSFRDPGPLMLPKGKAFTDMAS-YPNWLSQEESSYYVDKF  264

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
             K+GFTGG+NYYRAL L+WELTAPW+G++V VP KF+VGDLDL Y +PG KEYI+ GG+K
Sbjct  265  TKSGFTGGLNYYRALNLNWELTAPWTGAQVEVPVKFVVGDLDLAYHMPGVKEYINQGGMK  324

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLLE+VV+L+GVAHFL QE P  V +HI +F+ KF
Sbjct  325  KDVPLLEEVVILEGVAHFLQQEKPDVVTDHIYDFIRKF  362



>ref|XP_006414412.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
 gb|ESQ55865.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
Length=374

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LC +RP+KVKALVN+SV F PR+P    V   R ++G+D+YICRFQ+P
Sbjct  152  VGHDWGAMIAWQLCQYRPEKVKALVNMSVVFSPRYPDRVPVPTLRHVFGDDYYICRFQKP  211

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEF  +G +  L+  +  +  P PLY PK K F    + ++ALP WL +EDLDYYV
Sbjct  212  GEIEAEFKKLGTENVLKKFL-TYKTPGPLYLPKPKLFKRSENAASALPPWLTQEDLDYYV  270

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N+Y+K GFTG +NYYR +  +WELTAPW+G+K+ VP KFIVGD DL Y  PGAKEYIH G
Sbjct  271  NKYDKKGFTGPINYYRNIDRNWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYIHGG  330

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLL++ VVL G+ HFL++E+P E+N HI NF  KF
Sbjct  331  GFKRDVPLLDETVVLNGLGHFLHEESPDEINQHIHNFFQKF  371



>emb|CAZ86692.1| epoxide hydrolase 1 [Prunus persica]
Length=323

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 167/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW+LC+FRPD+VKALVN+SV F PR+P    +E  +A+YG+D+Y+CRFQEP
Sbjct  103  VGHDWGAFIAWYLCLFRPDRVKALVNMSVAFRPRNPQRKNLESLKAVYGDDYYMCRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA IG    ++  +  +  P PL+ PKDK F    D    LP+WL E++++YY 
Sbjct  163  GVIEAEFAKIGTARVMKEFL-TYRNPGPLFLPKDKMFGHSLDAPIVLPSWLSEDEVNYYA  221

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR L L+WELTA W+G++V VP KFIVGD DL Y   G K++IH G
Sbjct  222  SKFEKTGFTGGINYYRNLDLNWELTAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKG  281

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVV++GVAHF+NQE P E+N HI +F+ KF
Sbjct  282  GFKKYVPLLEEVVVMEGVAHFINQERPDEINKHIHDFIAKF  322



>ref|XP_010088294.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33519.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 165/221 (75%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LC+FRPD+VKALVN+SV F PRHP    +EG RA+ GND+YICRFQEP
Sbjct  100  VGHDWGAVIAWYLCLFRPDRVKALVNMSVAFSPRHPTRKPIEGFRALLGNDYYICRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYV  418
            GE E +FA       L+   F  GR P P   PK+ GF+D      +P+WL EED+ +Y 
Sbjct  160  GEAEKDFARDDTTNLLKK--FYLGRNPSPPCIPKEIGFSDLKAPQTMPSWLLEEDVKFYA  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++++ GFTGG+NYYRAL L WELTA WSG++V VP KFI+GDLD+ Y +PGAKEYIHNG
Sbjct  218  RKFDEKGFTGGLNYYRALDLTWELTAAWSGTQVKVPVKFIIGDLDVTYHVPGAKEYIHNG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L++VVV++GVAH++NQE  +E   HI +F+ KF
Sbjct  278  GFKRDVPYLQEVVVMEGVAHYINQEKAEETAAHIYDFVKKF  318



>ref|XP_007222693.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
 gb|EMJ23892.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
Length=323

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW+LC+FRPD+VKALVN+SV F PR+P    +E  +A+YG+D+YICRFQEP
Sbjct  103  VGHDWGAFIAWYLCLFRPDRVKALVNMSVAFLPRNPQRKSLESLKAVYGDDYYICRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA IG    ++  +  +    PL+ PKDK F    D    LP+WL E++++YY 
Sbjct  163  GVIEAEFAKIGTARVMKEFL-TYRNSGPLFLPKDKMFGHPLDAPIVLPSWLSEDEVNYYA  221

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR L L+WELTA W+G++V VP KFIVGD DL Y   G K++IH G
Sbjct  222  SKFEKTGFTGGINYYRNLDLNWELTAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKG  281

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVV++GVAHF+NQE P E+N HI +F+ KF
Sbjct  282  GFKKYVPLLEEVVVMEGVAHFINQERPDEINKHIHDFIAKF  322



>ref|XP_007222764.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
 gb|EMJ23963.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
Length=320

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 167/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW+LC+FRPD+VKALVN+SV F PR+P    +E  +A+YG+D+Y+CRFQEP
Sbjct  100  VGHDWGAFIAWYLCLFRPDRVKALVNMSVAFRPRNPQRKNLESLKAVYGDDYYMCRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA IG    ++  +  +  P PL+ PKDK F    D    LP+WL E++++YY 
Sbjct  160  GVIEAEFAKIGTARVMKEFL-TYRNPGPLFLPKDKMFGHSLDAPIVLPSWLSEDEVNYYA  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR L L+WELTA W+G++V VP KFIVGD DL Y   G K++IH G
Sbjct  219  SKFEKTGFTGGINYYRNLDLNWELTAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVV++GVAHF+NQE P E+N HI +F+ KF
Sbjct  279  GFKKYVPLLEEVVVMEGVAHFINQERPDEINKHIHDFIAKF  319



>gb|KJB35646.1| hypothetical protein B456_006G123000 [Gossypium raimondii]
Length=319

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 168/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW+LC+FRPDKVKA+  LSV F PR+P +   +G RA+YGND+YICRFQEP
Sbjct  99   VGHDWGAIIAWYLCLFRPDKVKAVFTLSVPFIPRNPQMKPTDGWRAIYGNDYYICRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAEFA +G +T ++ ++  +  P+PL  PK K F    +    LP+WL EE+++YYV
Sbjct  159  GEIEAEFAEMGTETVMKALL-TYRVPDPLMLPKGKPFGHSANTPITLPSWLSEEEVNYYV  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ K+GFTG +NYYR    +WEL APW G +V V  KF+VGD+DLVY +PG KEYIHNG
Sbjct  218  TKFNKSGFTGVINYYRNFDRNWELMAPWGGCEVKVAAKFVVGDVDLVYHMPGMKEYIHNG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP+LE+VVV++GV HF++ E P+E+NN I +F ++F
Sbjct  278  GFKKDVPMLEEVVVMEGVGHFIHMEKPEEINNLIYDFFHQF  318



>gb|AAM28292.1| epoxide hydrolase [Ananas comosus]
Length=318

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 162/219 (74%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW LCM RPD+VKALVN SV   PR+P +  V   + +YG++ Y+CRFQEP
Sbjct  101  VGHDWGAAIAWTLCMIRPDRVKALVNTSVAHMPRNPSVSPVHQIKHLYGDNIYVCRFQEP  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFG-RPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNR  412
            G  EAEFA +G K  L+ I+     RP  L   KD G T    ALP+WL EEDLDYY ++
Sbjct  161  GVAEAEFAEVGTKNVLRKILTMRDPRPSSLTH-KDWGSTGEEIALPSWLSEEDLDYYASK  219

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EKTGFTGG+NYYR + L+WELTAPW+G+K+ VPTKFIVGDLDL Y  P  ++YIH GG 
Sbjct  220  FEKTGFTGGMNYYRCMNLNWELTAPWAGAKIQVPTKFIVGDLDLTYHYPNIQDYIHKGGF  279

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            KN+VPLLE+VVVL+GV HF+ QE  +EV +HI NF+ KF
Sbjct  280  KNEVPLLEEVVVLEGVGHFIQQERAEEVTDHIYNFIKKF  318



>ref|XP_009411662.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   275 bits (703),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 167/222 (75%), Gaps = 6/222 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW LCM RPDKVKALVNLSV F PR+PH   ++  RA++G+DHY+CRFQE 
Sbjct  100  VGHDWGAAVAWWLCMLRPDKVKALVNLSVPFSPRNPHRRTLDSLRAIFGDDHYMCRFQEH  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS----TALPAWLPEEDLDYY  421
            G  EAEFA I     ++  +  + +PEP+  PK+KGF DG+     ALP WL EED++Y+
Sbjct  160  GATEAEFAQIETSLLIKKFL-TYRKPEPIIVPKEKGF-DGTLETPIALPTWLSEEDINYF  217

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             +++EK+GFTGG+NYYR L L+WELTAPW+G+++ VP KFIVGDLDL Y  PG ++YIH 
Sbjct  218  ASKFEKSGFTGGLNYYRCLDLNWELTAPWTGAQIKVPVKFIVGDLDLTYHSPGVQDYIHK  277

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K  VP L+DVVV++GV HF+NQE   ++++HI  F+ KF
Sbjct  278  GGFKKLVPFLQDVVVMEGVGHFINQERAHDISDHIYEFIKKF  319



>ref|XP_011091000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=327

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 164/218 (75%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LC++RPDKVKALVN+SV F  R+P    +E  RA+YG+D+YICRFQEP
Sbjct  103  VGHDWGALVAWALCLYRPDKVKALVNMSVVFTRRNPSRKPLEMLRAVYGDDYYICRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G IE EFA IG KT L++ +  +  P PL  PK K F D   +LP WL EED+DYY ++Y
Sbjct  163  GAIEHEFAQIGTKTVLKHFL-TYRTPGPLNIPKGKPFPDTPISLPPWLSEEDVDYYTSKY  221

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
              TGFT  +NYYRAL ++WELTA W+G+++ VP KFIVGD+DL Y  PG KEYIH GG K
Sbjct  222  NLTGFTAALNYYRALDINWELTAAWTGAQITVPVKFIVGDVDLTYNAPGCKEYIHKGGFK  281

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLL++VVV++GV HF+++E P +VN HI +F  +F
Sbjct  282  RDVPLLKEVVVMEGVGHFIHEEKPDDVNAHIHSFFKQF  319



>ref|XP_006654297.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Oryza brachyantha]
Length=245

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 164/219 (75%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+ AW+LC+FRPD+V+ALV LSV F PR P    V+G R +YG+D+Y+CR QEP
Sbjct  24   VAHDWGALTAWNLCLFRPDRVRALVALSVAFTPRSPARKPVDGLRTIYGDDYYVCRIQEP  83

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G IEAEFA +G +  L+  + A+  P PL  PK   G  D    LP+W+ E+D+ YY + 
Sbjct  84   GAIEAEFARLGTELVLRKFL-AYRTPGPLMMPKSGWGSPDDEVPLPSWITEDDIKYYTSM  142

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            ++KTGFTGG+NYYRAL   WELTAPW+G+++ VP KFIVGDLDL Y  PG +++IH GG 
Sbjct  143  FDKTGFTGGLNYYRALNKTWELTAPWTGAQIKVPAKFIVGDLDLTYHTPGIQDFIHKGGF  202

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL+DVVV++GV HF+N+E P+EV+ HII+F++KF
Sbjct  203  KKYVPLLDDVVVMEGVGHFINEEKPEEVSEHIISFISKF  241



>ref|XP_009620847.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 161/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAWHLC+ RPD++KALVN+SV F PRHP    +E  RA+ G+D+YICRFQE 
Sbjct  99   VGHDWGAIIAWHLCLLRPDRIKALVNMSVVFHPRHPKRKPIESMRAVLGDDYYICRFQEY  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS---TALPAWLPEEDLDYYV  418
            G++E EFA +     +   + +   P PL   K+KGF   S     LP+WL EED++YY 
Sbjct  159  GQVEEEFARVDTARLIAKFLIS-RNPAPLRVSKEKGFGGSSHTPIKLPSWLSEEDINYYA  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++ + GFTGG+NYYRA+ L+WELTAPW+G ++ VP KFIVGDLDL Y  PG KEYIH G
Sbjct  218  NKFSQKGFTGGLNYYRAMDLNWELTAPWTGQQIKVPVKFIVGDLDLTYNTPGVKEYIHKG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G +  VP L++VV+++GV HF+N+E P+E+N HI +F  KF
Sbjct  278  GFQKMVPFLQEVVIMEGVGHFINEEKPEEINGHIYDFFQKF  318



>ref|XP_009771842.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=318

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW+LC+ RPD++KALVN+SV F PRHP    +E  RA+ G+D+YICRFQE 
Sbjct  99   VGHDWGAIIAWYLCLLRPDRIKALVNMSVVFHPRHPKRKPIESMRAVLGDDYYICRFQEY  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS---TALPAWLPEEDLDYYV  418
            G++E EFA +     +   + +   P PL   K+KGF   S     LP+WL EED+DYY 
Sbjct  159  GQVEEEFARVDTARLIAKFLIS-RNPAPLRVSKEKGFGGSSHTPIKLPSWLSEEDIDYYA  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++ + GFTGG+NYYRA+ L+WELTAPW+G ++ VP KFIVGDLDL Y  PG KEYIH G
Sbjct  218  NKFSQKGFTGGLNYYRAMDLNWELTAPWTGMQIKVPVKFIVGDLDLTYNTPGVKEYIHKG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G +  VP L++VV+++GV HF+N+E P+E+N+HI +F+ KF
Sbjct  278  GFQKMVPFLQEVVIMEGVGHFINEERPEEINDHIYDFIQKF  318



>ref|XP_006489041.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=319

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW LC+FRPD+VKALVNLSV F P     +++E  RA YG+++Y+CRFQEP
Sbjct  100  VGHDWGAFMAWFLCLFRPDRVKALVNLSVVFNPFGSINNVIEALRAYYGDNYYMCRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFA IG +T ++  +  F  P P+  PK KGF    D   ALP+WL EED+ ++ 
Sbjct  160  GEIEAEFAQIGTETVIKEFL-TFRTPGPIILPKGKGFGHPPDAPMALPSWLSEEDVKHFT  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++K GFTGG+NYYR + L  EL APW+GS++ +PTKFI+GDLDLVY +PG KEYIH G
Sbjct  219  AKFDKKGFTGGINYYRNINLSQELLAPWAGSRLQIPTKFIIGDLDLVYHMPGVKEYIHKG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VV+++GV HF+NQE   E++ HI +F NKF
Sbjct  279  GFKRDVPLLEEVVIMEGVGHFINQEKGDEISKHIYDFFNKF  319



>ref|XP_008784771.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Phoenix 
dactylifera]
Length=338

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LCMFRP+KV+A+VNLSV F PR+P    VE  R++YG+DHY+CRFQEP
Sbjct  121  VGHDWGAMVAWSLCMFRPEKVRAVVNLSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQEP  180

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G  EAEFA +G    L+   + +  P+PL+ PK+  G  D    LP+WL ++D+ YY ++
Sbjct  181  GAAEAEFARLGTALVLEKF-YTYHSPDPLFIPKEGWGSPDTEIPLPSWLSKDDIKYYASK  239

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EKTGFTGG+NYYR L L+WELTAPW+G+ + VP KFIVGD+DL Y  PG ++YIH  G 
Sbjct  240  FEKTGFTGGLNYYRCLDLNWELTAPWTGAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGF  299

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K+ VPLLE+VVV++GV HF+N+E P E+  HI NF+ KF
Sbjct  300  KSYVPLLEEVVVMKGVGHFINEEKPHEITVHIYNFIKKF  338



>ref|XP_008784772.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Phoenix 
dactylifera]
Length=322

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LCMFRP+KV+A+VNLSV F PR+P    VE  R++YG+DHY+CRFQEP
Sbjct  105  VGHDWGAMVAWSLCMFRPEKVRAVVNLSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQEP  164

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G  EAEFA +G    L+   + +  P+PL+ PK+  G  D    LP+WL ++D+ YY ++
Sbjct  165  GAAEAEFARLGTALVLEKF-YTYHSPDPLFIPKEGWGSPDTEIPLPSWLSKDDIKYYASK  223

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EKTGFTGG+NYYR L L+WELTAPW+G+ + VP KFIVGD+DL Y  PG ++YIH  G 
Sbjct  224  FEKTGFTGGLNYYRCLDLNWELTAPWTGAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGF  283

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K+ VPLLE+VVV++GV HF+N+E P E+  HI NF+ KF
Sbjct  284  KSYVPLLEEVVVMKGVGHFINEEKPHEITVHIYNFIKKF  322



>ref|XP_007050977.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX95134.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=316

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 164/220 (75%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C FRPD+VKALVN+SV + PRH  +  VEG RA++G+D+YICRFQEP
Sbjct  98   VGHDWGAVIAWYFCHFRPDRVKALVNMSVAYRPRHRSMKPVEGFRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +     ++ I      P P   PK+ GF        LP+WL EED++Y+ +
Sbjct  158  GEIEEDFAQMDTAKIMK-IFLTSRNPRPPCIPKEIGFRGYPDPPPLPSWLSEEDINYFAS  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRAL L WEL APW+G ++ VP KFIVGDLD+ Y IPGAKEYIHNGG
Sbjct  217  KFNEKGFTGGLNYYRALDLSWELMAPWTGLQIKVPVKFIVGDLDITYHIPGAKEYIHNGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVP L++VVV++GVAHF+NQE  +E++ HI +F+ KF
Sbjct  277  FKKDVPFLQEVVVMEGVAHFINQEKSEEISKHIYDFIKKF  316



>ref|XP_010088295.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33520.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   273 bits (699),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 170/221 (77%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C+FRPD++KALVNLSV FFPR+P ++ V+G RA  G+D YICRFQEP
Sbjct  98   VGHDWGAMIAWYFCLFRPDRIKALVNLSVPFFPRNPKINFVDGFRAELGDDFYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GE EA+F+   V    +  I A   P+P   PK+ GF    +   ALP+WL E+D++++ 
Sbjct  158  GESEADFSSDTVAVFRR--ILANRDPKPPLIPKEIGFRGVYEDPVALPSWLTEDDINHFA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++ +TGFTGG+NYYRAL L WELTA W+G++V VPTKFI+GDLDLVY  PG KEYI NG
Sbjct  216  NKFNETGFTGGLNYYRALNLTWELTAAWTGARVQVPTKFIMGDLDLVYYFPGMKEYILNG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLL+++V+++G AHF+NQE P E+++HI +F+ KF
Sbjct  276  GFKRDVPLLQELVIIEGAAHFINQEKPDEISSHIHHFIQKF  316



>ref|XP_006414587.1| hypothetical protein EUTSA_v10025505mg [Eutrema salsugineum]
 gb|ESQ56040.1| hypothetical protein EUTSA_v10025505mg [Eutrema salsugineum]
Length=371

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LC +RP+KVKALVN+SV F PR+P    V   R ++G+D+YICRFQ+P
Sbjct  149  VGHDWGAMIAWQLCQYRPEKVKALVNMSVVFSPRNPDRVPVPTLRHVFGDDYYICRFQKP  208

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEF  +G +  L+  +  +  P PLY PK K F    + ++ALP WL +EDL YYV
Sbjct  209  GEIEAEFKKLGTENVLKKFL-TYKTPGPLYLPKPKLFKRSENAASALPPWLAQEDLHYYV  267

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N+Y+K GFTG +NYYR +  +WELTAPW+G+K+ VP KFIVGD DL Y  PGAKEYIH G
Sbjct  268  NKYDKKGFTGPINYYRNIDRNWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYIHGG  327

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLL++ VVL G+ HFL++E+P E+N HI NF  KF
Sbjct  328  GFKRDVPLLDETVVLNGLGHFLHEESPDEINQHIHNFFQKF  368



>ref|XP_010914487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 164/219 (75%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AWHLCMFRPD+VKA+VNLSV F PR+P +  V+  R++YG+++YICRFQEP
Sbjct  101  VGHDWGAHVAWHLCMFRPDRVKAVVNLSVAFLPRNPAMKPVDYFRSIYGDEYYICRFQEP  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
               EAEFA +G  T L+   F +  P P+Y PKD  G  +    LP+WL E D++YY ++
Sbjct  161  DAAEAEFARLGAATVLKKF-FTYRDPGPIYIPKDGWGSPNEQITLPSWLSEADINYYTSK  219

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EK+GFTG +NYYR   L+WELT PW+G++  VP KFIVGDLDL Y  P  ++YIH GG 
Sbjct  220  FEKSGFTGPINYYRCFDLNWELTEPWNGAQANVPAKFIVGDLDLTYHYPNMQDYIHKGGF  279

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K DVPLL++VVV++GVAHF+NQE  QE+ +HI +F+ KF
Sbjct  280  KKDVPLLQEVVVMEGVAHFINQEKAQEIADHIYDFIQKF  318



>ref|XP_003554527.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=317

 Score =   273 bits (698),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAWH C+ RPD+VKALVN+SV F PR+P+   ++  RA+ G+D+YICRFQ+P
Sbjct  98   VGHDWGASIAWHFCLLRPDRVKALVNMSVVFRPRNPNRKPIQSLRAIMGDDYYICRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GE+E EFA  G    ++  I A   P P   PK+ GF    D    LP+WL EED++YY 
Sbjct  158  GEVEEEFARAGAARIIKTFI-ASRDPRPPCVPKEIGFGGSPDLRIDLPSWLTEEDVNYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++E+ GFTGG+NYYRA+ L WELTA W+G ++ VP KFIVGDLD+ Y  PG KEYIHNG
Sbjct  217  SKFEQKGFTGGLNYYRAMDLTWELTAAWTGVQIKVPVKFIVGDLDITYNTPGVKEYIHNG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L+++VV++GVAHF+NQE PQE++ HI +F+ KF
Sbjct  277  GFKRDVPFLQELVVMEGVAHFINQERPQEISAHIYDFIKKF  317



>ref|XP_008223222.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Prunus mume]
Length=323

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LC+FRPD+VKALVN+SV F PR+P    +E  +A+YG+D+YICRFQEP
Sbjct  103  VGHDWGALIAWYLCLFRPDRVKALVNMSVVFPPRNPRRKTLESLKAVYGDDYYICRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA IG    ++  +  +  P PL+ PKD  F    D    LP+WL E++++YY 
Sbjct  163  GVIEAEFAKIGTARVMKEFL-TYRNPGPLFLPKDIMFGHPPDAPIVLPSWLSEDEVNYYA  221

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR L L+WEL A W+G++V VP KFIVGD DL Y   G K++IH G
Sbjct  222  SKFEKTGFTGGINYYRNLNLNWELIAAWTGAQVKVPVKFIVGDQDLTYNSVGTKDFIHKG  281

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVV++GVAHF+NQE P E+N HI +F+ KF
Sbjct  282  GFKKCVPLLEEVVVMEGVAHFINQERPDEINKHIHDFIAKF  322



>ref|XP_008775993.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=318

 Score =   273 bits (698),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 162/219 (74%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AWHLC+FRPD+VKALVNLSV F PR P    ++  RA+YG+D YI RFQEP
Sbjct  101  VGHDWGAFVAWHLCLFRPDRVKALVNLSVAFMPRKPAAKPLDDFRALYGDDSYISRFQEP  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G  EAEFA +G  T L+   F +  P P++ PKD  G  +    LP+WL EED++Y+ ++
Sbjct  161  GAAEAEFARLGTATVLRKF-FTYRNPGPIFIPKDGWGSPNEHITLPSWLSEEDINYFKSK  219

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EK+GFTG +NYYR   L+WEL APW+G+++ VP KFI+GDLDL Y  P  ++YIH GG 
Sbjct  220  FEKSGFTGPINYYRCFDLNWELAAPWTGAQIKVPAKFIIGDLDLTYHFPRMQDYIHKGGF  279

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K DVP L++VVV++GVAHF+NQE  QE+ +HI +F+ KF
Sbjct  280  KKDVPFLQEVVVMEGVAHFINQEKAQEITDHIYDFIQKF  318



>ref|XP_009350800.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   273 bits (698),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAW+LC+FRPD+VKALV+LSV F PR+P   ++E   A YG+D+Y+CRFQEP
Sbjct  102  VAHDWGALIAWYLCLFRPDRVKALVSLSVQFMPRNPRRKVIESFHAAYGDDYYMCRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA +G    ++  +  +  P PL+ PK K F   TD    LP+WL E+D++YY 
Sbjct  162  GVIEAEFAQMGTTRVIKEFL-TYRNPGPLFLPKGKAFGHPTDTPIVLPSWLSEDDVNYYT  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++KTGFTG VNYYR L ++WELTAPW+G++V VP KF+VGD DLVY   GA ++IH G
Sbjct  221  AKFDKTGFTGPVNYYRNLDVNWELTAPWTGAQVKVPVKFVVGDQDLVYNSQGAPDFIHKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVVL+GVAHFL QE P E++ HI +F+ KF
Sbjct  281  GFKKFVPLLEEVVVLEGVAHFLQQEKPDEISKHIHDFIKKF  321



>ref|XP_008784770.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=359

 Score =   274 bits (701),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LCMFRP+KV+A+VNLSV F PR+P    VE  R++YG+DHY+CRFQEP
Sbjct  142  VGHDWGAMVAWSLCMFRPEKVRAVVNLSVAFTPRNPARKSVEYLRSLYGDDHYVCRFQEP  201

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G  EAEFA +G    L+   + +  P+PL+ PK+  G  D    LP+WL ++D+ YY ++
Sbjct  202  GAAEAEFARLGTALVLEKF-YTYHSPDPLFIPKEGWGSPDTEIPLPSWLSKDDIKYYASK  260

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EKTGFTGG+NYYR L L+WELTAPW+G+ + VP KFIVGD+DL Y  PG ++YIH  G 
Sbjct  261  FEKTGFTGGLNYYRCLDLNWELTAPWTGAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGF  320

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K+ VPLLE+VVV++GV HF+N+E P E+  HI NF+ KF
Sbjct  321  KSYVPLLEEVVVMKGVGHFINEEKPHEITVHIYNFIKKF  359



>ref|XP_006600362.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Glycine 
max]
 ref|XP_006600363.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Glycine 
max]
Length=354

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 168/256 (66%), Gaps = 39/256 (15%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQ--  595
            VGHDWGA+ AW L ++RP++++ALVNLSV F PR+P    ++  RA+YGND+YICRFQ  
Sbjct  100  VGHDWGAMTAWSLSLYRPERIRALVNLSVVFTPRNPKRKPLDTLRAVYGNDYYICRFQVS  159

Query  594  ---------------------------------EPGEIEAEFAPIGVKTCLQNIIFAFGR  514
                                             EPGEIEAEFA IG    L+  +  +  
Sbjct  160  KHGLSRSDEKKMLFSRGKPWFAKWLCCSSALLQEPGEIEAEFAQIGTARVLKEFL-TYRN  218

Query  513  PEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYVNRYEKTGFTGGVNYYRALKLDWELT  343
            P PLY PK K F   TD   ALP+WL EE+ DYY ++Y+KTGFTGG+NYYR L L+WELT
Sbjct  219  PGPLYLPKGKAFAHPTDSPIALPSWLSEEECDYYASKYDKTGFTGGLNYYRNLDLNWELT  278

Query  342  APWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLKNDVPLLEDVVVLQGVAHFLNQE  163
            A W+G++V VP KFIVGDLDL Y  PGAKEYIH GG K DVPLLEDVVVL+G  HFL+QE
Sbjct  279  ASWTGAQVKVPVKFIVGDLDLTYNAPGAKEYIHKGGFKRDVPLLEDVVVLEGAGHFLHQE  338

Query  162  APQEVNNHIINFLNKF  115
             P E++NHI +F  KF
Sbjct  339  RPDEISNHIYDFFKKF  354



>ref|XP_008341331.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   273 bits (697),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAW+L +FRPD+VKALV+LSV F PR+P    +E  +A YG+D+Y+CRFQEP
Sbjct  102  VAHDWGAVIAWYLXLFRPDRVKALVSLSVQFIPRNPQRKFIESFQAAYGDDYYMCRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA +G    ++  +  +  P PL+ PK KGF    D    LP+WL E++++YY 
Sbjct  162  GVIEAEFAQMGTTRVIKEFL-TYRNPXPLFLPKGKGFGHPXDTPIVLPSWLSEDEVNYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++KTGFTGG+NYYR L ++WELTAPW+G++V VP KF+VGD DLVY   GA+++IH G
Sbjct  221  AKFDKTGFTGGINYYRNLDINWELTAPWTGAQVKVPVKFVVGDQDLVYNSLGAQDFIHKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+V+VL+GVAHFL QE P E++ HI +F+ KF
Sbjct  281  GFKKFVPLLEEVIVLEGVAHFLQQEKPDEISKHIHBFIKKF  321



>ref|XP_006419522.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
 gb|ESR32762.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
Length=324

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 166/226 (73%), Gaps = 9/226 (4%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFP-----RHPHLDLVEGHRAMYGNDHYIC  604
            VGHDWGA +AW LC+FRPD+VKALVNLSV F P        + + +E  RA YG+D+Y+C
Sbjct  100  VGHDWGAFMAWFLCLFRPDRVKALVNLSVVFNPFGSNTSESNNNPIEALRAYYGDDYYMC  159

Query  603  RFQEPGEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEED  433
            RFQEPGEIEAEFA IG +T ++  +  F  P P+  PK KGF    D   ALP+WL EED
Sbjct  160  RFQEPGEIEAEFAQIGTETVIKEFL-TFRTPGPIILPKGKGFGHPPDAPMALPSWLSEED  218

Query  432  LDYYVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKE  253
            + Y+  +++K GFTGG+NYYR + L  EL APW+GS++ +PTKFI+GDLDLVY +PG KE
Sbjct  219  VKYFTAKFDKKGFTGGINYYRNINLSQELLAPWAGSRLQIPTKFIIGDLDLVYHMPGVKE  278

Query  252  YIHNGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            YIH GG K DVPLLE+VV+++GV HF+NQE   E++ HI +F NKF
Sbjct  279  YIHKGGFKRDVPLLEEVVIMEGVGHFINQEKGDEISKHIYDFFNKF  324



>ref|XP_010039627.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW84775.1| hypothetical protein EUGRSUZ_B015791 [Eucalyptus grandis]
Length=320

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 170/221 (77%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HD GA +AW+LC+ RPD+VKALV+LS+ + PR+P +  ++G+RA YG+D+Y+CRFQEP
Sbjct  101  VAHDVGAQMAWYLCLLRPDRVKALVSLSLPWVPRNPGMKPLDGYRAAYGDDYYMCRFQEP  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEA+FA +G +  L+ ++  +  P PL+  K KGF    D    LP+WL ++D+DYYV
Sbjct  161  GEIEAQFAEMGTRRVLEGVL-TYRIPGPLFLVKGKGFGHPVDDPVVLPSWLTQKDVDYYV  219

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EK GFTGG+NYYR +  +WEL APW G++V VP KFIVG+LDLVY +PG K++IH G
Sbjct  220  DKFEKKGFTGGINYYRNMNRNWELMAPWDGAQVKVPVKFIVGELDLVYHMPGVKDFIHKG  279

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVV++GVAHFLNQE PQ+   HI +FL+KF
Sbjct  280  GFKKMVPLLEEVVVMEGVAHFLNQERPQDTTQHIYDFLSKF  320



>gb|KDP27825.1| hypothetical protein JCGZ_18905 [Jatropha curcas]
Length=321

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 162/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW+LC+FRPD+VKALVNLSV F PR+P     EG RA+YG+D+Y+CR QEP
Sbjct  102  VGHDWGAYIAWYLCLFRPDRVKALVNLSVAFAPRNPKRKPTEGMRAVYGDDYYVCRIQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTA---LPAWLPEEDLDYYV  418
            G+IEAEFA +G +  ++  +  +  P PL  PK K F+  S     LP+W  EED+ YY+
Sbjct  162  GDIEAEFAELGTEKIMKEFL-TYRNPGPLLLPKGKAFSRPSETPLVLPSWFSEEDVQYYI  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++EK GFTGG+NYYR +  +WELTAPW+G++V VP KFIVGD DL Y   G K++I  G
Sbjct  221  NKFEKKGFTGGLNYYRIVDRNWELTAPWTGAEVKVPVKFIVGDQDLTYNTFGTKDFIEKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VP LE+VV+++GV HFLN+E P+E+N HI +F  KF
Sbjct  281  GFKKAVPFLEEVVIMEGVGHFLNEEKPEEINKHIYDFFQKF  321



>ref|XP_010043042.1| PREDICTED: bifunctional epoxide hydrolase 2 [Eucalyptus grandis]
 gb|KCW85062.1| hypothetical protein EUGRSUZ_B01907 [Eucalyptus grandis]
Length=318

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 168/221 (76%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++ W+LCMFRP++V++ V L+V F PR+P    VE  RA +G+D+YICRFQEP
Sbjct  99   VGHDWGALVGWYLCMFRPERVRSYVCLTVPFRPRNPAAKPVESLRAHFGDDYYICRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G+IE++   +GV+  L+ I+    +P P  +PK + F+       ALP+WL EEDLDYY 
Sbjct  159  GDIESDIERLGVRNVLRKILTER-KPGPPMWPKGQDFSCRPGKPMALPSWLSEEDLDYYT  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EK GFTGG+NYYRAL L+WELTAPW+ ++V VP KF+VGDLD+ Y  PG KE++H G
Sbjct  218  SKFEKRGFTGGLNYYRALDLNWELTAPWTDARVRVPVKFVVGDLDITYTTPGVKEFVHGG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLEDVVV++G +HF+NQE P+EVN+HI NF+ KF
Sbjct  278  GFKKHVPLLEDVVVIEGASHFINQERPEEVNSHIHNFIKKF  318



>emb|CDY09722.1| BnaC07g33390D [Brassica napus]
Length=329

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 162/222 (73%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LCM+RP+KVKALVN+SV F PR+P    +   R  +G+D+YICRFQ+P
Sbjct  108  VGHDWGAMIAWQLCMYRPEKVKALVNMSVLFSPRNPDRVPIPTLRRFFGDDYYICRFQKP  167

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD----GSTALPAWLPEEDLDYY  421
            GEIEAEF  +G +  L+  +  +  P PLY PK K F       S+ALP WL +EDLDYY
Sbjct  168  GEIEAEFKKLGTEKVLKEFL-TYKTPGPLYLPKGKLFKSSENGASSALPPWLTQEDLDYY  226

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V  Y   GFTG +NYYR +  +WELTAPW+G+K+ VP KFIVGD DL Y  PGAKEYI+ 
Sbjct  227  VTNYNNKGFTGPINYYRNIDRNWELTAPWTGAKISVPVKFIVGDQDLTYNSPGAKEYING  286

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVPLL++ VVL+GV HFL++E+P+E+N HI +F  KF
Sbjct  287  GGFKKDVPLLDETVVLKGVGHFLHEESPEEINQHIHSFFQKF  328



>ref|XP_008807392.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 164/218 (75%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LCMFRPDKVKALVNLSV F PR+P +  V+  R +YG+D+YICRFQEP
Sbjct  101  VGHDWGALIAWYLCMFRPDKVKALVNLSVAFMPRNPAMKTVDYFRKLYGDDYYICRFQEP  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G IEA FA IG  +  + I+ +   P P   PK+       + L +WL EED++YY +++
Sbjct  161  GAIEARFAQIGTASIFRTILQS-RDPGPFLIPKEGWDLPEKSPLCSWLSEEDINYYASKF  219

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            +K+GFTG VNYYR + L+WELTAPW+G ++ VP KFIVGDLDL Y  PG ++YIHNGG K
Sbjct  220  DKSGFTGPVNYYRCMNLNWELTAPWTGVQIKVPAKFIVGDLDLTYHYPGIQDYIHNGGFK  279

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             +VPLL++VVV++GV HF+NQE   E+ +HI +F+ KF
Sbjct  280  QNVPLLQEVVVMEGVGHFINQEKGHEITDHIYDFIQKF  317



>ref|XP_004290776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 163/222 (73%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAWHLC+FRPD+VKALVNLSV F PR+P    V   +A+YG D+Y+CRFQE 
Sbjct  100  VGHDWGAVIAWHLCLFRPDRVKALVNLSVAFTPRNPQFKPVPALKAVYGGDYYMCRFQEE  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS----TALPAWLPEEDLDYY  421
            G+IE E A +G    ++  + +   P PL  PK KGF + S      LP+WL E+D+ YY
Sbjct  160  GDIEDELASLGCDRVMKEFL-SNRNPGPLMLPKGKGFGNASPDAPVTLPSWLSEDDIHYY  218

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             + +EK GFTG +NY+R L  +WELTAPW+GSK++VP KFIVGD DLVY   GAK+YIH 
Sbjct  219  ASNFEKKGFTGALNYFRNLDRNWELTAPWTGSKILVPVKFIVGDQDLVYNSMGAKDYIHK  278

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K  VPLLE+VVV++GVAHF+N+E P+E+N HI +F  KF
Sbjct  279  GGFKKYVPLLEEVVVMEGVAHFINEERPEEINQHIYDFFKKF  320



>ref|XP_002516953.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF45567.1| epoxide hydrolase, putative [Ricinus communis]
Length=321

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 162/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW LC+FRPD+VKALVNLSV F PR+PH  +VE  RA+YG+D+Y+CRFQE 
Sbjct  102  VGHDWGAYMAWFLCLFRPDRVKALVNLSVSFSPRNPHKKIVEMLRAVYGDDYYMCRFQEV  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G+IEAEFA +G +  ++  +  +  P PL+ PK K F    +    LP+WL EED  YYV
Sbjct  162  GDIEAEFAELGTERVIKEFL-TYRYPGPLFLPKGKAFNRSPENPLVLPSWLSEEDAQYYV  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++E+ GFTGG+N YR L L+WELTAPW+G+KV VP KFIVGD DL Y   G K YI  G
Sbjct  221  GKFEEKGFTGGLNLYRNLDLNWELTAPWTGAKVKVPIKFIVGDQDLTYNSLGNKAYIEKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP LE+VV+++GVAHF+NQE  +E+N HI +F  KF
Sbjct  281  GFKRDVPFLEEVVIMEGVAHFINQEKAEEINKHIYDFFQKF  321



>ref|XP_004240550.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=318

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAWH+C+ RPD++KALVN+SV F PR+P    +E  RA+ G+D+YICRFQE 
Sbjct  99   VGHDWGAVIAWHVCLLRPDRIKALVNMSVVFHPRNPKRKPIESMRAVLGDDYYICRFQEY  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS---TALPAWLPEEDLDYYV  418
            GE E EFA +     +   + +   P PL  PK+KGF         LP+WL EED++YY 
Sbjct  159  GEAEEEFARVDTARLIAKFLTS-RNPAPLRVPKEKGFGGSPHTPITLPSWLSEEDVNYYA  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++ ++GFTGG+NYYRA+ L+WELTAPW+G ++ VP KFIVGD+DL Y  PG KEYIH G
Sbjct  218  NKFRQSGFTGGLNYYRAMDLNWELTAPWTGVQIKVPVKFIVGDVDLTYNTPGVKEYIHKG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G +  VP L++VV+++GVAHF+NQE P+E+N+HI +F  KF
Sbjct  278  GFQKVVPFLQEVVIMEGVAHFINQERPEEINDHIYDFFQKF  318



>ref|XP_011079631.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 162/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+ C+FRPD++KALVN+SV F PR+P    VE  RA+ G+D+YICRFQ+P
Sbjct  98   VGHDWGAVMAWYFCLFRPDRIKALVNMSVVFQPRNPRRKPVESMRAILGDDYYICRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GE E EFA +     ++  + +   P PL  PK+ GF   TD    LP+WL E+D+ YY 
Sbjct  158  GEAEEEFARVDTAQLIKKFLIS-RNPTPLRVPKEVGFGGRTDKPIILPSWLSEDDVQYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ K GFTGG+NYYRA+ L WELTA W+G ++ VP KFIVGDLDL Y  PG KEYIHNG
Sbjct  217  TKFNKKGFTGGLNYYRAMDLTWELTAAWTGVQIKVPVKFIVGDLDLTYNTPGVKEYIHNG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G +  VP L+++V+++GVAHFLNQE P+E++ HI +F+ +F
Sbjct  277  GFRKQVPFLQELVIMEGVAHFLNQEKPEEISQHIYDFVQRF  317



>emb|CDO98837.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 164/220 (75%), Gaps = 4/220 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LC++RPDKVKAL N+SV F PR+P    +E  RA+ G D+Y+CRFQEP
Sbjct  102  VGHDWGAVMAWALCLYRPDKVKALFNMSVSFGPRNPKRKPIETLRAVCGPDYYVCRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIE EFA +G K  L+N + ++  P PL+ PK   F    D  T LP+WL EED+ YYV
Sbjct  162  GEIEEEFAKVGTKRVLENFL-SYRAPGPLFLPKGILFGDSPDAPTTLPSWLSEEDVAYYV  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N+Y ++GFTG +NYYRAL ++WELTAPW+G++V VP KF+VGDLDL Y  PG K+Y+H G
Sbjct  221  NQYAQSGFTGALNYYRALDINWELTAPWTGAQVKVPVKFVVGDLDLTYNAPGTKDYLHKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNK  118
            GLK DVP L+ VVV++ V HFL++E P E+N +I  F+ K
Sbjct  281  GLKKDVPFLDQVVVMKEVGHFLHEEKPDEINKYIHQFIQK  320



>ref|XP_006355815.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAWH+C+ RPD++KALVN+SV F PR+P    +E  RA+ G+D+YICRFQE 
Sbjct  99   VGHDWGAVIAWHVCLLRPDRIKALVNMSVVFHPRNPKRKPIESMRAVLGDDYYICRFQEY  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS---TALPAWLPEEDLDYYV  418
            GE E EFA +     +   + +   P PL  PK+KGF         LP+WL EED++YY 
Sbjct  159  GEAEEEFARVDTARLIAKFLTS-RNPAPLRVPKEKGFGGSPHTPITLPSWLSEEDVNYYA  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++ ++GFTGG+NYYRA+ L+WELTAPW+G ++ VP KFI+GD+DL Y  PG KEYIH G
Sbjct  218  NKFRQSGFTGGLNYYRAMDLNWELTAPWTGVQIKVPVKFIIGDVDLTYNTPGVKEYIHKG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G +  VP L++VV+++GVAHF+NQE P+E+N+HI +F  KF
Sbjct  278  GFQKMVPFLQEVVIMEGVAHFINQERPEEINDHIYDFFQKF  318



>ref|XP_011006450.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=323

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 165/222 (74%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAWHL +FRPD+VKA+VNLSV F PR+P   ++   +A+YG+D+YI RFQEP
Sbjct  103  VGHDWGALIAWHLSLFRPDRVKAMVNLSVLFNPRNPSRKVIATLKAVYGDDYYIIRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT----DGSTALPAWLPEEDLDYY  421
            GEIEAEFA IG +  L+  +  +  P P++ PK +GF     D    LP+WL EED+ YY
Sbjct  163  GEIEAEFAEIGTEKVLKEFL-TYRTPAPIFLPKGQGFNGKPLDTPVVLPSWLAEEDVKYY  221

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             +++E+ GFTGG+NYYR L  +WELTAPW+G+++ VP KFIVGD DL Y   GAK+Y+  
Sbjct  222  TSKFEQKGFTGGLNYYRNLDRNWELTAPWTGAQIKVPVKFIVGDQDLTYNSLGAKDYLAK  281

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP L+D+VV++GV HF+N+E P+E++ HI +F  KF
Sbjct  282  GGFKRDVPFLQDLVVMEGVGHFINEEKPEEISKHIYDFFRKF  323



>emb|CDX90550.1| BnaA03g42310D [Brassica napus]
Length=330

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 162/223 (73%), Gaps = 6/223 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LCM+RP+KVKALVN+SV F PR P    +   R  +G+D+YICRFQ+P
Sbjct  108  VGHDWGAMIAWQLCMYRPEKVKALVNMSVLFSPRSPDRVPIPTLRRFFGDDYYICRFQKP  167

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD-----GSTALPAWLPEEDLDY  424
            GEIE EF  +G +  L+  +  +  P PLY PK K F        S+ALP WL +EDLDY
Sbjct  168  GEIELEFKKLGTEKVLKEFL-TYKTPGPLYLPKGKLFKSSENGGASSALPPWLTQEDLDY  226

Query  423  YVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH  244
            YV +Y+  GFTG +NYYR +  +WELTAPW+G+K+ VP KFIVGD DL Y  PGAKEYI+
Sbjct  227  YVTKYDNKGFTGPINYYRNIDRNWELTAPWTGAKIRVPVKFIVGDQDLTYNSPGAKEYIN  286

Query  243  NGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             GG K DVPLL++ VVL+GV HFL++E+P+E+N HI +F  KF
Sbjct  287  GGGFKKDVPLLDETVVLKGVGHFLHEESPEEINQHIHSFFQKF  329



>gb|KDP27828.1| hypothetical protein JCGZ_18908 [Jatropha curcas]
Length=321

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW LC+FRPD+VKALVNLSV FF R+P +  V+  RA YG+D Y+CRFQE 
Sbjct  102  VGHDWGAPIAWDLCLFRPDRVKALVNLSVPFFRRNPEMKFVDAFRAAYGDDFYMCRFQEY  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS---TALPAWLPEEDLDYYV  418
            G+IEAEFA +G +  ++  +  +  P P  FPK K F+  +     LP+WL EE++ YY 
Sbjct  162  GDIEAEFAELGTERVMKEFL-TYRNPGPFIFPKGKVFSQPAGDPIILPSWLSEEEVHYYT  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++KTG TGGVNYYR +  +WELTAPW+ ++V VP+KFIVGD DLVY+  G K+YI  G
Sbjct  221  TKFDKTGLTGGVNYYRNIDRNWELTAPWTEAQVKVPSKFIVGDEDLVYRFVGMKDYIEKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VVV++GVAHFLNQE P E+NNHI +F  KF
Sbjct  281  GFKRDVPLLEEVVVMEGVAHFLNQERPDEINNHIYDFFKKF  321



>ref|XP_009136735.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=362

 Score =   272 bits (695),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 162/223 (73%), Gaps = 6/223 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LCM+RP+KVKALVN+SV F PR P    +   R  +G+D+YICRFQ+P
Sbjct  140  VGHDWGAMIAWQLCMYRPEKVKALVNMSVLFSPRSPDRVPIPTLRRFFGDDYYICRFQKP  199

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD-----GSTALPAWLPEEDLDY  424
            GEIE EF  +G +  L+  +  +  P PLY PK K F        S+ALP WL +EDLDY
Sbjct  200  GEIELEFKKLGTEKVLKEFL-TYKTPGPLYLPKGKLFKSSENGGASSALPPWLTQEDLDY  258

Query  423  YVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH  244
            YV +Y+  GFTG +NYYR +  +WELTAPW+G+K+ VP KFIVGD DL Y  PGAKEYI+
Sbjct  259  YVTKYDNKGFTGPINYYRNIDRNWELTAPWTGAKIRVPVKFIVGDQDLTYNSPGAKEYIN  318

Query  243  NGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             GG K DVPLL++ VVL+GV HFL++E+P+E+N HI +F  KF
Sbjct  319  GGGFKKDVPLLDETVVLKGVGHFLHEESPEEINQHIHSFFQKF  361



>ref|NP_001055069.1| Os05g0273800 [Oryza sativa Japonica Group]
 dbj|BAF16983.1| Os05g0273800 [Oryza sativa Japonica Group]
 gb|EAY97338.1| hypothetical protein OsI_19261 [Oryza sativa Indica Group]
 dbj|BAG87495.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63064.1| hypothetical protein OsJ_17872 [Oryza sativa Japonica Group]
Length=331

 Score =   271 bits (692),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 164/219 (75%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+ AW+LC+FRPD+V+ALV+LSV F PR P    V+G RA+YG+D+YICR QEP
Sbjct  110  VAHDWGALTAWNLCLFRPDRVRALVSLSVAFTPRSPARRPVDGLRALYGDDYYICRIQEP  169

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G IEAEFA +G +  L+  + A+  P PL  PK   G  D    LP+W+ EED+ YY ++
Sbjct  170  GAIEAEFARLGTELVLRKFL-AYRTPGPLMMPKSGWGSPDDEVPLPSWITEEDIKYYASK  228

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            ++KT FTGG+NYYRAL   WELTAPW+G+++ VP KFIVGDLDL Y  PG +++IH GG 
Sbjct  229  FDKTNFTGGLNYYRALNKTWELTAPWTGAEIKVPVKFIVGDLDLTYHTPGIQDFIHKGGF  288

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL+DVVV++GV HF+++E P+EV+ H+I+F+ K 
Sbjct  289  KKYVPLLDDVVVMKGVGHFISEEKPKEVSEHVISFIRKL  327



>ref|XP_007200440.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
 emb|CAZ86693.1| epoxide hydrolase 2 [Prunus persica]
 gb|EMJ01639.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
Length=316

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 162/221 (73%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW  C+FRPD+VKALVN+SV F PR+P    V+G RA++G+D+YICRFQEP
Sbjct  98   VGHDWGAVIAWWFCLFRPDRVKALVNMSVAFSPRNPKRKPVDGFRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTDGST--ALPAWLPEEDLDYYV  418
            GEIE EFA     + ++   F  GR P+P   PK+ G     T   LP WL EEDL+Y+ 
Sbjct  158  GEIEKEFAGYDTTSIMKK--FLTGRSPKPPCLPKELGLRAWKTPETLPPWLSEEDLNYFA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++ KTGF GG+NYYRAL L WELT PW+G +V VP KFIVGDLD+ Y IPG K YIHNG
Sbjct  216  SKFSKTGFVGGLNYYRALNLTWELTGPWTGLQVKVPVKFIVGDLDITYHIPGVKNYIHNG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L++VVV++  AHF+NQE P E++ H+ +F+ KF
Sbjct  276  GFKRDVPFLQEVVVIEDGAHFINQERPDEISRHVYDFIQKF  316



>gb|KEH32298.1| epoxide hydrolase [Medicago truncatula]
Length=355

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+ AW+L ++RP+++KALVNLSV F PR+P    ++  RA+YGND+YI RFQEP
Sbjct  136  VGHDWGALTAWYLSLYRPERIKALVNLSVAFTPRNPKRKPLDTLRAVYGNDYYISRFQEP  195

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G+IEAEFA IG +  L+  +  +  P PLY PK KGF    D    LP WL E++ +YY 
Sbjct  196  GDIEAEFAEIGTQRVLKEFL-TYRNPGPLYLPKGKGFGHPIDSPILLPPWLSEQECNYYA  254

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++++KTGFTG +NYYR + L+WEL APW+G++V VP KFIVGDLDL Y  PGAK+YIH G
Sbjct  255  SKFDKTGFTGALNYYRNIDLNWELNAPWTGAQVKVPVKFIVGDLDLTYNAPGAKDYIHKG  314

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G+K DVPLLEDVVV++G  HF++QE   ++N +I +F  KF
Sbjct  315  GMKRDVPLLEDVVVIEGAGHFIHQERADKINTYIYDFFKKF  355



>ref|XP_002314368.1| hypothetical protein POPTR_0010s01430g [Populus trichocarpa]
 gb|EEF00539.1| hypothetical protein POPTR_0010s01430g [Populus trichocarpa]
Length=335

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 164/221 (74%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAWHL +FRPD+VKALVNLSV F PR+P   ++   +A+YG+D+YI RFQEP
Sbjct  103  VGHDWGALIAWHLSLFRPDRVKALVNLSVLFNPRNPSRKVIATLKAVYGDDYYIIRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT----DGSTALPAWLPEEDLDYY  421
            GEIEAEFA IG +  L+  +  +  P P++ PK +GF     D    LP+WL EED+ YY
Sbjct  163  GEIEAEFAEIGTEKVLKEFL-TYRTPAPIFLPKGQGFNGKPLDTPVVLPSWLSEEDVKYY  221

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             +++E+ GFTGG+NYYR L  +WELTAPW+G+++ VP KFIVGD DL Y   GAK+YI  
Sbjct  222  TSKFEQKGFTGGLNYYRNLDRNWELTAPWTGAQIKVPVKFIVGDQDLTYNSLGAKDYIAK  281

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNK  118
            GG K DVP L+D+VV++GV HF+N+E P+E++ HI +F  K
Sbjct  282  GGFKRDVPFLQDLVVMEGVGHFINEEKPEEISKHIYDFFQK  322



>ref|XP_008454325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=324

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 162/222 (73%), Gaps = 2/222 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C+FRPD+VKALVNLSV++  RHP +  V+G RA+ G++ YIC+FQE 
Sbjct  98   VGHDWGAMIAWYFCLFRPDRVKALVNLSVYYIKRHPSISFVDGFRAVAGDNFYICQFQEA  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTA--LPAWLPEEDLDYYVN  415
            G  EA+F  +   T ++  +       PL F K+KGF+   T   LP WL EED+D++  
Sbjct  158  GVAEADFGRVDTATMMKKFMGMRDPEAPLIFTKEKGFSSMETPDPLPCWLTEEDIDFFAT  217

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ KTGFTGG NYYRAL L WELTA W+GSK+ VP KFIVGDLDLVY  PGAK+YIH G 
Sbjct  218  KFSKTGFTGGFNYYRALNLSWELTAAWNGSKIEVPVKFIVGDLDLVYHFPGAKQYIHGGE  277

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF*T  109
             K DVP LE+VVV++  AHF++QE P ++N+ I +F+NKF T
Sbjct  278  FKKDVPFLEEVVVIKDAAHFIHQEKPHQINSLIYHFINKFST  319



>emb|CDY65636.1| BnaAnng20810D [Brassica napus]
Length=316

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 158/220 (72%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW +CM RPD+VKALVN SV F PR+P +  V+  +A++G D+YICRFQEP
Sbjct  98   VGHDWGAIVAWWMCMIRPDRVKALVNTSVVFNPRNPSVKPVDAFKALFGEDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +  K  L N  F    P P   PK  GF       ALPAWL EED+ +Y  
Sbjct  158  GEIEEDFAQVDTKK-LINRFFTSRNPRPPCIPKSLGFRGLPDPPALPAWLTEEDVSFYAE  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEYIH GG
Sbjct  217  KFSQKGFTGGLNYYRAMNLSWELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK  VP L++VVV++GV HFL QE P EV +HI +F +KF
Sbjct  277  LKKHVPFLQEVVVMEGVGHFLQQEKPDEVTDHIYSFFSKF  316



>ref|XP_009111296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=316

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 158/220 (72%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW +CM RPD+VKALVN SV F PR+P +  V+  +A++G D+YICRFQEP
Sbjct  98   VGHDWGAIVAWWMCMIRPDRVKALVNTSVVFNPRNPSVKPVDAFKALFGEDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +  K  L N  F    P P   PK  GF       ALPAWL EED+ +Y  
Sbjct  158  GEIEEDFAQVDTKK-LINRFFTSRNPRPPCIPKSLGFRGLPDPPALPAWLTEEDVSFYAE  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEYIH GG
Sbjct  217  KFSQKGFTGGLNYYRAMNLSWELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK  VP L++VVV++GV HFL QE P EV +HI +F +KF
Sbjct  277  LKKHVPFLQEVVVMEGVGHFLQQEKPDEVTDHIYSFFSKF  316



>ref|XP_011006451.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=322

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 159/222 (72%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAW++C+FRPD+VKALVN SV F PR+P    VE  RA+YG+D+Y+CRFQEP
Sbjct  102  VAHDWGAVIAWYMCLFRPDRVKALVNTSVLFIPRNPERKFVETLRALYGDDYYMCRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT----DGSTALPAWLPEEDLDYY  421
            G IEAE+A  G +  L+ ++  +    PL+ PK KG      D    LP+WL EED  YY
Sbjct  162  GVIEAEYAERGTERVLKELL-TYRVAGPLFLPKGKGLNGTPLDAPIVLPSWLSEEDFKYY  220

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             N++E+ GFTGG+NYYR L  +WELTAPW+G++V VP KFIVGD DL Y   G K+YI +
Sbjct  221  TNKFEQKGFTGGLNYYRNLDRNWELTAPWTGAQVTVPVKFIVGDEDLTYNSLGGKDYIDS  280

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE++VV++GV HFLNQE   E+N HI +F  KF
Sbjct  281  GGFKRDVPFLEELVVMEGVGHFLNQEKADEINKHIYDFFQKF  322



>gb|EYU46741.1| hypothetical protein MIMGU_mgv1a009984mg [Erythranthe guttata]
Length=325

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 161/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+LC+ RPD++KALVNLSV F PR+P    VE  RA+ GND+YICRFQEP
Sbjct  98   VGHDWGAVMAWYLCLLRPDRIKALVNLSVVFHPRNPKRKPVESMRAILGNDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS---TALPAWLPEEDLDYYV  418
            GE E+EFA +     ++  + +   P PL  PK+ GF         +P+WL EED+ YY 
Sbjct  158  GEAESEFARVDTARLIKKFLTS-RNPAPLIVPKEVGFGGSPHKPITMPSWLSEEDVQYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++   GFTGG+NYYRA+ L+WELTAPWS  ++ VP KFIVGDLDL Y  PG KEYIH G
Sbjct  217  SKFSLKGFTGGLNYYRAMDLNWELTAPWSSVQIKVPVKFIVGDLDLTYNTPGVKEYIHGG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VP L+++V+++GVAHF+NQE P+E + HI +F++KF
Sbjct  277  GFKRQVPFLQELVIMEGVAHFINQEKPEETSQHIYDFIHKF  317



>ref|XP_008235117.1| PREDICTED: bifunctional epoxide hydrolase 2 [Prunus mume]
Length=316

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 164/221 (74%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW  C+FRPD+VKALVN+SV F PR+P    V+G RA++G+D+YICRFQEP
Sbjct  98   VGHDWGAVIAWWFCLFRPDRVKALVNMSVAFSPRNPKRKPVDGFRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTDGST--ALPAWLPEEDLDYYV  418
            GEIE EFA     + ++   F  GR P+P   PK+ G     T   LP WL EED++Y+ 
Sbjct  158  GEIEKEFAGFDAASIMKK--FLTGRSPKPPCLPKELGLRAWKTPETLPPWLLEEDVNYFA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++ KTGF GG+NYYRAL L WELT PW+G ++ VP KFIVGDLD+ Y IPG KEYIHNG
Sbjct  216  SKFSKTGFVGGLNYYRALNLTWELTGPWTGLQIKVPVKFIVGDLDITYHIPGMKEYIHNG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L++VVV++  AHF+NQE P E++ H+ +F++KF
Sbjct  276  GFKRDVPFLQEVVVIEDGAHFINQEKPHEISQHVYDFIHKF  316



>ref|XP_002314371.1| hypothetical protein POPTR_0010s01440g [Populus trichocarpa]
 gb|ABK94011.1| unknown [Populus trichocarpa]
 gb|EEF00542.1| hypothetical protein POPTR_0010s01440g [Populus trichocarpa]
Length=323

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 163/222 (73%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AWHL +FRPD+VKALVNLSV F PR+P   ++   +A+YG+D+YI RFQEP
Sbjct  103  VGHDWGALMAWHLALFRPDRVKALVNLSVLFNPRNPSRKVIATLKAVYGDDYYIIRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT----DGSTALPAWLPEEDLDYY  421
            GEIEAEFA IG +  L+  +  +  P PL+ PK +GF     D    LP+WL EED+ YY
Sbjct  163  GEIEAEFAEIGTEKVLKEFL-TYRTPAPLFLPKGQGFNGKPLDTPVVLPSWLSEEDVKYY  221

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             ++YE+ GFTGG+NYYR L  +WELTAPW+G+++ VP KFIVGD DL Y   GAK++I  
Sbjct  222  TSKYEQKGFTGGLNYYRNLDRNWELTAPWTGAQIKVPVKFIVGDQDLTYNSLGAKDHIDK  281

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP L D+VV++GV HF+N+E P+E++ HI +F  K 
Sbjct  282  GGFKRDVPFLHDLVVMEGVGHFINEEKPEEISKHIYDFFQKL  323



>ref|XP_006489255.1| PREDICTED: bifunctional epoxide hydrolase 2-like, partial [Citrus 
sinensis]
Length=257

 Score =   267 bits (682),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LC+FRPD+VKALVNLSV F P   + +L+E  RA YG+++Y+CRFQ+P
Sbjct  38   VGHDWGALMAWFLCLFRPDRVKALVNLSVVFNPFGSNDNLIEALRAYYGDNYYMCRFQKP  97

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFA IG +T ++   F F   + ++ PK KGF    +   ALP+WL EED+ Y+ 
Sbjct  98   GEIEAEFAQIGTETVIKEF-FTFWTRDRIFLPKGKGFGRPPNTPIALPSWLSEEDVKYFT  156

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++K GFTG +NYYR + L  EL APW+GS++ +PTKFI+GDLD+ Y +PG +EYIH G
Sbjct  157  TKFDKKGFTGAMNYYRNINLSLELLAPWAGSQIQIPTKFIIGDLDMTYHMPGVQEYIHKG  216

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE VV+++GV HF+NQ    E++ HI +F NKF
Sbjct  217  GFKRDVPLLEKVVIMEGVGHFINQGKSNEISKHIYDFFNKF  257



>ref|XP_009414133.1| PREDICTED: bifunctional epoxide hydrolase 2 [Musa acuminata subsp. 
malaccensis]
Length=349

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 168/220 (76%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWG+++AW+L MFRPDKV A+VNLS  F PR+P    +E  R ++G+D+Y+CRFQEP
Sbjct  131  VGHDWGSMVAWNLSMFRPDKVNAMVNLSQAFTPRNPTRKSLEYLRTVFGDDYYMCRFQEP  190

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF--TDGSTALPAWLPEEDLDYYVN  415
            G+IEAEFA +G    L+  +  +  P PLY  +D+G+  +D    LP+WL E D++YY +
Sbjct  191  GKIEAEFARLGTAWVLKKFL-TYRNPGPLYITEDQGWGSSDSKILLPSWLSEVDINYYTS  249

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            +YEK GFTGG+NYYR+L L+WELTAPW+G+++ VP KFIVGDLDL Y  PGA+++IH GG
Sbjct  250  KYEKAGFTGGLNYYRSLDLNWELTAPWTGARIKVPAKFIVGDLDLTYHSPGAQDFIHKGG  309

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LKN VPLL++VVV++ V HF+N+E P E+  +I +F+ KF
Sbjct  310  LKNYVPLLDEVVVMKEVGHFINEEKPTEITENICDFITKF  349



>ref|XP_007031041.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY11543.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=317

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 158/221 (71%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPD+VKA V LSV F PR P +  VE  R ++G D+YICRFQEP
Sbjct  98   VAHDWGAIIGWYLCMFRPDRVKAFVCLSVPFMPRKPKMKPVESMRLLFGEDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G+IEAE A +G    L+ ++ +   P P   PKD  F    D    LP+W  EEDL YY 
Sbjct  158  GKIEAEIAHVGTSEVLKKVL-STREPGPPRLPKDDAFGIKPDTPVTLPSWFSEEDLSYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++ + GFTGG+NYYRAL L+WELTAPW+  +V +P KFIVGDLD VY  PG KEY+ +G
Sbjct  217  NKFNQKGFTGGLNYYRALDLNWELTAPWTNVQVKLPVKFIVGDLDTVYTTPGIKEYVQSG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLL++VVV++GV HF+NQE  +E+N+ I +F+ KF
Sbjct  277  GFKRDVPLLDEVVVMEGVGHFINQERAEEINSLIYDFIKKF  317



>ref|XP_007221833.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
 gb|EMJ23032.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
Length=320

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW LC+FRPD+VKALVNLSV F PR+P    +E  +A+YG+D+Y+CRFQEP
Sbjct  100  VGHDWGAYLAWFLCLFRPDRVKALVNLSVAFMPRNPQRKFIESVKAVYGDDYYMCRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G +EAEFA +G    ++  +  +  P PL+ PKDK F    D    LP+WL E++++YY 
Sbjct  160  GVMEAEFAKLGTARVMKEFL-TYRNPGPLFLPKDKMFGHAPDAPIVLPSWLSEDEVNYYA  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTG +NYYR L L+WELTA W+  +V VP KFIVGD DLVY    AK++IH G
Sbjct  219  SKFEKTGFTGALNYYRNLDLNWELTAAWTEVQVKVPVKFIVGDQDLVYNSLHAKDFIHKG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVV++GVAHF+NQE P E+N HI +F+ KF
Sbjct  279  GFKKYVPLLEEVVVMEGVAHFINQERPDEINKHIHDFIAKF  319



>emb|CDY50394.1| BnaCnng19260D [Brassica napus]
Length=316

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 157/220 (71%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW +CM RPD+VKALVN SV F PR+P +  V+  +A++G D+YICRFQEP
Sbjct  98   VGHDWGAIVAWWMCMIRPDRVKALVNTSVVFNPRNPSVKPVDAFKALFGEDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +  K  L N  F    P P   PK  GF       ALPAWL EED+ +Y  
Sbjct  158  GEIEEDFAQVDTKK-LINRFFTSRNPRPPCIPKSLGFRGLPDPPALPAWLTEEDVSFYAE  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEYIH GG
Sbjct  217  KFSQKGFTGGLNYYRAMNLSWELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK  VP L++VVV++GV HFL QE P EV +HI  F +KF
Sbjct  277  LKKHVPFLQEVVVMEGVGHFLQQEKPDEVTDHIYGFFSKF  316



>ref|XP_002283462.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA I W++C+FRPD+VKA V+L+V F PR+P +  +EG RA +G+D+Y+CRFQ+P
Sbjct  98   VGHDWGAQIGWYMCLFRPDRVKAYVSLTVPFRPRNPKIRPIEGMRAFFGDDYYMCRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS---TALPAWLPEEDLDYYV  418
            GEIEAE A +G K  L+ I+    +P P   PK+  F   +   + LP+W  EEDL+YY 
Sbjct  158  GEIEAEIARLGSKEVLKRIL-TDRKPGPPCLPKENPFGIKAIPPSPLPSWFSEEDLNYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +Y++ GFTGG+NYYRAL L+WELTAPW+G +V VP KF+VGDLD+VY  PG KEY+ +G
Sbjct  217  RKYDEKGFTGGLNYYRALDLNWELTAPWTGEQVRVPVKFVVGDLDMVYTTPGVKEYVDSG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              K DVP LED+V+++G  HF+NQE  +E+NN+I++F+ KF
Sbjct  277  AFKKDVPCLEDIVIIEGAGHFINQEKAEEINNYIVDFIRKF  317



>ref|XP_010038235.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 160/226 (71%), Gaps = 10/226 (4%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AWHLC+ RPD+VKALVN SV +FPR+P    VE  RA +G+D+Y+CRFQEP
Sbjct  99   VGHDWGAIMAWHLCLVRPDRVKALVNTSVAWFPRNPERKPVESMRATFGDDYYVCRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFT-------DGSTALPAWLPEED  433
            G  E +FA   +   +Q  +F  GR P P   PKD G +            LP+WL ++D
Sbjct  159  GVAEEDFAKADIAKLIQ--LFLTGRDPSPPIVPKDVGISGLIKLLDQQQVELPSWLTDDD  216

Query  432  LDYYVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKE  253
            + YY  ++ +TGFTGG NYYR L L+WEL+APW+G+++ VP KFIVGDLDL Y  PG KE
Sbjct  217  ISYYATQFSRTGFTGGFNYYRCLDLNWELSAPWTGARIEVPVKFIVGDLDLTYHFPGVKE  276

Query  252  YIHNGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            YIH+GG K  VP LEDVVV++GVAHFL QE PQEV  HI +F+ KF
Sbjct  277  YIHDGGFKKAVPNLEDVVVMEGVAHFLQQEKPQEVTAHIHDFIKKF  322



>ref|XP_010038230.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50053.1| hypothetical protein EUGRSUZ_K03494 [Eucalyptus grandis]
Length=319

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 162/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+ C+ RPD+VKALVN SV F PR+P    ++  RA++G+D+YICRFQEP
Sbjct  100  VGHDWGAVMAWYFCLLRPDRVKALVNTSVVFQPRNPKRKPIDSLRALFGDDYYICRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GE E +FA   + T L  +      P+P   PK+ G++   +    LP WL EED++YY 
Sbjct  160  GEAEEDFARADI-TKLMKLFLTSRNPKPPCIPKEIGYSGLANSRDKLPPWLSEEDVNYYA  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++ + GFTGG+NYYRAL L WEL APW+G ++ VP KFIVGDLD+ Y +PG KEYIHNG
Sbjct  219  SKFSQKGFTGGLNYYRALNLTWELAAPWTGVQIKVPVKFIVGDLDITYHVPGVKEYIHNG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK  VP L++VVV++GVAHFL QE P+EV NHI +F+ KF
Sbjct  279  GLKKLVPFLQEVVVMEGVAHFLQQEKPEEVTNHIYDFIKKF  319



>ref|XP_008246047.1| PREDICTED: bifunctional epoxide hydrolase 2-like, partial [Prunus 
mume]
Length=277

 Score =   267 bits (682),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW LC+FRPD+VKALVNLSV F PR+P    +E  +A+YG+D+Y+CRFQEP
Sbjct  57   VGHDWGAYLAWLLCLFRPDRVKALVNLSVAFMPRNPQRKFIESVKAVYGDDYYMCRFQEP  116

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G +EAEFA +G    ++  +  +  P PL+ P+DK F    D    LP+WL E++++YY 
Sbjct  117  GVMEAEFAKLGTARVMKEFL-TYRNPGPLFLPEDKMFGHPPDAPIVLPSWLSEDEVNYYA  175

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR   L+WELTA W+  +V VP KFIVGD DLVY    AK++IH G
Sbjct  176  SKFEKTGFTGGLNYYRNFDLNWELTAAWTEVQVKVPVKFIVGDQDLVYNSLDAKDFIHKG  235

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVV++GVAHF+NQE P E++ HI +F+ KF
Sbjct  236  GFKKYVPLLEEVVVMEGVAHFINQEKPDEISKHIHDFIVKF  276



>ref|XP_008223225.1| PREDICTED: bifunctional epoxide hydrolase 2-like, partial [Prunus 
mume]
Length=263

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW LC+FRPD+VKALVNLSV F PR+P    +E  +A+YG+D+Y+CRFQEP
Sbjct  43   VGHDWGAYLAWLLCLFRPDRVKALVNLSVAFMPRNPQRKFIESVKAVYGDDYYMCRFQEP  102

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G +EAEFA +G    ++  +  +  P PL+ P+DK F    D    LP+WL E++++YY 
Sbjct  103  GVMEAEFAKLGTARVMKEFL-TYRNPGPLFLPEDKMFGHPPDAPIVLPSWLSEDEVNYYA  161

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR   L+WELTA W+  +V VP KFIVGD DLVY    AK++IH G
Sbjct  162  SKFEKTGFTGGLNYYRNFDLNWELTAAWTEVQVKVPVKFIVGDQDLVYNSLDAKDFIHKG  221

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVV++GVAHF+NQE P E++ HI +F+ KF
Sbjct  222  GFKKYVPLLEEVVVMEGVAHFINQEKPDEISKHIHDFIVKF  262



>ref|XP_008371325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   268 bits (686),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA IAW+LC+ RPD+VKALV LSV F PR+P   ++E  +A YG+D+YICRFQEP
Sbjct  102  VAHDWGATIAWYLCLLRPDRVKALVGLSVQFMPRNPQRKVIESLQAAYGDDYYICRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA +G    ++  +  +  P PL+ PK KGF   TD    LP+WL E++++YYV
Sbjct  162  GVIEAEFAQMGTTRVIKEFL-TYRNPGPLFLPKGKGFGHPTDTPIVLPSWLSEDEVNYYV  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++KTGFTGG+NYYR   ++WELTAPW+G++V VP KF+VGD DLVY   GA ++I  G
Sbjct  221  AKFDKTGFTGGINYYRNXDINWELTAPWTGAQVKVPVKFVVGDQDLVYNSLGAXDFIXKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVVL+GVAHFL QE P E++ HI +F+  F
Sbjct  281  GFKKFVPLLEEVVVLEGVAHFLQQEKPDEISKHIHDFIXXF  321



>ref|XP_006378063.1| hypothetical protein POPTR_0010s01420g [Populus trichocarpa]
 gb|ERP55860.1| hypothetical protein POPTR_0010s01420g [Populus trichocarpa]
Length=306

 Score =   268 bits (684),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 158/222 (71%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAIIAW++C+FRPD+VKALVN SV F PR+P    VE  RA+YG+D+Y+CRFQEP
Sbjct  86   VAHDWGAIIAWYMCLFRPDRVKALVNTSVLFIPRNPKRKFVETLRALYGDDYYMCRFQEP  145

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT----DGSTALPAWLPEEDLDYY  421
            G IEAE+A  G +  L+ ++       PL+ PK KG      D    LP+WL EED  YY
Sbjct  146  GVIEAEYAERGTERVLKELL-THRVAGPLFLPKGKGLNGAPLDAPIVLPSWLSEEDFKYY  204

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             N++E+ GFTGG+NYYR L  +WELTAPW+G++V VP KFI+GD DL Y   G K+YI +
Sbjct  205  TNKFEQKGFTGGLNYYRNLDRNWELTAPWTGAQVTVPVKFIIGDEDLTYNSLGGKDYIDS  264

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE++VV++GV HFLNQE   E+N HI +F  KF
Sbjct  265  GGFKRDVPFLEELVVMEGVGHFLNQEKADEINKHIYDFFQKF  306



>ref|XP_007035641.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY06567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=396

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 159/216 (74%), Gaps = 4/216 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LC+ RPD+VKALVN+SV F PR+P    +E  RA YG+D+YICRFQ P
Sbjct  173  VGHDWGALIAWWLCLVRPDRVKALVNMSVVFSPRNPKRKPLESLRAFYGDDYYICRFQAP  232

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTAL---PAWLPEEDLDYYV  418
            GEIEAEFA +G +  L+  +  +  P PL  PK K F    T +   P WL EED+ YY+
Sbjct  233  GEIEAEFAELGFERVLKGFL-TYRNPGPLLLPKGKYFGQPDTPISLPPNWLSEEDVKYYI  291

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++YEK GFTGG+NYYR + L+WELTAPW+GS+V VP KFIVGD DL Y  PG K+YI  G
Sbjct  292  SQYEKKGFTGGLNYYRNIDLNWELTAPWTGSQVKVPVKFIVGDQDLTYNAPGTKDYIQKG  351

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIIN  130
            GLK DVP LE VVV++GVAHFL++E P E+N H+ +
Sbjct  352  GLKRDVPFLEQVVVMEGVAHFLHEEKPDEINKHMTS  387



>gb|KJB35639.1| hypothetical protein B456_006G122800 [Gossypium raimondii]
Length=321

 Score =   268 bits (685),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 168/222 (76%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW+LC+FRPDKVKA+ N+SV F P +P ++ ++G RA+YGND+Y+CRFQ+P
Sbjct  100  VGHDWGAAIAWYLCLFRPDKVKAVFNVSVPFIPHNPQMNPIDGWRAIYGNDYYMCRFQQP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAEFA +G +T ++  +  +  P P+  PK K F    D   ALP+WL EE++ YYV
Sbjct  160  GEIEAEFAEMGTETVVKAFL-TYRVPGPIMLPKGKPFGHSADTPIALPSWLSEEEVHYYV  218

Query  417  NRYE-KTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            ++++ K+GFTGG+NYYR L  +WEL APW+G  V V  KF+V DLDLVY +PG KEYIHN
Sbjct  219  SKFDNKSGFTGGINYYRNLHRNWELMAPWTGCDVKVAAKFVVSDLDLVYHMPGMKEYIHN  278

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP+LE+VVV++GV HF++ E P E+N+ I +F  +F
Sbjct  279  GGFKKDVPMLEEVVVMEGVGHFIHMEKPDEINSLIYDFFRQF  320



>ref|XP_008361962.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   268 bits (684),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA IAW+LC+ RPD+VKALV+LSV F PR+P   ++E  +A YG+D+YICRFQEP
Sbjct  102  VAHDWGAXIAWYLCLXRPDRVKALVSLSVQFMPRNPQRKVIESLQAAYGDDYYICRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA +G    ++  +  +  P PL+ PK KGF   T+    LP+WL E++++YY 
Sbjct  162  GVIEAEFAQMGTTRVIKEFL-TYRNPGPLFLPKGKGFGHPTBTPIVLPSWLSEDEVNYYX  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++KTGFTGG+NYYR   ++WELTAPW+G++V VP KF+VGD DLVY   GA ++I  G
Sbjct  221  AKFDKTGFTGGINYYRNXDINWELTAPWTGAQVKVPVKFVVGDQDLVYNSLGAXDFIXKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVVL+GVAHFL QE P E++ HI +F+ KF
Sbjct  281  GFKKFVPLLEEVVVLEGVAHFLQQEKPDEISKHIHDFIRKF  321



>ref|XP_004967831.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=325

 Score =   268 bits (684),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 153/221 (69%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LC+ RPD V+ALVNLSV + PR P    ++  +A  G DHY+CRFQEP
Sbjct  106  VGHDWGAIVAWQLCLLRPDLVRALVNLSVVYHPRRPEGSPLQTIKAACGEDHYMCRFQEP  165

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G  EAEFA    K    N  F   +P PL  PKDK F    D     P WL EED+ YY 
Sbjct  166  GVAEAEFAQYDAKYIF-NKTFGMRKPAPLILPKDKSFFDSLDSDGTCPPWLSEEDISYYA  224

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ KTGFTGG NYYR + L+WEL+APW+G+ + VPTKFIVGDLD+ Y  PG ++YIH G
Sbjct  225  EKFSKTGFTGGFNYYRCMDLNWELSAPWTGAPIKVPTKFIVGDLDITYNTPGVQDYIHKG  284

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VP LEDVVV++GV+HF+NQE P EV++HI  F +KF
Sbjct  285  GFKASVPKLEDVVVMEGVSHFINQEKPSEVSDHICEFFSKF  325



>ref|XP_010102979.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB94546.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 161/220 (73%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW  C+FRPD++KA+VNLSV F PR+P ++LV+G RA +G+D Y CRFQEP
Sbjct  98   VGHDWGAYMAWFFCLFRPDRIKAVVNLSVAFMPRNPRINLVDGFRAFFGDDFYFCRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT--DGSTALPAWLPEEDLDYYVN  415
            GEIE +FA     T L+ +  +FG    L+ PK+ GF        LP+WL EED++Y  +
Sbjct  158  GEIEKDFASDDTATVLKKLYTSFGATH-LFIPKELGFKGLKAPDTLPSWLSEEDINYSAS  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++E+ GFTGG+NYYRA  L WEL APW+G++V VP KFIVGD D  Y  PG K+YI +GG
Sbjct  217  KFEQKGFTGGLNYYRAANLTWELLAPWTGAQVKVPAKFIVGDEDTTYHFPGVKQYIESGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVP LE+VV+++GVAHF+NQ  P+E++ HI +F+ KF
Sbjct  277  FKKDVPSLEEVVIVEGVAHFINQAKPEEISTHIYDFIKKF  316



>dbj|BAJ99775.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 158/221 (71%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AWHLC+ RPD V+ALVNLSV + PR      ++  RA+ G DHY+CRFQEP
Sbjct  103  VGHDWGALVAWHLCLLRPDLVRALVNLSVAYHPRSSEGSPLQAIRALCGEDHYMCRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G  EAEFA   +    + + F   +P P   PKDK F    D     P WL EED+ YY 
Sbjct  163  GVAEAEFALYDMSHKFKTV-FGMRKPAPPILPKDKTFFDSLDSDGTCPPWLSEEDISYYA  221

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR + L+WEL+APW+G+ V V TKFIVGDLD+ Y +PG K+YIH G
Sbjct  222  DKFEKTGFTGGLNYYRCMDLNWELSAPWTGAPVKVATKFIVGDLDVTYNVPGVKDYIHKG  281

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK +VP LEDVVV++GV+HF NQE P EV++HI  F +KF
Sbjct  282  GLKANVPNLEDVVVMEGVSHFCNQEKPNEVSDHICEFFSKF  322



>ref|XP_008454330.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=316

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 158/221 (71%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW+LC+FRPD+VKALVNLSVHF  R+P +  V+G R  +G+D YICRFQ P
Sbjct  98   VGHDWGAIIAWYLCLFRPDRVKALVNLSVHFLRRNPTISFVQGFRIAFGDDFYICRFQVP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYV  418
            GE E +F  I      +   F  GR P+P   PK+ G         LP+WL +ED++Y+ 
Sbjct  158  GEAEKDFGSIDTAELFKK--FLCGRSPDPPILPKEFGIRSIPSPQNLPSWLSQEDINYFA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ +TGFTGG NYYRAL L WELTA W+ ++V VP KFIVGDLDL Y  PGAKEYIHNG
Sbjct  216  TKFNRTGFTGGFNYYRALDLTWELTASWNKAQVQVPVKFIVGDLDLTYHFPGAKEYIHNG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP LE+VVV++  AHF+NQE P E++ HI +F+ KF
Sbjct  276  GFKTDVPFLEEVVVMEDTAHFINQERPHEISAHIHDFIKKF  316



>gb|KDP28184.1| hypothetical protein JCGZ_13955 [Jatropha curcas]
Length=315

 Score =   267 bits (682),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 166/220 (75%), Gaps = 4/220 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AWH+C+FRPD++KALVN SV F PR+P+   +E +R + G+D YICRFQEP
Sbjct  98   VGHDWGAIVAWHMCLFRPDRIKALVNTSVVFTPRNPNHKPLEKYRELLGDDFYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKD--KGFTDGSTALPAWLPEEDLDYYVN  415
            GEIE +FA  G    L+  + A   P+P   PK   +G  D + +LP WL EED++YYV+
Sbjct  158  GEIEEDFAQAGAAKVLRRFL-ASRNPKPPCIPKIGFRGLPD-NPSLPPWLSEEDINYYVS  215

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYR L L+WELTAPW+G ++ VP KFIVGDLD+ Y  PG KEYIHNGG
Sbjct  216  KFNQKGFTGGLNYYRCLDLNWELTAPWTGLQIKVPVKFIVGDLDVTYHFPGVKEYIHNGG  275

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK  VP L++VV+++GV H+LNQE P+E++ HI +F+ KF
Sbjct  276  LKKYVPFLQEVVIMEGVCHYLNQEKPEEISAHIYDFIKKF  315



>ref|XP_009622181.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=333

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 159/218 (73%), Gaps = 2/218 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+++W LC++RPDKVK    LSV F PR+P    +E  RA+YG+D+Y+ RFQE 
Sbjct  104  VGHDWGAVVSWALCLYRPDKVKGFFCLSVAFNPRNPMKKPLETLRAVYGDDYYVVRFQEA  163

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDG-STALPAWLPEEDLDYYVNR  412
            G IEAEF  IGVK  L+   F +  P PLYF K K F D     LP WL EE+LD+Y  +
Sbjct  164  GVIEAEFEEIGVKNVLKKF-FTYREPAPLYFKKGKSFGDNPQVELPCWLSEEELDFYATK  222

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            YE+TGFTG +N+YRA+  +WELT  W+G+K+ VP KFIVG+LDL Y  PG K+Y+H GG 
Sbjct  223  YEQTGFTGALNFYRAIDRNWELTGAWTGAKIQVPVKFIVGELDLTYNAPGTKDYLHKGGF  282

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNK  118
            K  VPLLE+VVVL+GV HF+++E P+E+N+HI NF+ K
Sbjct  283  KKQVPLLEEVVVLEGVGHFIHEEKPKEINDHIYNFIRK  320



>gb|EMT09897.1| hypothetical protein F775_52362 [Aegilops tauschii]
Length=337

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAW LC+FRPD+VKALV LSV F PR P    V+G +A+YG+++YICR QEP
Sbjct  119  VAHDWGAMIAWSLCLFRPDRVKALVALSVPFSPRSPARKPVDGLKALYGDEYYICRIQEP  178

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G IEAEFA +G +  L+   F +  P PL+ PK   G  D    LP+W+ EED+ YY  +
Sbjct  179  GAIEAEFARLGTELVLRKF-FTYRTPGPLFIPKSGWGSPDDEVPLPSWITEEDIKYYAAQ  237

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            ++K+GFTGG+NYYRAL   WELT+PW+G+++ VPTKFIVGD+DL Y + GA ++I+ GGL
Sbjct  238  FDKSGFTGGLNYYRALNKTWELTSPWTGAEIKVPTKFIVGDVDLSYHVAGAHDFINKGGL  297

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL+DVVV++ V HF+N+E P+E++ HII+F+ KF
Sbjct  298  KKFVPLLDDVVVMKDVGHFINEEKPEEISAHIISFIKKF  336



>ref|XP_007147004.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
 gb|ESW18998.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
Length=318

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 165/222 (74%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPD+VKA V LSV    R+P +  V+  RAMYG+D+YICRFQ+P
Sbjct  98   VAHDWGAIIGWYLCMFRPDRVKAYVCLSVPLLHRNPEIRTVDAMRAMYGDDYYICRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFT-DGSTALPAWLPEEDLDYY  421
            GE+EA+ A +G +  L+NI+    +P P  FPK +   GF  D + +LP+WL + DL YY
Sbjct  158  GEMEAQMAEVGTEYVLKNILTT-RKPGPPIFPKGEYGTGFNPDMTNSLPSWLSQHDLAYY  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V++++KTGFTG +NYYR +  +WELTAPWSG+K+ VP KFI GDLD+VY     KEYIH 
Sbjct  217  VSKFQKTGFTGPLNYYRNMNPNWELTAPWSGAKIKVPVKFITGDLDMVYTSLNMKEYIHG  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE+V+V +GVAHF NQEA +E+N HI +F+NKF
Sbjct  277  GGFKEDVPNLEEVIVQKGVAHFNNQEAAEEINTHIYDFINKF  318



>gb|KGN66047.1| hypothetical protein Csa_1G569240 [Cucumis sativus]
Length=317

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 161/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAW LC+FR + VKA V LSV F PRHP+   VE  R ++G+D+YICRFQ P
Sbjct  98   VAHDWGALIAWSLCLFRAEMVKAFVCLSVPFRPRHPNRKPVETMRMVFGDDYYICRFQNP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS---TALPAWLPEEDLDYYV  418
            GEIE E A +G K  L+ I+    +  P+Y PK + F   +   + LP+WL EEDL Y+ 
Sbjct  158  GEIEEEMAQVGAKDVLRGILTTRRQGPPIY-PKKQAFRARAGPPSPLPSWLSEEDLSYFA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            ++YE+ GFTG +NYYR++ L+WELTAPW+G +V VP KFIVGD+D+VY  PG KEY++ G
Sbjct  217  SKYEQKGFTGPLNYYRSMDLNWELTAPWTGVQVKVPVKFIVGDVDMVYTTPGVKEYVNGG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L+DVVV+ GV HFLNQE P+E+N HI +F+ KF
Sbjct  277  GFKKDVPFLQDVVVMDGVGHFLNQEKPEEINTHIYDFIKKF  317



>ref|XP_002455386.1| hypothetical protein SORBIDRAFT_03g009830 [Sorghum bicolor]
 gb|EES00506.1| hypothetical protein SORBIDRAFT_03g009830 [Sorghum bicolor]
Length=325

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 153/221 (69%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LC+ RPD V+ALVNLSV + PR P +  ++  RA  G DHY+CRFQEP
Sbjct  106  VGHDWGAIVAWQLCLLRPDLVRALVNLSVVYHPRRPEMSPLQTIRAACGEDHYMCRFQEP  165

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G  EAEFA    K   +   F   +P PL  PKDK F    D     P WL EED+ YY 
Sbjct  166  GVAEAEFALYDTKYVFKKT-FGMRKPAPLVLPKDKSFFDSLDSDGTCPPWLSEEDISYYA  224

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ KTGFTGG+NYYR +   WEL+APW+G+++ VP+KFIVGDLD+ Y  PG  +YIH G
Sbjct  225  EKFAKTGFTGGLNYYRCMDRSWELSAPWTGAQIKVPSKFIVGDLDITYNAPGVPDYIHKG  284

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VP LEDVV+++GV+HFLNQE P EV++HI  F +KF
Sbjct  285  GFKASVPNLEDVVIMEGVSHFLNQEKPNEVSDHICEFFSKF  325



>ref|XP_010269590.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nelumbo nucifera]
Length=318

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 159/222 (72%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW+LC+FRPD+VKALVNLSV F PR+P    V+  RA +G+++YICRFQEP
Sbjct  98   VGHDWGAIIAWYLCLFRPDRVKALVNLSVSFMPRNPAGKTVQRLRAAFGDNYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKD--KGFTDGSTA--LPAWLPEEDLDYY  421
            GEIEAEFA  G  T +      + +  PL  PK   +G  D      LP WL EED++YY
Sbjct  158  GEIEAEFAQAGA-TKIMKYFLTYKKTGPLILPKGSIRGLHDAPQVDELPPWLTEEDVNYY  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
              ++E+ GFTGG+NYYRAL L WE+TAPW+  +V VP KFIVGD D+ Y  PGAKEYIH 
Sbjct  217  ATKFEQKGFTGGLNYYRALDLTWEITAPWTNVQVKVPAKFIVGDQDVTYTTPGAKEYIHG  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP L++VVV++GV HF+ QE   E++ HI +F+ KF
Sbjct  277  GGFKRDVPFLQEVVVMEGVGHFITQERADEISAHIHDFIQKF  318



>ref|XP_002874922.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51181.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 158/222 (71%), Gaps = 3/222 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LCM RPD+V ALVN SV F PR+P +  V+  RA++G+D+YICRFQEP
Sbjct  98   VGHDWGAIVAWWLCMIRPDRVNALVNTSVVFNPRNPSVKPVDAFRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +  K  +    F    P P   PK  GF       +LPAWL EED+ +Y +
Sbjct  158  GEIEEDFAQVDTKKLITRF-FISRNPRPPCIPKSVGFRGLPDPPSLPAWLTEEDVSFYGD  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRAL L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEYIH GG
Sbjct  217  KFSQKGFTGGLNYYRALNLSWELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF*T  109
            LK  VP L++VVVL+GV HFL+QE P E+ +HI  F  KF T
Sbjct  277  LKKHVPFLQEVVVLEGVGHFLHQEKPDEITDHIYGFFKKFRT  318



>ref|XP_004494384.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=317

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 161/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW+ C+ +PD+VKALVN+SV F PR+P    V+  RA+ G+D+YICRFQ+P
Sbjct  98   VGHDWGAAMAWYFCLLKPDRVKALVNMSVVFRPRNPIRKPVQTMRALMGDDYYICRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GE E EFA  G    +++ +     P  L  PK+ GF    +    LP+WL EED++YY 
Sbjct  158  GEAEEEFARAGANRIIKSFL-TLRDPRALCVPKEIGFGGSPNTPITLPSWLSEEDVNYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +YE+ GFTGG+NYYRAL L WEL APW+G ++ VP KFIVGDLDL Y  PG KEYIHNG
Sbjct  217  TKYEQKGFTGGLNYYRALDLTWELMAPWTGEQIKVPVKFIVGDLDLTYNTPGVKEYIHNG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G + +VP L+++VV++GVAHF+NQE P+E+N HI +F+ KF
Sbjct  277  GFRREVPYLQEMVVMEGVAHFINQERPEEINAHIYDFIKKF  317



>gb|AFZ93648.1| epoxide hydrolase [Euphorbia lathyris]
 gb|AFZ93653.1| epoxide hydrolase [Euphorbia lathyris]
Length=315

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 156/219 (71%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW++C+FRPD++KALVN SV F PR P    VE +R +YG D+YI R+Q+P
Sbjct  98   VGHDWGAIIAWYVCLFRPDRIKALVNTSVPFLPRDPTTPFVEFYRNLYGEDYYIVRYQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEP-LYFPKDKGFTDGSTALPAWLPEEDLDYYVNR  412
            G  EAE+A I     L  II     P P    PKD G     + LP WL E+D+DYY  +
Sbjct  158  GVAEAEYAKIN-SAKLFRIILTNRDPNPEATLPKDIGKQPDPSTLPCWLTEKDVDYYARK  216

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            + KTGFTGG+NYYR     WELTA W+G++V VP KFIVGDLDLVY IPG KEYIHNGG 
Sbjct  217  FHKTGFTGGINYYRNFDRTWELTAAWTGAQVKVPVKFIVGDLDLVYNIPGMKEYIHNGGF  276

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K DVP LE+VV+++GVAHFLNQE   E++ HI +F+ KF
Sbjct  277  KRDVPFLEEVVIMEGVAHFLNQEKADEISKHIYDFIKKF  315



>ref|XP_006342825.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=334

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 163/220 (74%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+++W LC++RPDKVKA V LSV F PR+P    +E  R +YG+D+Y+ RFQEP
Sbjct  103  VGHDWGAVVSWALCLYRPDKVKAFVCLSVAFNPRNPVKKPLETLRKVYGDDYYVVRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTA--LPAWLPEEDLDYYVN  415
            G IE EF  +G+K  ++  +  +  P PLY  K K F D S+   LP WL +ED+D+Y N
Sbjct  163  GVIEGEFEELGIKNVVKKFL-TYRTPGPLYLKKGKPFEDASSTDELPGWLSDEDIDFYAN  221

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            +Y++ GFTG +NYYR++  +WE+TA W+G+K+ VP KFIVGDLD+ Y  PGAK+Y+H GG
Sbjct  222  KYKQIGFTGALNYYRSIDRNWEVTAAWTGAKIQVPVKFIVGDLDITYNAPGAKDYLHKGG  281

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K  VPLLEDVVVLQGV HF++QE P+E+N HI N+++K 
Sbjct  282  FKKLVPLLEDVVVLQGVGHFIHQEKPKEINEHIYNYISKI  321



>dbj|BAK07144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAW LC+FRPD+VKALV LSV F PR P    V+G +A+YG+++YICR QEP
Sbjct  134  VAHDWGAMIAWSLCLFRPDRVKALVALSVPFTPRSPARKPVDGLKALYGDEYYICRIQEP  193

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G IEAEFA +G +  L+   F +  P PL+ PK   G  D    LP+W+ EED+ YY  +
Sbjct  194  GVIEAEFARLGTELVLRKF-FTYRTPGPLFIPKSGWGSPDDEVPLPSWITEEDIKYYAAQ  252

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            ++K+GFTGG+NYYRAL   WELT+PW+G+++ VPTKFIVGD+DL Y + GA ++I+ GGL
Sbjct  253  FDKSGFTGGLNYYRALNKTWELTSPWTGAEIKVPTKFIVGDVDLSYHVAGAYDFINKGGL  312

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLLEDVVV++ V HF+N+E P+E++ HII+F+ KF
Sbjct  313  KKFVPLLEDVVVMKDVGHFINEEKPEEISAHIISFVKKF  351



>gb|EMT04118.1| hypothetical protein F775_13984 [Aegilops tauschii]
Length=322

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 161/219 (74%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW LC+FRPD+VKALV LSV F PR P +  V+  RA+YG+D YIC FQEP
Sbjct  104  VGHDWGAIIAWSLCLFRPDRVKALVPLSVPFIPRSPAVKPVDAVRALYGDDFYICSFQEP  163

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G IEAEF  +G +  L+   FA   P PL+ PK   G  D    LP+W+ EED+ YY  +
Sbjct  164  GAIEAEFKRLGTELVLRKF-FADRTPGPLFIPKSGWGSPDDEVPLPSWITEEDVKYYTTQ  222

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
             +K+GFTGG+NYYRAL   WELT+PW+G+++MVPTKF VGDLDL Y I GAK +I+ GGL
Sbjct  223  LDKSGFTGGLNYYRALNKTWELTSPWTGAEIMVPTKFTVGDLDLTYNIAGAKVFINKGGL  282

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL+DVV+++ V HF+N++ P+E++  II F+ KF
Sbjct  283  KKFVPLLDDVVIMKDVGHFINEQKPEEISALIIGFIKKF  321



>ref|XP_011010960.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 161/221 (73%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C FRPD+VKALVN SV F PR+P  +L++  RA+ G+D+Y  RFQEP
Sbjct  98   VGHDWGAMIAWYFCTFRPDRVKALVNTSVPFLPRNPQGNLLQWFRALLGDDYYFLRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKD---KGFTDGSTALPAWLPEEDLDYYV  418
            GE E +FA +  K  +      FG P P   PK    K F D   +LP+WL EED++YY 
Sbjct  158  GEAEDDFAQVDTKRLMIKFFTNFG-PNPPLMPKGIGVKAFPD-PPSLPSWLSEEDINYYA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++  TGFTGG+NYYRA  + WEL APW+GS + VP KFIVGDLDL+Y IPG K++IHNG
Sbjct  216  EKFNLTGFTGGLNYYRATAITWELMAPWTGSPITVPAKFIVGDLDLLYNIPGLKDFIHNG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VVV++GVAHFL QE P+EV+ HI +F+ KF
Sbjct  276  GFKKDVPLLEEVVVMEGVAHFLQQEKPEEVSKHIYDFVKKF  316



>ref|XP_011010961.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 162/221 (73%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C FRPD+VKALVN SV F PR+P  +L++  RA++G+++Y  RFQEP
Sbjct  98   VGHDWGAMIAWYFCTFRPDRVKALVNTSVPFLPRNPQGNLLQWFRALFGDNYYFLRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKD---KGFTDGSTALPAWLPEEDLDYYV  418
            GE E +FA +  K  +      FG P P   PK    K F D   +LP+WL EED++YY 
Sbjct  158  GEAEDDFAQVDTKRLMIKFFTNFG-PNPPLMPKGIGVKAFPD-PPSLPSWLSEEDINYYA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++  TGFTGG+NYYRA  + WEL APW+GS + VP KFIVGDLDL+Y IPG K++IHNG
Sbjct  216  EKFNLTGFTGGLNYYRATAITWELMAPWTGSPITVPAKFIVGDLDLLYNIPGLKDFIHNG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE+VVV++GVAHFL QE P+EV+ HI +F+ KF
Sbjct  276  GFKKDVPLLEEVVVMEGVAHFLQQEKPEEVSKHIYDFVKKF  316



>ref|XP_004152361.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156886.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52823.1| hypothetical protein Csa_4G001900 [Cucumis sativus]
Length=322

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 162/222 (73%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C+FRPD+VKALVNLSVH+  RHP ++ V+G RA  G + YIC+FQE 
Sbjct  98   VGHDWGAVIAWYFCLFRPDRVKALVNLSVHYLKRHPSINFVDGFRASAGENFYICQFQEA  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRP--EPLYFPKDKGFTDGSTA--LPAWLPEEDLDYY  421
            G  EA+F  +   T ++  +     P   P+Y  K+KGF+   T   LP WL EED+D++
Sbjct  158  GVAEADFGSVDTATMMKKFM-GMRDPVAPPIYNTKEKGFSSLETPNPLPCWLTEEDVDFF  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             +++ KTGFTGG NYYRAL L WELTA W+GSK+ VP KFIVGDLDLVY  PGAKEYI+ 
Sbjct  217  ASKFSKTGFTGGFNYYRALNLSWELTAAWNGSKIEVPVKFIVGDLDLVYHFPGAKEYING  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G  K DVP LE+VVV++  AHF+NQE P ++N+ I +F+NKF
Sbjct  277  GEFKKDVPFLEEVVVIKDAAHFINQEKPHQINSLIYHFINKF  318



>ref|XP_006288215.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
 gb|EOA21113.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
Length=324

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 158/222 (71%), Gaps = 3/222 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW LCM RPD+V ALVN SV F PR+P L  V+  RA++G+D+YICRFQE 
Sbjct  98   VGHDWGAIIAWWLCMIRPDRVSALVNTSVVFNPRNPTLKPVDAFRALFGDDYYICRFQEA  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +  K  +    F    P P   PK  GF       +LPAWL E+D+ +Y +
Sbjct  158  GEIEEDFAQVDTKKLITKF-FVSRNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVSFYGD  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L WELTAPW+G ++ VP KFIVGDLD+VY IPG KEYIH+GG
Sbjct  217  KFSQKGFTGGLNYYRAMNLSWELTAPWAGLQIKVPVKFIVGDLDIVYNIPGTKEYIHDGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF*T  109
            LK  VP L++VVV++GV HFL QE P EV +HI  F  KF T
Sbjct  277  LKKHVPFLQEVVVMEGVGHFLQQEKPDEVTDHIYGFFEKFRT  318



>ref|XP_008340789.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   266 bits (679),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA IAW+LC+ RPD+VKALV+LSV F PR+P   ++E  +A YG+D+YICRFQEP
Sbjct  102  VAHDWGAXIAWYLCLXRPDRVKALVSLSVQFMPRNPQRKVIESLQAAYGDDYYICRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEFA +G    ++  +  +  P PL+ PK KGF   T+    LP+WL E++++YY 
Sbjct  162  GVIEAEFAQMGTTRVIKEFL-TYRNPGPLFLPKGKGFGHPTBTPIVLPSWLSEDEVNYYX  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++KTGFTGG+NYYR   ++WELTAPW+G++V VP KF+VGD DLVY   GA ++I  G
Sbjct  221  AKFDKTGFTGGINYYRNXDINWELTAPWTGAQVKVPVKFVVGDQDLVYNSXGAXDFIXKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VPLLE+VVVL+GVAHFL QE P E++ HI +F+  F
Sbjct  281  GFKKFVPLLEEVVVLEGVAHFLQQEKPDEISKHIHDFIXXF  321



>ref|XP_008355493.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=316

 Score =   265 bits (678),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 160/221 (72%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA++AW  C+FRPD+VKALVN+SV F PR+P    ++  RA++G+D+YICRFQEP
Sbjct  98   VAHDWGAVMAWWFCLFRPDRVKALVNMSVAFSPRNPKRKPIDTFRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYV  418
            GEIE +F  I     ++   F  GR P+P   PKD+G         LPAWL EED++Y+ 
Sbjct  158  GEIEQDFDSIDTAAVMK--CFLTGRSPKPPCIPKDQGLKSWAAPVTLPAWLTEEDVNYFA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++ KTGFTGG+NYYRAL L WELT PW+G ++ VP KFIVGDLD+ Y IPG + YIH G
Sbjct  216  SKFSKTGFTGGLNYYRALNLTWELTGPWTGLQIKVPVKFIVGDLDITYHIPGIQNYIHKG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L++VVV++  AHF+NQE P EV+ H+ +F+ KF
Sbjct  276  GFKRDVPFLQEVVVMEDAAHFINQEKPDEVSQHVYDFIKKF  316



>ref|NP_567228.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAC19281.1| T14P8.15 [Arabidopsis thaliana]
 emb|CAB80727.1| AT4g02340 [Arabidopsis thaliana]
 gb|AAM26670.1| AT4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AAN18121.1| At4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AEE82157.1| putative epoxide hydrolase [Arabidopsis thaliana]
Length=324

 Score =   266 bits (679),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 158/222 (71%), Gaps = 3/222 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LCM RPD+V ALVN SV F PR+P +  V+  RA++G+D+YICRFQEP
Sbjct  98   VGHDWGAIVAWWLCMIRPDRVNALVNTSVVFNPRNPSVKPVDAFRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +  K  +    F    P P   PK  GF       +LPAWL E+D+ +Y +
Sbjct  158  GEIEEDFAQVDTKKLITRF-FTSRNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVRFYGD  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRAL L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEYIH GG
Sbjct  217  KFSQKGFTGGLNYYRALNLSWELTAPWTGLQIKVPVKFIVGDLDITYNIPGTKEYIHEGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF*T  109
            LK  VP L++VVV++GV HFL+QE P EV +HI  F  KF T
Sbjct  277  LKKHVPFLQEVVVMEGVGHFLHQEKPDEVTDHIYGFFKKFRT  318



>gb|AFK41660.1| unknown [Lotus japonicus]
Length=318

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 164/221 (74%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWG+II W+LCM RP++VKA V LSV F PR+P +  V+G R  YG+D+YICRF+EP
Sbjct  98   VAHDWGSIIGWYLCMLRPERVKAYVCLSVPFLPRNPEIRTVDGMRHAYGDDYYICRFREP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFT-DGSTALPAWLPEEDLDYY  421
            GE+EA+ A +G +  L+NI+    +P P  FPK +   GF  D    LP+WL +EDL Y+
Sbjct  158  GEMEAQMAEVGTEYVLKNILTT-RKPGPPIFPKGEYGTGFNPDTPNTLPSWLTQEDLAYF  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V+++EKTGFTGG+NYYR L L+WELTAPWSG K+ VP KFI G+LD+VY     KEYIH+
Sbjct  217  VSKFEKTGFTGGLNYYRNLNLNWELTAPWSGGKINVPVKFITGELDMVYTSLNMKEYIHD  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNK  118
            GG K DVP LE+V+V +GVAHF NQE P E++NHI +F+ K
Sbjct  277  GGFKEDVPNLEEVIVQKGVAHFNNQETPDEISNHIYDFIKK  317



>ref|XP_002271210.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+LC++RPD+VKALVN+SV F PR+P    +E  RA  G+D+YICRFQEP
Sbjct  98   VGHDWGAVMAWYLCLYRPDRVKALVNMSVPFSPRNPMRKPLESLRAQLGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTA---LPAWLPEEDLDYYV  418
            G IE EFA IGV   L++ +  +  P PL+ PK   F D       LP+WL EE++ YY 
Sbjct  158  GVIETEFAEIGVDRVLKHFL-TYRNPAPLFLPKGNAFGDDPATPIVLPSWLSEEEVHYYT  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +Y+KTGFTGG+NYYR+L  +WELTAP++G +  VPTKFIVGD D+ Y  PG+K++IH G
Sbjct  217  TKYQKTGFTGGLNYYRSLNRNWELTAPFTGYQSKVPTKFIVGDHDMTYHAPGSKDFIHGG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK  VPLLEDV+V++GV HF+++E   E+N HI +F  +F
Sbjct  277  GLKKYVPLLEDVIVMEGVGHFIHEEKSDEINKHIYDFFQQF  317



>ref|XP_006433457.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
 gb|ESR46697.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
Length=317

 Score =   265 bits (678),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAIIAW+LC+F P++VKA V LSV F PR+P++  VE  RA++G+D+YICRFQEP
Sbjct  98   VAHDWGAIIAWYLCLFCPERVKAFVCLSVPFLPRNPNIKPVESMRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G+IEA+ A +G    L+NI+ A  +P P  FP++  F    +    LP+W  E+DL +Y 
Sbjct  158  GKIEAQIAQVGTAEVLKNIL-ANRKPGPSCFPEENAFGIDPENRVTLPSWFSEQDLSFYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ +TGFTG +NYYRA+ L+WE+TA W+  +V VP KFIVG+LD+VY  PG KEY+HNG
Sbjct  217  TKFNQTGFTGALNYYRAMNLNWEMTAAWTEVQVKVPVKFIVGELDMVYTTPGIKEYVHNG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE++VV++   HF+NQE  +E+N HI +F+ KF
Sbjct  277  GFKKDVPLLEEIVVIEDAGHFINQERAEEINAHIYDFIKKF  317



>ref|XP_006419517.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
 gb|ESR32757.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
Length=319

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LC+FRPD++KALVNLSV F P   + +L+E  RA YG+++Y+CRFQ+P
Sbjct  100  VGHDWGALMAWFLCLFRPDRIKALVNLSVVFNPFGSNDNLIEALRAYYGDNYYMCRFQKP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEFA IG +T ++   F F   + ++ PK KGF    +   ALP+WL EED+ Y+ 
Sbjct  160  GEIEAEFAQIGTETVIKEF-FTFWTGDRIFLPKGKGFGRPPNTPIALPSWLSEEDVKYFT  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++K GFTG +NYYR + L+ EL APW+GS++ +PTKFI+GDLD+ Y +PG +EYIH G
Sbjct  219  TKFDKKGFTGAMNYYRNINLNHELLAPWAGSQIQIPTKFIIGDLDMTYHMPGVQEYIHKG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE VV+++GV HF+NQ    E++ HI +F NKF
Sbjct  279  GFKRDVPLLEKVVIMEGVGHFINQGKSNEISKHIYDFFNKF  319



>ref|XP_008386679.1| PREDICTED: bifunctional epoxide hydrolase 2 [Malus domestica]
Length=316

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+ AW  C+FRPD+VKALVN+S+ F PR+P    V+G RA++G+D+YICRFQEP
Sbjct  98   VAHDWGAVXAWWFCLFRPDRVKALVNMSIAFSPRNPKRKPVDGFRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
             EIE +F  IG    ++  + +   P+P   PKD+G         LPAWL EEDL+Y V+
Sbjct  158  EEIERDFDSIGTAAVMKRFLTS-RSPKPPCIPKDQGLKSWAAPVTLPAWLTEEDLNYIVS  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ K+GFTGG+NYYRAL L WELT PW+G ++ VP KFIVG+LD+ Y IPG + YIH GG
Sbjct  217  KFSKSGFTGGLNYYRALNLTWELTGPWTGLQIKVPVKFIVGELDVTYNIPGVQAYIHKGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVP L++VVV++G AHF+ QE P EV+ H+ +F+ KF
Sbjct  277  FKRDVPFLQEVVVMEGAAHFIAQEKPDEVSQHVYDFIKKF  316



>ref|XP_004152245.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156836.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52816.1| hypothetical protein Csa_4G001830 [Cucumis sativus]
Length=316

 Score =   265 bits (677),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 157/221 (71%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW+ C+FRPD+VKALVNLSVHF PR+P +  V+G R  +G+D YICRFQ P
Sbjct  98   VGHDWGAIIAWYFCLFRPDRVKALVNLSVHFLPRNPAISFVQGFRFAFGDDFYICRFQVP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTDGSTA--LPAWLPEEDLDYYV  418
            GE E +F  I      + I+   GR P+P   PK  G     +   LP+WL +ED++Y+ 
Sbjct  158  GEAEKDFGSIDTTELFKKILC--GRTPDPPILPKGLGIRSIPSPHDLPSWLSQEDINYFA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++  TGFTGG NYYRAL L WELTA W+ ++V VP KFIVGDLDL Y  PGAKEYIHNG
Sbjct  216  TKFNHTGFTGGFNYYRALDLTWELTASWNKAQVQVPVKFIVGDLDLTYYFPGAKEYIHNG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP LE+VVV++  AHF+NQE P E++ HI  F+ KF
Sbjct  276  GFKTDVPFLEEVVVMEDTAHFINQERPHEISVHIHEFIKKF  316



>ref|XP_010684348.1| PREDICTED: bifunctional epoxide hydrolase 2 [Beta vulgaris subsp. 
vulgaris]
Length=319

 Score =   265 bits (677),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 163/220 (74%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAWH  +FRPD++KALVNLSV F PR+P L  VE  R   G+D YICRFQEP
Sbjct  101  VGHDWGAIIAWHFSLFRPDRIKALVNLSVPFTPRNPTLKPVERLRNSLGDDFYICRFQEP  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK--GFTDGSTALPAWLPEEDLDYYVN  415
            GE+E E   I     ++  + +   PEP  FPK K     +    LP+WL EED++Y+ +
Sbjct  161  GEMEKELDSIDTAKLMKKFLVS-RDPEPPCFPKGKLAAAAEKPVTLPSWLSEEDINYFAD  219

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++++TGFTGG+NYYR++ L WEL APW+G +V VPTKFI+G+LD+ Y+ P  K YIHNGG
Sbjct  220  KFKQTGFTGGLNYYRSMDLTWELMAPWTGMQVKVPTKFILGELDITYRFPLTKNYIHNGG  279

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            +K DVPLL+DVV+++G AHF+NQE P+E++ HI+++ ++F
Sbjct  280  MKRDVPLLDDVVIMEGAAHFINQERPEEISKHILDYFDQF  319



>ref|XP_006604802.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43315.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 163/222 (73%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPDKVKA V LSV F  R P++  V+G RA+YG+D+Y+CRFQ+P
Sbjct  98   VAHDWGAIIGWYLCMFRPDKVKAYVCLSVPFLRRDPNIRTVDGMRALYGDDYYVCRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFT-DGSTALPAWLPEEDLDYY  421
            GE+EA+ A +G    L+NI+ +  +  P + P  +   GF  D S +LP+WL E+DL YY
Sbjct  158  GEMEAQMAEVGTGYVLKNILTS-RKTGPPFLPHGEFGTGFNPDMSDSLPSWLTEDDLAYY  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V+++EKTGFTGG+NYYR   LDWELTAPW+G ++ VP KFI G+LD VY     KEYIH 
Sbjct  217  VSKFEKTGFTGGLNYYRNFNLDWELTAPWTGVQIKVPVKFITGELDSVYTSLNLKEYIHG  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE V+V +GVAHF NQEA +E+N HI +F+ KF
Sbjct  277  GGFKQDVPNLEQVIVQKGVAHFNNQEAAEEINTHIYDFIKKF  318



>gb|AFK34299.1| unknown [Lotus japonicus]
Length=318

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 164/221 (74%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWG+II  +LCMFRP++VKA V LSV F PR+P +  V+G R  YG+D+YICRFQEP
Sbjct  98   VAHDWGSIIGRYLCMFRPERVKAYVCLSVPFLPRNPEIRTVDGMRHAYGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFT-DGSTALPAWLPEEDLDYY  421
            GE+EA+ A +G +  L+NI+    +P P  FPK +   GF  D    LP+WL +EDL Y+
Sbjct  158  GEMEAQMAEVGTEYVLKNILTT-RKPGPPIFPKGEYGTGFNPDTPNTLPSWLTQEDLAYF  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V+++EKTGFTGG+NYYR L L+WELTAPWSG K+ VP KFI G+LD+VY     KEYIH+
Sbjct  217  VSKFEKTGFTGGLNYYRNLNLNWELTAPWSGRKINVPVKFITGELDMVYTSLNMKEYIHD  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNK  118
            GG K DVP LE+V+V +GVAHF NQE P E++NHI +F+ K
Sbjct  277  GGFKEDVPDLEEVIVQKGVAHFNNQETPDEISNHIYDFIKK  317



>ref|XP_010556730.1| PREDICTED: bifunctional epoxide hydrolase 2 [Tarenaya hassleriana]
Length=316

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 158/220 (72%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LC+ RPD+V ALVN SV F PR+P +  V+G RA++G+D+YICRFQE 
Sbjct  98   VGHDWGAIVAWWLCLIRPDRVNALVNTSVAFSPRNPAVKPVDGFRALFGDDYYICRFQER  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA  G K  +   + +   P P   PK  GF       +LP WL E+D+DYY  
Sbjct  158  GEIEEDFAQAGAKKLITKFLTS-RNPRPPCIPKALGFRGLPDPPSLPDWLTEQDIDYYAE  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L WELTAPW+G+++ VP KF+VGDLD+ Y IPG KEYIH GG
Sbjct  217  KFSQKGFTGGLNYYRAMNLSWELTAPWTGAQIKVPVKFMVGDLDVTYHIPGVKEYIHEGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            +K  VP L++VVVL+GV HFL QE P+E+  HI +F  KF
Sbjct  277  IKKQVPFLQEVVVLEGVGHFLQQEKPEEITAHIHDFFKKF  316



>ref|XP_010693593.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=369

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 158/218 (72%), Gaps = 0/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LC+FRPD+VKALVN+SV F PR+P +  ++  RA YG+ +YI RFQ P
Sbjct  152  VGHDWGAIVAWWLCLFRPDRVKALVNMSVAFSPRNPKMKPLDMLRAAYGDSYYIVRFQVP  211

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G+IE E    G        I++   P PL+ PK + F D   + P+W+ +E + YY +++
Sbjct  212  GDIEEEIMEAGGAEIFLRKIYSHHSPGPLFLPKGESFNDVPASFPSWMSKEMIAYYCDKF  271

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
             +TGFTGG+NYYRAL L+WE+TAPW+G++V VPTKFIVGDLDL Y   G K+YIH GG+K
Sbjct  272  SQTGFTGGLNYYRALNLNWEITAPWTGAQVKVPTKFIVGDLDLTYNATGVKDYIHKGGMK  331

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVPLLEDVV+L+GV HFL  E P  ++ HI +F+ KF
Sbjct  332  RDVPLLEDVVILEGVHHFLQHEKPDMISKHIYDFIKKF  369



>ref|XP_006396441.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
 gb|ESQ37894.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
Length=316

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 156/220 (71%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LCM RPD+V ALVN SV F PR+P +  V+  RA++G+D+Y+CRFQEP
Sbjct  98   VGHDWGAIVAWWLCMIRPDRVNALVNTSVVFNPRNPSVKPVDAFRALFGDDYYVCRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA    K  L N  F    P P   PK  GF        LPAWL E+D+ +Y +
Sbjct  158  GEIEEDFAQADTKK-LINRFFTSRNPRPPCIPKTLGFRGLPDPPPLPAWLTEQDVRFYAD  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRAL L WELTAPW+G ++ VP KFIVGDLDL Y IPG KEYIH GG
Sbjct  217  KFSQKGFTGGLNYYRALNLSWELTAPWAGLQIKVPVKFIVGDLDLTYHIPGTKEYIHEGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK  VP L++VVV++GV HFL+QE P EV +HI  F  KF
Sbjct  277  LKKHVPFLQEVVVMEGVGHFLHQEKPDEVTDHIYGFFKKF  316



>ref|XP_003632381.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW+ C+ RPD+VKALVN+SV F PR+P    +E  R ++G+D+Y+CRFQEP
Sbjct  98   VGHDWGAAIAWYFCLLRPDRVKALVNMSVVFRPRNPTRKPIESMRVLFGDDYYMCRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDG---STALPAWLPEEDLDYYV  418
            G  E EFA +G +T ++ I      P P   PK+  ++      TALP WL +ED+DY+ 
Sbjct  158  GLAENEFARLGTETVMK-IFLGSRNPRPPRMPKESWYSGALKTPTALPPWLSQEDIDYFA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++ + GFTGG+NYYRAL L WE  APW+G  + VP KFIVGDLD  Y  PG KEYIHNG
Sbjct  217  SKFNQNGFTGGLNYYRALDLSWEALAPWTGVPIKVPVKFIVGDLDTTYNTPGVKEYIHNG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K +VP L+++V+++GVAHF+NQE P+E+N HI +F+ +F
Sbjct  277  GFKREVPFLQELVIMEGVAHFINQERPEEINAHIYDFIRRF  317



>ref|XP_003626243.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08020.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82461.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 161/222 (73%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+I W+LCMFRP+++KA V LSV F  R+P +  ++G RA YG+D+YICRFQEP
Sbjct  99   VAHDWGAMIGWYLCMFRPERIKAYVCLSVPFNHRNPTVKPIDGRRAAYGDDYYICRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFT-DGSTALPAWLPEEDLDYY  421
            G+IEAE A +G    L+N++       P+  PK +   GF  D    LP WL E+DL Y+
Sbjct  159  GKIEAEIAEVGTAYVLKNVLTTRKTGPPI-LPKGEFGTGFNPDTPETLPTWLTEDDLAYF  217

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V++YEKTGFTGG+NYYR   L+WELTAPWSG K+ VP KFI GDLD+VY  P  KEYIH 
Sbjct  218  VSKYEKTGFTGGLNYYRNFNLNWELTAPWSGVKIKVPVKFITGDLDMVYTSPHVKEYIHG  277

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE+V+V +GVAHF NQEA +E++NHI  F+ KF
Sbjct  278  GGFKEDVPNLEEVIVQKGVAHFNNQEAAEEISNHIYEFIKKF  319



>gb|KHG07158.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=316

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 163/220 (74%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C+FRPD++KALVNLSV + PR+P +  V+G+RA++G+D YICRFQ P
Sbjct  98   VGHDWGAMIAWNFCLFRPDRIKALVNLSVPYHPRNPKVKTVDGYRALFGDDFYICRFQVP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GE EA FA +     L+  +     P P   PK+ G        ALP+WL E++++Y+  
Sbjct  158  GEAEAHFAQMDTAKVLKKFLTT-RDPNPPCIPKETGLKALPDPPALPSWLSEDEINYFAT  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L+WEL APW+G ++ VP KFIVGDLD+ Y IPG KEY+ NGG
Sbjct  217  KFNQKGFTGGLNYYRAMNLNWELMAPWTGLQIQVPVKFIVGDLDITYHIPGVKEYLQNGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K +VP L+++VV++GVAHF+NQE PQE++ HI +F+ KF
Sbjct  277  FKKNVPFLQELVVMEGVAHFINQEKPQEISMHIYDFVKKF  316



>emb|CDP17111.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+ C+ RPD++KALVN+SV F PR+P    +E  RA +G+D+YICRFQEP
Sbjct  98   VGHDWGAVMAWYFCLLRPDRIKALVNMSVVFTPRNPKRKPLEAMRARFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGS---TALPAWLPEEDLDYYV  418
            GE E EFA +     ++  + +  RP PL  PK+ GF         LP+WL E+D++Y+ 
Sbjct  158  GEAEEEFARVDTARIIKKFLTS-RRPGPLCVPKEVGFGGSPHNPIQLPSWLSEDDVNYFA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++ + GFTGG+NYYRA+ L+WELTAPW+G ++ VP KFIVGDLD+ +  PG KEYI  G
Sbjct  217  SKFSQKGFTGGLNYYRAMDLNWELTAPWTGLQIKVPVKFIVGDLDVTFTTPGVKEYIQKG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L+++VV++GVAHF+NQE P+EV+ HI +F+ KF
Sbjct  277  GFKRDVPFLQELVVMEGVAHFVNQEKPEEVSAHIYDFIQKF  317



>ref|XP_002523108.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39293.1| epoxide hydrolase, putative [Ricinus communis]
Length=316

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 162/220 (74%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+LCMFRPD++KALVN SV +  R+P L  +E  R +YG+D+Y+CRFQEP
Sbjct  98   VGHDWGAMMAWYLCMFRPDRIKALVNTSVAYMSRNPQLKSLELFRTVYGDDYYVCRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            G  E +FA +     ++++ F    P P   PK+ GF       +LP+WL EED++YY +
Sbjct  158  GGAEEDFAQVDTAKLIRSV-FTSRDPNPPIVPKEIGFRSLPDPPSLPSWLSEEDVNYYAD  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ K GFTGG+NYYR +  +WELTAPW G ++ VP KF++GDLDL Y  PG K+YIHNGG
Sbjct  217  KFNKKGFTGGLNYYRNIDQNWELTAPWDGLQIKVPVKFVIGDLDLTYHFPGIKDYIHNGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K  VPLL++VVV++GVAHF+NQE P+E++ HI +F+ KF
Sbjct  277  FKQVVPLLQEVVVMEGVAHFINQEKPEEISEHIYDFIKKF  316



>ref|XP_007163124.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
 gb|ESW35118.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
Length=317

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW+ C+ RP+++KALVN+SV F PR+P    ++  RAM G+D+YICRFQ+P
Sbjct  98   VGHDWGASIAWYFCLLRPERLKALVNMSVVFRPRNPKRKPIQSLRAMMGDDYYICRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GE+E +FA  G    ++  + A   P P    K+ GF    D   ALP+WL EED++YY 
Sbjct  158  GEVEEDFARAGAARIIKKFL-ASRDPRPPRASKEIGFGGSPDLHVALPSWLSEEDVNYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++E+ GFTGG+NYYRA+ L WELTA W+G ++ VP KFIVGDLD+ Y  PG KEYIHNG
Sbjct  217  SKFEQKGFTGGLNYYRAMDLTWELTAAWTGVQIKVPVKFIVGDLDITYNTPGVKEYIHNG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L++++V++GVAHF+N+E P+E++ HI +F+ KF
Sbjct  277  GFKRDVPFLQELIVMEGVAHFINEERPEEISAHIYDFIKKF  317



>ref|XP_006444386.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 ref|XP_006479994.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
 dbj|BAD13534.1| soluble epoxide hydrolase [Citrus jambhiri]
 gb|ESR57626.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 gb|KDO87173.1| hypothetical protein CISIN_1g021158mg [Citrus sinensis]
Length=316

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 160/220 (73%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C+FRPD+VKALVN+SV F PR+P +  +   RA+YG+D+YICRFQEP
Sbjct  98   VGHDWGALIAWYFCLFRPDRVKALVNMSVPFPPRNPAVRPLNNFRAVYGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE EFA I     ++  +     P+PL  PKD G +     +ALP+WL EED++YY +
Sbjct  158  GEIEEEFAQIDTARLMKKFL-CLRIPKPLCIPKDTGLSTLPDPSALPSWLSEEDVNYYAS  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTG VNYYR   L+WEL APW+G ++ VP K+IVGD DLVY   G KEYIHNGG
Sbjct  217  KFNQKGFTGPVNYYRCWDLNWELMAPWTGVQIKVPVKYIVGDQDLVYNNKGTKEYIHNGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K  VP L+DVVV++GVAHF+NQE  +EV  HI  F+ KF
Sbjct  277  FKKYVPYLQDVVVMEGVAHFINQEKAEEVGAHIYEFIKKF  316



>ref|XP_010914488.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 161/218 (74%), Gaps = 1/218 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LCMFRPD+VKALVNLSV F PR+P    V+  R +YG+D+Y+CRFQEP
Sbjct  101  VGHDWGALIAWNLCMFRPDRVKALVNLSVAFMPRNPAKKPVDYFRHLYGDDYYVCRFQEP  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G IEA+FA I   +  + +      P PL  PK+         LP+WL EED++++ +++
Sbjct  161  GAIEAKFAQIETASIFR-MFLPSRDPGPLLMPKEGWNVPEKIPLPSWLSEEDINFFASKF  219

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            +K+GFTG VNYYR L L+WELTAPW+G+++ VP KFIVGDLDL Y  PG ++YIH GG K
Sbjct  220  DKSGFTGPVNYYRCLNLNWELTAPWTGAQIKVPVKFIVGDLDLTYHYPGIQDYIHKGGFK  279

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             +VPLL++VVV++GV HF+NQE   E+ +HI  F+ KF
Sbjct  280  QNVPLLQEVVVMEGVGHFINQEKAHEITDHIYEFIQKF  317



>ref|XP_003563920.2| PREDICTED: bifunctional epoxide hydrolase 2-like [Brachypodium 
distachyon]
Length=355

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 162/219 (74%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+ AW LC+FRPD+V+A+V LSV F PR P    V+G RA++G+++Y+CR QEP
Sbjct  137  VAHDWGAVTAWSLCLFRPDRVRAMVALSVAFTPRSPARKPVDGLRALFGDEYYVCRIQEP  196

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G IEAEFA +G    L+   F +  P PL+ PK   G  D    LP+W+ EED+ YY  +
Sbjct  197  GAIEAEFARLGTDLVLRKF-FTYRTPGPLFIPKSGWGSPDDEVPLPSWITEEDVKYYATQ  255

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            ++KTGFTGG+NYYRAL   WELT+PW+G+++ VP KF++GDLDL Y  PG +++I+ GGL
Sbjct  256  FDKTGFTGGLNYYRALNKTWELTSPWTGAEIKVPVKFVIGDLDLTYHTPGIQDFINKGGL  315

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL+DVV+++ V HF+N+E P+EV+ HII+F+ KF
Sbjct  316  KKYVPLLDDVVIMKDVGHFINEEKPEEVSAHIISFIKKF  354



>gb|KDP28186.1| hypothetical protein JCGZ_13957 [Jatropha curcas]
Length=319

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 165/223 (74%), Gaps = 6/223 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHL-DLVEGHRAMYGNDHYICRFQE  592
            VGHDWG+IIAW+ C+FRPD++KALVN SV F PR P L + VE  RA+ G+D+Y+CRFQ 
Sbjct  98   VGHDWGSIIAWYFCLFRPDRIKALVNTSVAFTPRFPQLLNPVENLRAIIGDDYYVCRFQG  157

Query  591  PGEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKG----FTDGSTALPAWLPEEDLDY  424
            P E EA+FA +   + L++I +    P+P   PK+      F D   +LP+WL EED+DY
Sbjct  158  PIEHEAQFAGVNTASLLRSI-YTARDPKPPRIPKNIAYESLFPDSLCSLPSWLSEEDIDY  216

Query  423  YVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH  244
            +  ++++TGFTGG+NYYR LK  WEL APW+G +V VP KFIVGDLD  Y +PG KEY++
Sbjct  217  FATKFKQTGFTGGLNYYRNLKSTWELMAPWTGQQVKVPVKFIVGDLDTAYNLPGVKEYVN  276

Query  243  NGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            NGG KNDVPLLE+VV+++GVAHF+ QE  QE++ HI +F+ KF
Sbjct  277  NGGFKNDVPLLEEVVIMEGVAHFIIQEKAQEISQHIYDFIKKF  319



>ref|XP_009335707.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
 ref|XP_009335715.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=316

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 159/221 (72%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA++AW  C+FRPD+VKALVN+SV F PR+P    ++  RA++G+D+YICRFQEP
Sbjct  98   VAHDWGAVMAWWFCLFRPDRVKALVNMSVAFSPRNPKRKPIDTFRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYV  418
            GEIE +F  I     ++   F  GR P+P   PKD+G         LPAWL EED++Y+ 
Sbjct  158  GEIEQDFDSIDTAAVMKR--FLTGRSPKPPCIPKDQGLKSWAAPVTLPAWLTEEDVNYFA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++ KTGFTGG+NYYRAL L WELT PW+G ++ VP KFIVGDLD+ Y IPG + YIH G
Sbjct  216  SKFSKTGFTGGLNYYRALNLTWELTGPWTGLQIKVPVKFIVGDLDITYHIPGIQNYIHKG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DV  L++VVV++  AHF+NQE P EV+ H+ +F+ KF
Sbjct  276  GFKRDVAFLQEVVVMEDAAHFINQEKPDEVSQHVYDFIKKF  316



>ref|XP_009775353.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional epoxide hydrolase 
2-like [Nicotiana sylvestris]
Length=318

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 162/222 (73%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+  +FRPD++KALVNLSV F PRHP    V+  R ++G+D+Y+CRFQ+P
Sbjct  98   VGHDWGALIAWYFSLFRPDRIKALVNLSVVFRPRHPSRKPVDSLRELFGDDYYVCRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF----TDGSTALPAWLPEEDLDYY  421
            GE+E EFA +   T ++  + +   P P   PK+ GF          LP+W+ EED+ Y+
Sbjct  158  GEVEEEFASVDTATVVKGFLSS-RDPRPPCIPKEIGFHQALAKSPATLPSWITEEDVHYF  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
              + ++TGFTGG+NYYR L  +WELTAP+SG K+ VPTKF+VGDLD  Y +PG KEYIHN
Sbjct  217  AEKLKETGFTGGLNYYRNLDKNWELTAPFSGCKIQVPTKFVVGDLDXTYHVPGTKEYIHN  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K +VP L++VVV++GV HF+NQE P E+N+HI +F+ +F
Sbjct  277  GGFKKEVPNLQEVVVMEGVGHFINQEKPDEINSHIYDFIQRF  318



>ref|XP_007015342.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32961.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW++C+FRPD+VKAL NLSV F P +P    VE  +A +GNDHYI RFQEP
Sbjct  100  VGHDWGAIIAWYMCLFRPDRVKALFNLSVPFIPYNPRFKPVETWKAYFGNDHYIVRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAEF  IG+   +  ++ ++  P+PLY PK   F    DG   LP WL  +D +YY 
Sbjct  160  GVIEAEFEEIGLGRAVLELL-SYRVPDPLYLPKGNLFGHPLDGPVDLPPWLSHQDANYYA  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++EKTG T  +NYYR    +WEL+APWSGS++ VP KF++GDLDLVY +PG KEYIHNG
Sbjct  219  TQFEKTGITPALNYYRNFDRNWELSAPWSGSQIKVPVKFVMGDLDLVYTMPGMKEYIHNG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP LE+ VV++GV H++NQE P ++N  + +F +KF
Sbjct  279  GFKRDVPFLEEAVVMKGVTHWINQEKPDDINKQMFDFFSKF  319



>ref|XP_009629123.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 161/222 (73%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+  +FRPD++KALVNLSV F PRHP    V+  R ++G+D+Y+CRFQ+P
Sbjct  98   VGHDWGALIAWYFSLFRPDRIKALVNLSVVFRPRHPSRKPVDSLRELFGDDYYMCRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF----TDGSTALPAWLPEEDLDYY  421
            GE+E EFA +   T ++  + +   P P   PK+ GF          LP+W+ EED+ Y+
Sbjct  158  GEVEEEFASVDTATVIKGFLSS-RDPRPPCIPKEIGFHQALAKSPATLPSWITEEDVHYF  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
              + +KTGFTGG+NYYR L  +WELTAP+SG K+ VPTKF+VGDLD  Y +PG KEYIHN
Sbjct  217  AEKLKKTGFTGGLNYYRNLDKNWELTAPFSGCKIQVPTKFVVGDLDATYHVPGTKEYIHN  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K +VP L++VVV++G  HF+NQE P E+N+HI +F+ +F
Sbjct  277  GGFKKEVPNLQEVVVMEGAGHFINQEKPAEINSHIYDFIQRF  318



>ref|XP_010094462.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB56095.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 158/221 (71%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V  DWG ++AW+LC+FRP+KVKA V L V F PR+P +  VE  RA +G+D+Y+CRFQEP
Sbjct  99   VAQDWGCLMAWYLCLFRPEKVKAFVCLGVPFRPRNPKMKPVESMRAFFGDDYYMCRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAE A +G    L+ I+    +P P + PK K F    D S  LP+WL EEDL+YY 
Sbjct  159  GEIEAEMAQVGASAVLKKILTT-RKPGPPFLPKGKAFRADPDASVTLPSWLSEEDLNYYA  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++  GFTGG+NYYR L ++WEL A W G++V VP KFIVGDLD+VY  PG KEY+HNG
Sbjct  218  TKFKLKGFTGGLNYYRNLDINWELMAAWDGAEVKVPVKFIVGDLDMVYTTPGTKEYVHNG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L++VVV++   HF++QE  +E++ HI +F+ KF
Sbjct  278  GFKKDVPYLQEVVVIEDAGHFISQERAEEISTHIYDFIQKF  318



>ref|XP_008454327.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=315

 Score =   263 bits (671),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 157/219 (72%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+ C+FRPD+VKALVNLSVH+ PR+P    +   R   G+D YIC+FQEP
Sbjct  98   VGHDWGAMMAWYFCLFRPDRVKALVNLSVHYTPRNPAGSPLAVTRRYLGDDFYICKFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKD-KGFTDGSTALPAWLPEEDLDYYVNR  412
            G  EA+F  +   T ++  +     P P   P   K   +    LP+WL EED++Y+ ++
Sbjct  158  GVAEADFGSVDTATMMKKFL-TMRDPRPAIIPNGFKTLLETPEILPSWLTEEDIEYFASK  216

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            + KTGFTGG NYYRAL + WELT PWS +++ VPTKFIVGDLDLVY  PGAKEYIH GG 
Sbjct  217  FSKTGFTGGFNYYRALDITWELTGPWSRAQIKVPTKFIVGDLDLVYNFPGAKEYIHGGGF  276

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K DVPLLEDVVV++G AHF+NQE P E+++ I +F+ KF
Sbjct  277  KKDVPLLEDVVVIEGAAHFINQEKPDEISSLIYDFITKF  315



>ref|XP_011092097.1| PREDICTED: bifunctional epoxide hydrolase 2 [Sesamum indicum]
Length=317

 Score =   262 bits (670),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 156/220 (71%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+I W+LC+FRPD VKA V+L+V F PRHP++  VEG RA +G D+Y+CRFQEP
Sbjct  99   VAHDWGAMIGWYLCLFRPDLVKAYVSLTVPFRPRHPNVKPVEGMRAFFGEDYYMCRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDG--STALPAWLPEEDLDYYVN  415
            G++E+E A  G +  ++ I+     P P Y PK+  F        LP W  E+DL YY  
Sbjct  159  GKMESEIARYGAEAVIKKIL-TDRTPGPPYLPKETPFGSNIDDIKLPPWFTEDDLKYYAE  217

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
             YEK GFTGG+NYYRAL L+WELTA W+G+KV VP KF+VGD+D+VY  PG KEY+H GG
Sbjct  218  NYEKRGFTGGLNYYRALDLNWELTAAWTGAKVRVPVKFVVGDVDMVYTTPGLKEYVHGGG  277

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             KNDVPLLE+ VV+  V HFLNQE   EVN +I  F+ KF
Sbjct  278  FKNDVPLLEECVVMDNVGHFLNQEKADEVNAYIHEFIKKF  317



>ref|XP_010456047.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 157/222 (71%), Gaps = 3/222 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LCM RPD+VKALVN SV F PR+P +  V+  RA++G+D+YICRFQE 
Sbjct  98   VGHDWGAIVAWWLCMIRPDRVKALVNTSVVFNPRNPTVKPVDKFRALFGDDYYICRFQEA  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +  K  +    F    P P   PK  GF       +LPAWL E+D+ +Y +
Sbjct  158  GEIEEDFAQVDTKKLITRF-FVSRNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVSFYGD  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEYIH GG
Sbjct  217  KFGQKGFTGGLNYYRAMNLSWELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHGGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF*T  109
            LK  VP L++VVV++GV HFL QE P EV +HI  F  KF T
Sbjct  277  LKKHVPFLQEVVVMEGVGHFLQQEKPDEVTDHIYGFFEKFRT  318



>gb|KJB23306.1| hypothetical protein B456_004G091300 [Gossypium raimondii]
Length=316

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 163/220 (74%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C+FRPD++KALVNLS+ + PR+P +  V+G+RA++G+D YICRFQ P
Sbjct  98   VGHDWGAMIAWNFCLFRPDRIKALVNLSIPYHPRNPKVKTVDGYRALFGDDFYICRFQVP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GE EA FA +     ++  +     P P   P++ G        ALP+WL E++++Y+  
Sbjct  158  GEAEAHFAQMDTAKVMKKFLTT-RDPNPPCIPRETGLKALPDPPALPSWLSEDEINYFAT  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L+WEL APW+G ++ VP KFIVGDLD+ Y IPG KEY+ NGG
Sbjct  217  KFSQKGFTGGLNYYRAMNLNWELMAPWTGLQIQVPVKFIVGDLDITYHIPGVKEYLQNGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K +VP L+++VV++GVAHF+NQE PQE++ HI +F+ KF
Sbjct  277  FKKNVPFLQELVVMEGVAHFINQEKPQEISMHIYDFIKKF  316



>ref|XP_010104146.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB98711.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 157/221 (71%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V  DWG ++AW+LC+FRP+KVKA V L V F PR+P +  VE  RA +G+D+Y+CRFQEP
Sbjct  99   VAQDWGCLMAWYLCLFRPEKVKAFVCLGVPFRPRNPKMKPVESMRAFFGDDYYMCRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAE A +G    L+ I+    +P P + PK K F    D S  LP+WL EEDL+YY 
Sbjct  159  GEIEAEMAQVGASAVLKKILTT-RKPGPPFLPKGKAFRADPDASVTLPSWLSEEDLNYYA  217

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++  GFTGG+NYYR L ++WEL A W G++V VP KFIVGDLD+VY  PG KEY+HNG
Sbjct  218  TKFKLKGFTGGLNYYRNLDINWELMAAWDGAEVKVPVKFIVGDLDMVYTTPGTKEYVHNG  277

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L++VVV++   HF+ QE  +E++ HI +F+ KF
Sbjct  278  GFKKDVPYLQEVVVIEDAGHFIGQERAEEISTHIYDFIQKF  318



>gb|KHG24497.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=317

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 153/221 (69%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LC+FRPD+VKA V LSV F PR P +  VE  R  +G+D+YICRFQEP
Sbjct  98   VAHDWGAIIGWYLCLFRPDRVKAFVCLSVPFMPRKPQMKPVESMRLFFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G+IEAE A  G    L+ II +  +P P   PKD  F    D    LP+W  EEDL YY 
Sbjct  158  GKIEAEIARYGASNVLKKIISS-RKPGPPCMPKDNAFGIKPDTPITLPSWFSEEDLSYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++ K GFTG +NYYRA  L+WE TAPW+ ++V VP KFIVGDLD VY  PG KEY++ G
Sbjct  217  NKFNKKGFTGALNYYRAFDLNWEQTAPWTNTQVKVPVKFIVGDLDSVYTTPGMKEYVNGG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              K D P+LE+VV+++GV HF+NQE   E+N+HI +F+  F
Sbjct  277  DFKRDAPMLEEVVIMKGVGHFINQERADEINSHIHDFIKNF  317



>ref|XP_010422608.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 157/222 (71%), Gaps = 3/222 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LCM RPD+VKALVN SV F PR+P +  V+  RA++G+D+Y+CRFQE 
Sbjct  98   VGHDWGAIVAWWLCMIRPDRVKALVNTSVVFNPRNPSVKPVDKFRALFGDDYYVCRFQEA  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +  K  +    F    P P   PK  GF       +LPAWL E+D+ +Y +
Sbjct  158  GEIEEDFAQVDTKKLITRF-FVSRNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVSFYGD  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEY+H GG
Sbjct  217  KFSQKGFTGGLNYYRAMNLSWELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYLHGGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF*T  109
            LK  VP L++VVV++GV HFL QE P EV +HI  F  KF T
Sbjct  277  LKKHVPFLQEVVVMEGVGHFLQQEKPDEVTDHIYGFFEKFKT  318



>emb|CDP17206.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAW+LC+FRPD VKA V+L++ F PR+P +  + G RA +G ++Y+CRFQEP
Sbjct  98   VAHDWGAMIAWYLCLFRPDMVKAFVSLTLPFRPRNPKMKPIAGLRAFFGEEYYMCRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAE A  G K  L+ I+    +P P   PK   F    D    LPAWL EEDL YY 
Sbjct  158  GEIEAEIAKYGSKAVLKKIL-TDRKPGPPCLPKGNPFGISPDTDIKLPAWLSEEDLKYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N+Y + GFTGG+NYYRAL L+WELTA W+G++V VP KFIVGDLD+VY  PG +EY+H G
Sbjct  217  NKYAQKGFTGGLNYYRALDLNWELTAAWTGAQVKVPVKFIVGDLDMVYTTPGTQEYVHGG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP LE+ V+++G  HFL+QE  +E+N+HI +F+  F
Sbjct  277  GFKRDVPFLEEPVIMKGTGHFLHQERAEEINHHIHHFIKMF  317



>ref|XP_004229259.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=335

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 163/225 (72%), Gaps = 5/225 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+++W LC++RPDKVKA V LSV F PR+P    ++  R +YG+D+Y+ RFQE 
Sbjct  103  VGHDWGAVVSWALCLYRPDKVKAFVCLSVAFNPRNPLNKPLDTLRKVYGDDYYVVRFQEA  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTA----LPAWLPEEDLDYY  421
            G IE EF  +G+K  L+  +  +  P PLY  K K F D S+     LPAWL  ED+D+Y
Sbjct  163  GVIEGEFEELGIKNVLKKFL-TYRTPGPLYLKKGKPFEDTSSTNDDELPAWLSHEDIDFY  221

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             N+Y++ GFTG +NYYR++  +WE+TA W+G+K+ VP KFIVGDLD+ Y  PGAK+Y+H 
Sbjct  222  ANKYKQIGFTGALNYYRSIDRNWEVTAAWTGAKIQVPVKFIVGDLDITYNAPGAKDYLHK  281

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF*TF  106
            GG K  VPLLEDVVVLQGV HF++QE P+E+N HI N++ K  ++
Sbjct  282  GGFKKLVPLLEDVVVLQGVGHFIHQEKPKEINEHIYNYITKISSY  326



>ref|XP_010434902.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=379

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 161/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LC +RPDKVKALVN+SV F PR+     V   R  +G+D+YICRFQ+P
Sbjct  159  VGHDWGAMLAWQLCQYRPDKVKALVNMSVLFSPRNSQRVPVTTLRHTFGDDYYICRFQKP  218

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEF  +G +  L+  +  +  P PL+ PK K F    + + ALP WL +EDLDYYV
Sbjct  219  GEIEAEFKKLGTEKVLKEFL-TYKTPGPLHLPKGKCFERLENDACALPPWLTQEDLDYYV  277

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +Y+K GFTG +NYYR +  +WELTAPW+G+K+ VP KFIVG  DL Y  PGAKEYI++G
Sbjct  278  TKYDKKGFTGPINYYRNIDRNWELTAPWTGAKIHVPVKFIVGGQDLTYNFPGAKEYINDG  337

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLL++ VVL+G+ HFL++E P  +N HI NF +KF
Sbjct  338  GFKRDVPLLDETVVLKGLGHFLHEEDPDVINQHIHNFFHKF  378



>ref|NP_193331.6| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE83674.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=375

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 161/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW LC +RP+KVKALVN+SV F PR+P    V   R ++G+D+Y+CRFQ+ 
Sbjct  155  VGHDWGAMIAWQLCQYRPEKVKALVNMSVLFSPRNPVRVPVPTLRHVFGDDYYVCRFQKA  214

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIE EF  +G +  L+  +  +  P PL  PKDK F    + ++ALP WL +EDLDYYV
Sbjct  215  GEIETEFKKLGTENVLKEFL-TYKTPGPLNLPKDKYFKRSENAASALPLWLTQEDLDYYV  273

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +YE  GFTG +NYYR +  +WELTAPW+G+K+ VP KFI+GD DL Y  PGAKEYI+ G
Sbjct  274  TKYENKGFTGPINYYRNIDRNWELTAPWTGAKIRVPVKFIIGDQDLTYNFPGAKEYINGG  333

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLL++ VVL+G+ HFL++E P  +N HI NF +KF
Sbjct  334  GFKRDVPLLDETVVLKGLGHFLHEENPDVINQHIHNFFHKF  374



>ref|XP_004152242.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156832.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52825.1| hypothetical protein Csa_4G001920 [Cucumis sativus]
Length=316

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 157/220 (71%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW+ C+FRP+++KALVNLSV FFPR+P +  ++  RA YG+D Y+CRFQ P
Sbjct  98   VGHDWGAIIAWYFCLFRPERIKALVNLSVQFFPRNPAISFIQRFRAAYGDDFYMCRFQVP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GE EA+FA I      +  +       P   PK+ GF        LP+WL EED++YY  
Sbjct  158  GEAEADFACIDTAQLFKTTLSTRSTEAPC-LPKEYGFRAIPPPENLPSWLTEEDINYYAA  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++++TGFTG +NYYRA  L WELTAPW+G ++ VP KFIVGDLD+ Y   GAKEYIH+GG
Sbjct  217  KFKETGFTGALNYYRAFDLTWELTAPWTGVQIQVPVKFIVGDLDITYHFKGAKEYIHDGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVPLLE+VV+++   HF+++E P E+N HI +F+ KF
Sbjct  277  FKRDVPLLEEVVIVKNAGHFVHEEKPHEINTHIHDFIKKF  316



>gb|EMS55500.1| Epoxide hydrolase 2 [Triticum urartu]
Length=259

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 158/219 (72%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAI AW LC FRPD+VKALV LSV F PR P +  V+  RA+YG+D YIC FQ+P
Sbjct  41   VAHDWGAITAWSLCQFRPDRVKALVALSVPFTPRSPAVKPVDAVRALYGDDFYICSFQDP  100

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G IEAEF  +G +  L+   FA     PL+ PK   G  D    LP+W+ +ED+ YY  +
Sbjct  101  GAIEAEFKRLGTELVLRKF-FADRSASPLFIPKSGWGSPDDEVPLPSWITDEDVKYYTTQ  159

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            ++K+GFTGG NYYRAL   WELT+PW+G+++MVPTKFIVGDLDL Y I GAK++I+ GG 
Sbjct  160  FDKSGFTGGFNYYRALNKTWELTSPWTGAEIMVPTKFIVGDLDLTYNIAGAKDFINKGGF  219

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL+ VV+++ V HF+N+E P+E++  II+F+ KF
Sbjct  220  KKFVPLLDGVVIMKDVGHFINEEKPEEISALIISFIKKF  258



>ref|XP_004290809.1| PREDICTED: bifunctional epoxide hydrolase 2 [Fragaria vesca subsp. 
vesca]
Length=316

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 161/221 (73%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+IAW  C+FRPD+VK LVN+SV F PR+P    V+G +A++G+D+YICRFQEP
Sbjct  98   VAHDWGAVIAWWFCLFRPDRVKCLVNMSVAFNPRNPKRKPVDGFKALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTDGSTA--LPAWLPEEDLDYYV  418
            GE EA F  +   + ++  +F  GR P P    K+ GF        +PAWL EED++Y+ 
Sbjct  158  GEAEAYFGGLDTASVMK--MFLTGRNPAPPKISKELGFASWKPVEPMPAWLSEEDVNYFA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ KTGFTGG+NYYRA+ L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEYIHNG
Sbjct  216  TKFSKTGFTGGLNYYRAINLTWELTAPWTGVQIKVPVKFIVGDLDITYNIPGIKEYIHNG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K+ VP L++V++++G AHF+NQE  +E + HI +F+ KF
Sbjct  276  GFKSQVPFLQEVIIVEGAAHFINQEKAEECSAHIYDFIKKF  316



>ref|XP_010544298.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Tarenaya hassleriana]
Length=326

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 163/225 (72%), Gaps = 8/225 (4%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPR----HPHLDLVEGHRAMYGNDHYICR  601
            VGHDWGA++AW+LC+FRPDKVKALVNLSV F  +     P +  VE  RA YG+D+YI R
Sbjct  103  VGHDWGAVMAWYLCLFRPDKVKALVNLSVPFTLKPTDPSPAVKPVEMLRAFYGDDYYISR  162

Query  600  FQEPGEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDL  430
            FQEPG IEAEFA +G +  L+   F F  P PL  P+DK F    D    LP+WL EED+
Sbjct  163  FQEPGAIEAEFAEVGTERVLKRF-FTFRTPGPLIIPEDKSFWGHPDTPIPLPSWLSEEDV  221

Query  429  DYYVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEY  250
             YYV+++EKTGF+G VN+YR L  ++EL  PW GSK+ VPTKFIVGDLDLVY  PG KEY
Sbjct  222  RYYVSKFEKTGFSGAVNFYRNLDRNYELLGPWIGSKITVPTKFIVGDLDLVYHRPGMKEY  281

Query  249  IHNGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            I+    K DVPLLE  V+++GVAH++NQE P E+ +HI +F+NKF
Sbjct  282  INGPQFKEDVPLLEPPVIMEGVAHWINQEKPDEILHHITDFINKF  326



>ref|XP_010039296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 159/226 (70%), Gaps = 10/226 (4%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LC+ RPD+VKALVN SV +FPR P    VE  RAM+G+D+Y+CRFQEP
Sbjct  99   VGHDWGAMIAWYLCLLRPDRVKALVNTSVAWFPRDPERKPVEKMRAMFGDDYYVCRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFT-------DGSTALPAWLPEED  433
            GE E +FA        +  +F  GR P P    KD GF+       D    LP+WL E+D
Sbjct  159  GEAEEDFAKADPAKLFK--LFLAGRDPSPPIVTKDVGFSGMTKLFEDHQVDLPSWLSEDD  216

Query  432  LDYYVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKE  253
            +++Y  ++ +TGFTGG+NYYR   L+WEL+A W+G  + VP KFIVGDLDL Y IPG KE
Sbjct  217  INFYAAQFSRTGFTGGLNYYRCWDLNWELSASWTGVPIEVPMKFIVGDLDLTYHIPGVKE  276

Query  252  YIHNGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            YIH GG K  VP LE+VVV++GVAHFL QE PQEV +HI NF+ KF
Sbjct  277  YIHGGGFKQAVPNLEEVVVMEGVAHFLMQEKPQEVTSHIHNFIKKF  322



>ref|NP_001042622.1| Os01g0255100 [Oryza sativa Japonica Group]
 dbj|BAD81074.1| putative epoxide hydrolase [Oryza sativa Japonica Group]
 dbj|BAE95793.1| putative epoxide hydrolase [Oryza sativa Japonica Group]
 dbj|BAF04536.1| Os01g0255100 [Oryza sativa Japonica Group]
 gb|EAZ11287.1| hypothetical protein OsJ_01143 [Oryza sativa Japonica Group]
 dbj|BAG86722.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 154/220 (70%), Gaps = 4/220 (2%)
 Frame = -2

Query  765  GHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEPG  586
            GHDWGA++AW LC+ R D V A V+LSV + PRHP + +++  R + G+DHY+CRFQ+PG
Sbjct  104  GHDWGAVVAWQLCLLRADLVTAHVSLSVEYQPRHPRMSVLQAVRVLCGDDHYVCRFQKPG  163

Query  585  EIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYVN  415
              EAEFA + +   L  ++F   +P  +  P+DK F    D     P WL EED+ YY +
Sbjct  164  VAEAEFARLDLNH-LFKMVFGMRKPATIILPQDKTFFDAIDSDGTCPPWLSEEDISYYAD  222

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ KTGFTGG NYYR + LDWELTAPW+G+ + VP KFIVGDLDL Y  PG K+YIH GG
Sbjct  223  KFGKTGFTGGFNYYRCIDLDWELTAPWTGALINVPIKFIVGDLDLTYNTPGVKDYIHKGG  282

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K +VP LEDVVVL+GV HF+NQE P EV+ HI  F +KF
Sbjct  283  FKANVPNLEDVVVLEGVGHFINQEKPDEVSEHICEFFSKF  322



>ref|XP_002523107.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39292.1| epoxide hydrolase, putative [Ricinus communis]
Length=315

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 159/220 (72%), Gaps = 4/220 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AWHLC+FRPD++KALVN SV F PR+PH   VE +R + G+D YICRFQE 
Sbjct  98   VGHDWGATVAWHLCLFRPDRIKALVNTSVAFSPRNPHKKPVERYRELLGDDFYICRFQEH  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTA--LPAWLPEEDLDYYVN  415
            GEIE +FA  G    ++  + +     P   PK  GF        LP+WL EED++YYV+
Sbjct  158  GEIEEDFAKAGAARIIRRFLASRSTAPPC-VPKATGFRSLPVPQNLPSWLSEEDINYYVS  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            +Y + GFTGG+NYYR L L+WELTAPW+GS++ VP KFIVGD+D+ Y  PG KEYIH+ G
Sbjct  217  KYGQKGFTGGLNYYRCLDLNWELTAPWTGSQIKVPVKFIVGDMDITYHFPGVKEYIHH-G  275

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            +K  VP L++VVVL+GVAHFL+QE P EV  HI +F+ KF
Sbjct  276  MKKHVPFLQEVVVLEGVAHFLSQEKPDEVTAHIHDFIKKF  315



>ref|XP_006644009.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Oryza brachyantha]
Length=321

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 151/221 (68%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
              HDWGA +AW LC+ RPD V ALV LSV + PR+P    V+  RA+ G++HYIC FQ+P
Sbjct  102  AAHDWGAAVAWQLCLLRPDLVTALVVLSVEYHPRNPSRSPVQTLRAICGDEHYICFFQKP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G  EAEF    +K  L+   +   +PEPL  P+ K      D     PAWL EED+ YY 
Sbjct  162  GVAEAEFGRCDIKCALKKF-YGMRKPEPLIIPQGKTLFDSIDSDGTCPAWLTEEDIAYYA  220

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++EKTGFT G+NYYR + L+WELTAPW+G  + VPTKFIVGD DL Y IPG K+YIH G
Sbjct  221  EKFEKTGFTAGLNYYRCIDLNWELTAPWTGVPIKVPTKFIVGDQDLTYNIPGVKDYIHKG  280

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK  VP LEDVVV++GVAHF+NQE P EV+NHI  F  KF
Sbjct  281  GLKASVPNLEDVVVMEGVAHFINQEKPNEVSNHICEFFGKF  321



>ref|XP_010429523.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 156/222 (70%), Gaps = 3/222 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LCM RPD+VKALVN SV F PR+P +  V+  R ++G+D+Y+CRFQE 
Sbjct  98   VGHDWGAIVAWWLCMIRPDRVKALVNTSVVFNPRNPSVKPVDKFRDLFGDDYYVCRFQET  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE +FA +  K  +    F    P P   PK  GF       +LPAWL E+D+ +Y +
Sbjct  158  GEIEEDFAQVDTKKLITRF-FVSRNPRPPCIPKSVGFRGLPDPPSLPAWLTEQDVSFYGD  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEYIH GG
Sbjct  217  KFSQKGFTGGLNYYRAMNLSWELTAPWAGLQIKVPVKFIVGDLDITYNIPGTKEYIHGGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF*T  109
            LK  VP L++VVV++GV HFL QE P EV +HI  F  KF T
Sbjct  277  LKKHVPFLQEVVVMEGVGHFLQQEKPDEVTDHIYGFFEKFRT  318



>ref|XP_004134492.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004162212.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN57130.1| hypothetical protein Csa_3G164490 [Cucumis sativus]
Length=324

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 163/223 (73%), Gaps = 6/223 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LCM+RPD+VKALVN SV F  R P    +E  +A+YG+D+YICRFQEP
Sbjct  103  VGHDWGAVIAWNLCMYRPDRVKALVNTSVTFNRRSPKRKPIESLKALYGDDYYICRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF-----TDGSTALPAWLPEEDLDY  424
            GEIEAEFA IG +  +  I+ ++  P+PL  PK +G       D   +LP WL ++D+DY
Sbjct  163  GEIEAEFAEIGTERIMTEIL-SYRTPKPLMMPKGRGKGKDHPLDTPISLPPWLAKQDMDY  221

Query  423  YVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH  244
            YV++++K GFTG +NYYR L  +WEL A ++G++V VPTKFIVGD DL Y   GAK+YI 
Sbjct  222  YVSKFDKNGFTGPINYYRNLDRNWELNASFTGAQVKVPTKFIVGDQDLTYHSFGAKQYIQ  281

Query  243  NGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            +G +K DVP LE+VVV++GV HFL +E P E++NHI  F+  +
Sbjct  282  SGEMKKDVPFLEEVVVMEGVGHFLQEEKPHEISNHIYEFIKNY  324



>gb|ACU19478.1| unknown [Glycine max]
 gb|KHN43316.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 158/219 (72%), Gaps = 1/219 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPDKVKA V LSV F+PR+P +  V+  RA+YG+D+YICRFQEP
Sbjct  98   VAHDWGAIIGWYLCMFRPDKVKAYVCLSVPFWPRNPKVKPVDAMRAIYGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT-DGSTALPAWLPEEDLDYYVNR  412
            G+ E E A    +  ++N+  +     P+   +  GF  + S  LP WL +EDL YY ++
Sbjct  158  GKAEGELAKNSTEQVIKNVFISRKPGPPILEKEGMGFNPNTSMPLPTWLSQEDLTYYASK  217

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EKTGFTGG+NYYR   L+WELTAPW+G++V VP KFI GDLDLVY   G K YI +G  
Sbjct  218  FEKTGFTGGLNYYRNFNLNWELTAPWTGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAF  277

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K DVP LE+VVV +GVAHF NQEA ++V+NHI +F+ KF
Sbjct  278  KKDVPNLEEVVVQEGVAHFNNQEAAEDVSNHIYDFIKKF  316



>ref|XP_002443185.1| hypothetical protein SORBIDRAFT_08g014640 [Sorghum bicolor]
 gb|EES17023.1| hypothetical protein SORBIDRAFT_08g014640 [Sorghum bicolor]
Length=374

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 160/220 (73%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
              HDWGA+ AW LC+FRPDKV+ LV LSV + PR      V+G RA++G+D+YICR QE 
Sbjct  155  AAHDWGALTAWSLCLFRPDKVRTLVALSVAYTPRSAARKPVDGLRALFGDDYYICRIQEA  214

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            GEIEAEFA +G +  L+   F++  P PL+FPK   G  D    LP+W+ EEDL YY N+
Sbjct  215  GEIEAEFARLGTELVLKKF-FSYRYPGPLFFPKSGWGSLDDEVPLPSWVTEEDLKYYTNK  273

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EKTGFTGG+NYYRAL   WELT+PW+ +K+ VP KFI+GDLDL Y  PG ++++H GG 
Sbjct  274  FEKTGFTGGLNYYRALNKTWELTSPWTLAKINVPVKFIIGDLDLTYHSPGIQDFLHKGGF  333

Query  231  KNDVPLL-EDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL +D+VV++ V HF+N+E P EV+ HIINF+ KF
Sbjct  334  KKFVPLLDDDIVVMKDVGHFINEEKPNEVSEHIINFIKKF  373



>ref|XP_010921625.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=211

 Score =   256 bits (655),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 155/212 (73%), Gaps = 2/212 (1%)
 Frame = -2

Query  747  IIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEPGEIEAEF  568
            ++ W LCMFRP+KV+A+VNLSV F PR+P    VE  R++YG D+Y+C FQEPG  EAEF
Sbjct  1    MVVWSLCMFRPEKVRAVVNLSVTFTPRNPARKSVEYLRSLYGEDYYVCGFQEPGAAEAEF  60

Query  567  APIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNRYEKTGFT  391
            A +G    L+   + +  P+PL+ PK+  G  D    LP+WL ++D+ YY +++EKTGFT
Sbjct  61   ARLGAVLVLKKF-YTYHSPDPLFIPKEGWGSPDSEIPLPSWLSKDDIKYYASKFEKTGFT  119

Query  390  GGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLKNDVPLL  211
            GG+NYYR L L+WELTAPW+G+ + VP KFIVGD+DL Y  PG ++YI  GG KNDVPLL
Sbjct  120  GGLNYYRCLDLNWELTAPWTGAHIKVPAKFIVGDVDLTYHAPGVQDYIQKGGFKNDVPLL  179

Query  210  EDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            E+VVV++GV HF+N+E P EV  HI  F+ KF
Sbjct  180  EEVVVMKGVGHFINEEKPHEVTEHICKFIKKF  211



>gb|KEH24395.1| epoxide hydrolase [Medicago truncatula]
Length=317

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW+ C+ +PD+VKALVN+SV F  R+P    V+  RA+ G+D+Y+CRFQ+P
Sbjct  98   VGHDWGAAMAWYFCLLKPDRVKALVNMSVVFRSRNPVRKPVQTMRALMGDDYYMCRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GE E EFA  G    +++ +     P  L  PK+ GF    +    LP WL EED++YY 
Sbjct  158  GEAEEEFARAGATRIIKSFL-TLRDPRALCVPKEIGFGGSPNTHITLPKWLSEEDVNYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++E+ GFTGG+NYYRAL L WEL APW+G ++ VP KFIVGDLDL Y  PG KEYIHNG
Sbjct  217  TKFEQKGFTGGLNYYRALDLTWELMAPWTGEQIKVPAKFIVGDLDLTYNTPGVKEYIHNG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K +VP L+++VV++GVAHF+NQE P+E++ HI +F+ KF
Sbjct  277  GFKREVPYLQEMVVMEGVAHFINQERPEEISAHIYDFIKKF  317



>ref|XP_007015353.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32972.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   260 bits (664),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW+LC+FRPDKVKAL+NLSV +      ++ ++G RA YGND+YICRFQEP
Sbjct  100  VGHDWGAFMAWYLCLFRPDKVKALLNLSVPYIQLGRQMNPIDGWRAFYGNDYYICRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIEAEFA IG +  ++  +  +  P P+  P+ K F    D    LP+WL +E+++YYV
Sbjct  160  GEIEAEFAEIGTERVVKEFL-TYRVPGPILLPEGKLFGHSADTPITLPSWLTQEEVNYYV  218

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +++K GFTGG+NYYR    +WEL APW G ++ VP KFIVGD DLVY +PG KEYIHNG
Sbjct  219  TQFDKKGFTGGINYYRNFNRNWELLAPWGGCEIKVPAKFIVGDQDLVYHMPGIKEYIHNG  278

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L+ VVV++GV HF+N E   ++N HI +F  +F
Sbjct  279  GFKKDVPHLQQVVVMEGVGHFINMEKADDINKHIYDFFRQF  319



>ref|XP_003554633.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=341

 Score =   261 bits (666),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 158/219 (72%), Gaps = 1/219 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPDKVKA V LSV F+PR+P +  V+  RA+YG+D+YICRFQEP
Sbjct  123  VAHDWGAIIGWYLCMFRPDKVKAYVCLSVPFWPRNPKVKPVDAMRAIYGDDYYICRFQEP  182

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT-DGSTALPAWLPEEDLDYYVNR  412
            G+ E E A    +  ++N+  +     P+   +  GF  + S  LP WL +EDL YY ++
Sbjct  183  GKAEGELAKNSTEQVIKNVFISRKPGPPILEKEGMGFNPNTSMPLPTWLSQEDLTYYASK  242

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EKTGFTGG+NYYR   L+WELTAPW+G++V VP KFI GDLDLVY   G K YI +G  
Sbjct  243  FEKTGFTGGLNYYRNFNLNWELTAPWTGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAF  302

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K DVP LE+VVV +GVAHF NQEA ++V+NHI +F+ KF
Sbjct  303  KKDVPNLEEVVVQEGVAHFNNQEAAEDVSNHIYDFIKKF  341



>ref|NP_001132040.1| uncharacterized protein LOC100193450 [Zea mays]
 gb|ACF80720.1| unknown [Zea mays]
Length=369

 Score =   261 bits (668),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 161/220 (73%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
              HDWGA++AW LC+FRPD+V+ALV LSV + PR      V+G RA++G+D+YICR QEP
Sbjct  150  AAHDWGALVAWSLCLFRPDRVRALVALSVAYTPRSAARKPVDGLRALFGDDYYICRIQEP  209

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            GEIEAEFA +G +  L+   F++  P  L+FPK   G  D    LP+W+ EEDL YY + 
Sbjct  210  GEIEAEFARLGTELVLKKF-FSYRSPGALFFPKSGWGSPDDEVPLPSWVTEEDLKYYTSM  268

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EKTGFTGG+NYYRAL   WELT+PW+ +K+ VP KFI+GDLDL Y  PG +++IH GG 
Sbjct  269  FEKTGFTGGLNYYRALNKTWELTSPWTLAKINVPVKFIIGDLDLTYHNPGIQDFIHKGGF  328

Query  231  KNDVPLL-EDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL +D++V++ V HF+N+E P EV+ HIINF+ KF
Sbjct  329  KKFVPLLDDDIIVMKDVGHFINEEKPNEVSEHIINFIKKF  368



>ref|XP_010039280.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50058.1| hypothetical protein EUGRSUZ_K03499 [Eucalyptus grandis]
Length=331

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 162/231 (70%), Gaps = 14/231 (6%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHF------FPRHPHLDLVEGHRAMYGNDHYI  607
            VGHDWGAI+AW+LC+ RPD+V+ALVN SV +      FP  P    VE  RAMYG+D+Y+
Sbjct  99   VGHDWGAIMAWYLCLLRPDRVRALVNTSVPWCPGGTCFPSDPEKKPVESLRAMYGDDYYV  158

Query  606  CRFQEPGEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT-------DGSTALPAW  448
            CRFQEPGEIE +FA       +Q +      P P   PKD G++       D    LP+W
Sbjct  159  CRFQEPGEIEEDFAKADPAKLIQ-LFLTTRNPGPPRVPKDLGYSGRTKLLEDSQVDLPSW  217

Query  447  LPEEDLDYYVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQI  268
            L EED++YY  ++ +TGFTGG+NYYR L L+WEL+APW+G+++ VP KFIVGDLDL+Y I
Sbjct  218  LTEEDINYYATQFSRTGFTGGLNYYRCLDLNWELSAPWAGARIEVPVKFIVGDLDLIYHI  277

Query  267  PGAKEYIHNGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            PG KEYIH+GG K  VP L++VVV++GVAH+L  E P EV +HI +F+ KF
Sbjct  278  PGVKEYIHDGGFKQTVPNLKEVVVMEGVAHYLLLEKPHEVTSHICDFIKKF  328



>gb|KDP23458.1| hypothetical protein JCGZ_23291 [Jatropha curcas]
Length=317

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAII W+LC+FRPDKVKA V LSV F PRHP++  VE  R ++G+++YICRFQ+P
Sbjct  98   VGHDWGAIIGWYLCLFRPDKVKAFVCLSVPFKPRHPNIKTVESMRLLFGDEYYICRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            GEIE E A +G +  L+ I F   +P P   PK+  F    +    LP+WL EEDL YYV
Sbjct  158  GEIEEEIARVGTEEVLKKI-FTDRKPGPPCLPKENAFGSCKENPVTLPSWLTEEDLAYYV  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ + GFTGG+NYYRAL L+WELTA W+G  + VP KF+VGD D+VY  PG KEY+   
Sbjct  217  TKFNQKGFTGGLNYYRALDLNWELTAQWTGVAIKVPVKFVVGDADMVYTTPGMKEYVQGS  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G  + VP LEDVVV++GV HF++QE P+E++N I +F+ ++
Sbjct  277  GFSHYVPFLEDVVVMEGVGHFISQERPKEISNLIYDFITQY  317



>gb|ACN28644.1| unknown [Zea mays]
 gb|ACN35781.1| unknown [Zea mays]
Length=274

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 150/221 (68%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW LC+ RPD V+ALVNLSV + PR P +  ++  RA  G DHY+CRFQE 
Sbjct  55   VGHDWGATVAWQLCLLRPDLVRALVNLSVVYHPRRPEMSPLQAIRAACGEDHYMCRFQEF  114

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G  EAEFA   +K   +   F   +P PL  PKDK F    D     P WL EED+ YY 
Sbjct  115  GVAEAEFALYDIKWVFKKT-FGMRKPAPLILPKDKSFFDSLDSDGTCPPWLSEEDISYYA  173

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ KTGFTGG+NYYR +   WEL+A W+G+ + VP+KFIVGDLD+ Y  PG  +YIH G
Sbjct  174  EKFAKTGFTGGLNYYRCIDRSWELSAAWTGAPIKVPSKFIVGDLDITYNAPGVPDYIHKG  233

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VP LEDVVV++GV+HF+NQE P EV++HI  F +KF
Sbjct  234  GFKASVPNLEDVVVMEGVSHFINQEKPNEVSDHICEFFSKF  274



>gb|KFK30821.1| hypothetical protein AALP_AA6G030400 [Arabis alpina]
Length=316

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LCM RPD+VKALVN SV F PR+P++  ++  R+++G+D+YICRFQEP
Sbjct  98   VGHDWGAIVAWWLCMIRPDRVKALVNTSVVFNPRNPNVKPLDTFRSLFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF--TDGSTALPAWLPEEDLDYYVN  415
            GEIE +FA    K  +    F    P P   PK  GF        LPAW  EED+ +YV+
Sbjct  158  GEIEEDFAQTDTKKLITRF-FTSRNPRPPCIPKTVGFRGLPAPPPLPAWFTEEDVSFYVD  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTGG+NYYRA+ L WELTAPW+G ++ VP KFIVGDLD+ Y IPG KEYIH+GG
Sbjct  217  KFNQKGFTGGLNYYRAMNLSWELTAPWAGLQIKVPVKFIVGDLDITYHIPGTKEYIHDGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK  VP L++VV+++GV HFL QE P+EV +HI +F  KF
Sbjct  277  LKKHVPFLQEVVIMEGVGHFLQQEKPEEVTDHIYSFFKKF  316



>ref|XP_010038231.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50055.1| hypothetical protein EUGRSUZ_K03496 [Eucalyptus grandis]
Length=322

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 157/221 (71%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+ C+ RPD+VKALVN SV F P       V+  RA++G+D+YICRFQEP
Sbjct  103  VGHDWGAVMAWYFCLLRPDRVKALVNTSVAFLPGSRKRKPVDSLRALFGDDYYICRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKD---KGFTDGSTALPAWLPEEDLDYYV  418
            GE E +FA   + T L  +      P+P   PK+    G       LP WL EED+++Y 
Sbjct  163  GEAEEDFARADI-TKLMKLFLTCRSPKPPCIPKEIGCSGLASSRDKLPPWLSEEDINFYA  221

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++ + GFTGG+NYYRA+ L W+L APW+G ++ VP KFIVGDLD+ Y +PGAK++IHNG
Sbjct  222  SKFSQKGFTGGLNYYRAMNLTWKLAAPWTGVQIKVPVKFIVGDLDITYHVPGAKQHIHNG  281

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK  VP L++VVV++GVAHFL QE P+EV NHI +F+ KF
Sbjct  282  GLKKLVPFLQEVVVMEGVAHFLQQEKPEEVTNHIYDFIKKF  322



>ref|NP_001240943.1| uncharacterized protein LOC100803974 [Glycine max]
 gb|ACU18288.1| unknown [Glycine max]
 gb|KHN03960.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+I W+LC+FRPD++KA V LSV F PR+P +  V+  RA+YG+D+YICRFQEP
Sbjct  98   VAHDWGAVIGWYLCLFRPDRIKAYVCLSVPFMPRNPKVKPVDAMRALYGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKG--FTDGSTALPAWLPEEDLDYYVN  415
            G+ EAEFA   ++  ++NI+ +  RP P    K+     +D S  LP WL +ED+ YY +
Sbjct  158  GKAEAEFANNSIEQVIKNILTS-RRPGPPILRKEGAGSNSDPSRPLPTWLSQEDVTYYAS  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ KTG TGG+NYYR L L+WELTAPW+G +V VP KFI GDLD VY   G K YI +G 
Sbjct  217  KFTKTGLTGGLNYYRNLNLNWELTAPWTGVQVKVPVKFITGDLDAVYTSLGMKNYIESGA  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVP LE+VVV +GVAHF NQEA ++V NHI +F+NKF
Sbjct  277  FKKDVPCLEEVVVQEGVAHFNNQEAAEDVTNHIYDFINKF  316



>ref|XP_009757465.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=331

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 159/218 (73%), Gaps = 2/218 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            +GHDWGA+++W LC++RPDKVK    LSV F PR+P    ++  RA+YG+D+Y+ RFQE 
Sbjct  102  IGHDWGAVVSWALCLYRPDKVKGFFCLSVAFNPRNPIKKPLDTLRAVYGDDYYVVRFQEA  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDG-STALPAWLPEEDLDYYVNR  412
            G IEAEF  +GVK  L+   F +  P PLY  K K F D     LP WL EE+LD+Y  +
Sbjct  162  GVIEAEFEEMGVKNVLKKF-FTYREPAPLYLKKGKPFGDNPQVELPCWLSEEELDFYAIK  220

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +E+TGFTG +N+YRA+  +WELTA W+G+K+ VP KFIVGDLDL Y  PG K+Y+H GG 
Sbjct  221  FEQTGFTGPLNFYRAIHRNWELTAAWTGAKIQVPVKFIVGDLDLTYNAPGTKDYLHKGGF  280

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNK  118
            K  VPLLE+VVVL+GV HF+++E P+E+N+HI NF+ K
Sbjct  281  KKQVPLLEEVVVLEGVGHFIHEEKPKEINDHIYNFIRK  318



>ref|XP_008454322.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Cucumis 
melo]
Length=316

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 155/220 (70%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW+ C+FRP+++KALVNLSV FFPR+P +  ++  RA YG+D Y+CRFQ P
Sbjct  98   VGHDWGAIIAWYFCLFRPERIKALVNLSVQFFPRNPAISFIQRFRAAYGDDFYMCRFQVP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GE EA+FA I      +  +       P   PK+ GF        LP+WL EED++YY  
Sbjct  158  GEAEADFACIDTAQLFKTTLSNRSTKAPC-LPKEYGFRAIPPPENLPSWLTEEDINYYAA  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++++TGFTG +NYYRA  L WELTAPW+G ++ VP KFIVGD DL Y   GAKEYIH GG
Sbjct  217  KFKETGFTGALNYYRAFDLTWELTAPWTGVQIQVPVKFIVGDSDLTYHFKGAKEYIHEGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVPLLE+VV+++   HF+++E P E+N HI +F+ KF
Sbjct  277  FKRDVPLLEEVVIVENAGHFVHEEKPHEINTHIHDFIKKF  316



>gb|KJB45332.1| hypothetical protein B456_007G301800 [Gossypium raimondii]
 gb|KJB45333.1| hypothetical protein B456_007G301800 [Gossypium raimondii]
Length=317

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 153/221 (69%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LC+FRPD+VKA V LSV F PR P +  VE  R  +G+D+YICRFQEP
Sbjct  98   VAHDWGAIIGWYLCLFRPDRVKAFVCLSVPFMPRKPQMKPVESMRLFFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G+IEAE A  G    L+ II +  +P P   PKD  F    D    LP+W  EEDL YY 
Sbjct  158  GKIEAEIARYGASNVLKKIISS-RKPGPPCMPKDNAFGIKPDTPITLPSWFSEEDLSYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            N++ K GFTG +NYYRA  L+WE TAPW+ ++V VP KFIVGDLD VY  PG KEY++  
Sbjct  217  NKFNKKGFTGALNYYRAFDLNWEQTAPWTNTQVKVPVKFIVGDLDSVYTTPGMKEYVNGE  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              K D P+L++VV+++GV HF+NQE   E+N+HI++F+  F
Sbjct  277  DFKRDAPMLDEVVIMEGVGHFINQERADEINSHILDFIISF  317



>ref|NP_001148885.1| epoxide hydrolase 2 [Zea mays]
 gb|ACG33290.1| epoxide hydrolase 2 [Zea mays]
 gb|ACG37254.1| epoxide hydrolase 2 [Zea mays]
Length=325

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 151/221 (68%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AW LC+ RPD V+ALVNLSV + PR P +  ++  RA  G DHY+CRFQE 
Sbjct  106  VGHDWGAIVAWQLCLLRPDLVRALVNLSVVYHPRRPEMSPLQAIRAACGEDHYMCRFQEF  165

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G  EAEFA   +K   +   F   +P PL  PKDK F    D     P WL EED+ YY 
Sbjct  166  GVAEAEFALYDIKWVFKKT-FGMRKPAPLILPKDKSFFDSLDSDGTCPPWLSEEDISYYA  224

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ KTGFTGG+NYYR +   WEL+A W+G+ + VP+KFIVGDLD+ Y  PG  +YIH G
Sbjct  225  EKFAKTGFTGGLNYYRCIDRSWELSAAWTGAPIKVPSKFIVGDLDITYNAPGVPDYIHKG  284

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VP LEDVVV++GV+HF+NQE P EV++HI  F +KF
Sbjct  285  GFKASVPNLEDVVVMEGVSHFINQEKPNEVSDHICEFFSKF  325



>emb|CDM82646.1| unnamed protein product [Triticum aestivum]
Length=322

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 155/221 (70%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LC+ RPD V+ALVNLSV + PR      ++  RA+ G DHY+CRFQEP
Sbjct  103  VGHDWGALVAWQLCLLRPDLVRALVNLSVAYHPRSSEGSPLQVIRALCGEDHYMCRFQEP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G  EAEFA        + + F   +P P   PKDK F    D     P WL EED+ YY 
Sbjct  163  GVAEAEFALYDNSHKFKTV-FGMRKPAPPILPKDKTFFDSLDSDGTCPPWLSEEDISYYA  221

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG+NYYR + L+WEL+APW+G+ + V TKFIVGDLD+ Y +PG K+YIH G
Sbjct  222  DKFEKTGFTGGLNYYRCMDLNWELSAPWTGAPIKVATKFIVGDLDVTYNVPGVKDYIHKG  281

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK  VP LEDVVV++GV+HF NQE P EV+++I  F +KF
Sbjct  282  GLKASVPNLEDVVVMEGVSHFCNQEKPNEVSDYICEFFSKF  322



>gb|AFW56302.1| hypothetical protein ZEAMMB73_530848 [Zea mays]
Length=397

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 161/220 (73%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
              HDWGA++AW LC+FRPD+V+ALV LSV + PR      V+G RA++G+D+YICR QEP
Sbjct  178  AAHDWGALVAWSLCLFRPDRVRALVALSVAYTPRSAARKPVDGLRALFGDDYYICRIQEP  237

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            GEIEAEFA +G +  L+   F++  P  L+FPK   G  D    LP+W+ EEDL YY + 
Sbjct  238  GEIEAEFARLGTELVLKKF-FSYRSPGALFFPKSGWGSPDDEVPLPSWVTEEDLKYYTSM  296

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +EKTGFTGG+NYYRAL   WELT+PW+ +K+ VP KFI+GDLDL Y  PG +++IH GG 
Sbjct  297  FEKTGFTGGLNYYRALNKTWELTSPWTLAKINVPVKFIIGDLDLTYHNPGIQDFIHKGGF  356

Query  231  KNDVPLL-EDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL +D++V++ V HF+N+E P EV+ HIINF+ KF
Sbjct  357  KKFVPLLDDDIIVMKDVGHFINEEKPNEVSEHIINFIKKF  396



>ref|XP_008438903.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=369

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 163/223 (73%), Gaps = 6/223 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+LCM+RPD+VKALVN SV F  R P    +   +A+YG+D+YICRFQEP
Sbjct  148  VGHDWGAMIAWNLCMYRPDRVKALVNTSVTFNRRSPKRKPIPALKALYGDDYYICRFQEP  207

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF-----TDGSTALPAWLPEEDLDY  424
            GEIEAEFA IG +  +  I+ ++  P+PL  PK +G       D   +LP WL ++D+DY
Sbjct  208  GEIEAEFAEIGTERIMTEIL-SYRIPKPLMMPKGRGKGKDHPLDTPISLPPWLTKQDMDY  266

Query  423  YVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH  244
            YV++++K GFTG +NYYR L  +WEL AP++G++V VPTKFIVGD DL Y   GAK+YI 
Sbjct  267  YVSKFDKNGFTGPINYYRNLDRNWELNAPFTGAQVKVPTKFIVGDQDLTYNSFGAKQYIE  326

Query  243  NGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            +G +K DVP LE+VVV++GV HFL +E P E++NHI  F+  +
Sbjct  327  SGEMKKDVPFLEEVVVMEGVGHFLQEEKPHEISNHIYEFIKNY  369



>ref|XP_004965308.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=361

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 158/219 (72%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
              HDWGA+ AW LC+FRPD+V+ALV LSV + PR      V+G RA+YG+++YICR QEP
Sbjct  143  AAHDWGAVTAWSLCLFRPDRVRALVALSVAYTPRSAARRPVDGLRAIYGDEYYICRIQEP  202

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G IEAEF  +G +  L+   F++  P PL  PK   G  D    LP+W+ EEDL+YY + 
Sbjct  203  GAIEAEFKRLGTELVLRKF-FSYRTPGPLIIPKTGWGSPDDQVLLPSWVTEEDLNYYTSE  261

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +E+TGFTGG+NYYRAL   WELT+ W+ S++ VP KFI+GDLDL Y  PG +++IH GG 
Sbjct  262  FERTGFTGGLNYYRALNRTWELTSSWTASEINVPVKFIIGDLDLTYHTPGIQDFIHKGGF  321

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VPLL+DVVV++ V HF+N+E P+EV+ HII+F+ KF
Sbjct  322  KKFVPLLDDVVVMKDVGHFINEEKPKEVSEHIISFIKKF  360



>ref|XP_003566463.1| PREDICTED: bifunctional epoxide hydrolase 2 [Brachypodium distachyon]
Length=322

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 154/221 (70%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
             GHDWGAI+AW LC+ RPD V+ALVNLSV + PR      +E  RA+ G DHY+C FQ+P
Sbjct  103  AGHDWGAIVAWQLCLLRPDLVRALVNLSVVYHPRRSEGSPLEAVRALCGEDHYMCHFQKP  162

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G  EAEFA   ++   + ++    +  PL  PKDK F    D     PAWL EED+ YY 
Sbjct  163  GVAEAEFALPDMRHLFKKVL-GMRKAAPLILPKDKTFFDSLDSDGTCPAWLSEEDISYYA  221

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EKTGFTGG NYYR +  +WEL+APW+G+ + VPTKFIVGDLDL Y  PG K+YIH G
Sbjct  222  DKFEKTGFTGGFNYYRCMDKNWELSAPWTGAPIKVPTKFIVGDLDLTYNTPGVKDYIHKG  281

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GLK  VP LED+V+++GV HF+NQE P EV++HI  F +KF
Sbjct  282  GLKAMVPNLEDLVIMEGVGHFINQEKPNEVSDHICEFFSKF  322



>gb|EPS69728.1| epoxide hydrolase [Genlisea aurea]
Length=318

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 158/219 (72%), Gaps = 3/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++ W LC++RPD+VKALVNLSV    R+P   +V+  R  YG+D+Y+ RFQEP
Sbjct  102  VGHDWGAVVTWQLCLYRPDRVKALVNLSVPLSRRNPDRSIVDALRKAYGDDYYVIRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            GEIEAEFA IG K   +NI FA+  P PLY PK KGF   S   P+WL EEDLDY+V ++
Sbjct  162  GEIEAEFAEIGFKQVFKNI-FAYRTPGPLYLPKGKGFG-YSADRPSWLTEEDLDYFVTKF  219

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH-NGGL  232
            +++GFTGGVNYYRA  L WEL A W+ +KV VPTKFIVGDLDL Y  PG KE IH + G 
Sbjct  220  QQSGFTGGVNYYRAWPLSWELDAAWADAKVNVPTKFIVGDLDLTYHNPGVKELIHGDDGF  279

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VP L++VVV++   HF+NQE P  ++ HI  FL ++
Sbjct  280  KGRVPSLKEVVVVEDAGHFINQEKPDLISQHIYAFLEQY  318



>ref|XP_006480000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=316

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C+FRPD+VKALVN+SV F PR+P +  +   RA+YG+D+YICRFQEP
Sbjct  98   VGHDWGALIAWYFCLFRPDRVKALVNMSVPFPPRNPAVRPLNNFRAVYGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GEIE EFA I     ++  +      +PL  PKD G +     +ALP+WL EED++YY +
Sbjct  158  GEIEEEFAQIDTARLMKKFL-CLRIAKPLCIPKDTGLSTVPDPSALPSWLSEEDVNYYAS  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ + GFTG VNYYR   L+WEL APW+G ++ VP KFIVGD DLVY   G KEYIH+GG
Sbjct  217  KFNQKGFTGPVNYYRCSDLNWELMAPWTGVQIEVPVKFIVGDQDLVYNNKGMKEYIHDGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K  VP L++VVV++GVAHF+NQE  +EV  HI  F+ KF
Sbjct  277  FKKYVPYLQEVVVMEGVAHFINQEKAEEVGAHIYEFIKKF  316



>gb|KHN03961.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 164/223 (74%), Gaps = 7/223 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPDKVKA V LSV F  R+P++  V+G RAMYG D+YICRFQ+P
Sbjct  98   VAHDWGAIIGWYLCMFRPDKVKAYVCLSVPFIRRNPNVRTVDGMRAMYGEDYYICRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD-----GSTALPAWLPEEDLDY  424
            GE+EA+ A +G +  L+NI+    +P P  FPK +  T          LP+WL ++DL Y
Sbjct  158  GEMEAQMAQVGTEYVLKNIL-TIRKPGPPIFPKGEFGTGLNPNMSDDTLPSWLTDDDLAY  216

Query  423  YVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH  244
            YV++YEK+GFTG +NYYR + L+WELTAPW+G ++ V  K+I G+LD+VY   G KEY+H
Sbjct  217  YVSKYEKSGFTGPLNYYRNMNLNWELTAPWTGVQIQVAVKYITGELDMVYTSLGMKEYVH  276

Query  243  NGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            +GG K DVP L+ VVV +GVAHF N EA +E+NNHI +F+NKF
Sbjct  277  SGGFKQDVPNLQ-VVVQKGVAHFNNLEAAEEINNHIYDFINKF  318



>ref|XP_009386486.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW LC+ RPD VKALVNLSV + PR+P    V+  R ++G+DHYICRFQE 
Sbjct  98   VGHDWGAYMAWWLCILRPDMVKALVNLSVAYAPRNPGRRPVDACRTIFGDDHYICRFQEH  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G +EAE A IG  T        + +P  +  PKDKG     +    LP+WL EED++Y+ 
Sbjct  158  GAMEAEIAQIGT-TLFMKKFLTYRKPAAINIPKDKGLEVSLETPVTLPSWLSEEDINYFA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++EK+GFTGG+NYYR L L+WEL+APW+  +V VP KFI+GDLDL Y  PG ++YIH G
Sbjct  217  SKFEKSGFTGGLNYYRCLNLNWELSAPWTEVQVDVPVKFIIGDLDLTYHTPGIQDYIHKG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K+ VP LEDVVV++GV HF+NQE P EV++ I +F++KF
Sbjct  277  GFKSAVPFLEDVVVMEGVGHFINQERPHEVSDLIYHFIHKF  317



>ref|XP_009393199.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 164/222 (74%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVH---FFPRHPHLDLVEGHRAMYGNDHYICRF  598
            VGHDWGA++AW++C+FRPD+VKALVNLSV    F PR+P   LVE  R++YG+D+Y+CRF
Sbjct  100  VGHDWGALVAWYMCLFRPDRVKALVNLSVALVPFIPRNPAGKLVEYFRSLYGDDYYVCRF  159

Query  597  QEPGEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF-TDGSTALPAWLPEEDLDYY  421
            QEPG +EA+F  +G ++ L+ ++FA   P PL  PK+     D    LP WL EED+ Y+
Sbjct  160  QEPGAVEADFDRLGTESLLR-MVFASRNPGPLLLPKEAFVPLDRQIPLPDWLSEEDISYF  218

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
             ++++++GFTG VNYYR L L+ EL APW G K+ VP KFIVGD DL Y  PG ++Y+H 
Sbjct  219  TSKFDESGFTGPVNYYRCLDLNRELGAPWCGVKIQVPVKFIVGDQDLTYHYPGIQDYLHG  278

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP+LE+VVV++GVAHF+NQE   E+ +HI +F+ KF
Sbjct  279  GGFKEDVPMLEEVVVMEGVAHFINQEKAHEITDHIYHFIRKF  320



>gb|KHN43314.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 161/220 (73%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPDKVKA V LSV    R P++  V+G RA+YG+D+Y+CRFQ+P
Sbjct  98   VAHDWGAIIGWYLCMFRPDKVKAYVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFT-DGSTALPAWLPEEDLDYYVN  415
            GE+EA+ A +G +  L+NI+     P P   PK +  F  +    LP+WL EEDL YYV+
Sbjct  158  GEMEAQMAEVGTEYVLENILTT-RNPGPPILPKGRFQFNPEMPNTLPSWLTEEDLAYYVS  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++EKTGFTG +NYYR   L+WELTAPW+G ++ VP K+I G+LD+VY     KEYIH GG
Sbjct  217  KFEKTGFTGPLNYYRNFNLNWELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVP LE V+V +GVAHF NQEA +E++N+I +F+NKF
Sbjct  277  FKQDVPNLEQVIVQKGVAHFNNQEAAEEIDNYIYDFINKF  316



>ref|XP_002318980.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|EEE94903.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 164/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+I W+LC+FRPD+VKA V LSV + PR+P +  VE  + ++G D+Y+CRFQEP
Sbjct  98   VAHDWGALIGWYLCLFRPDRVKAYVCLSVPYRPRNPKMKPVESMKLVFGEDYYMCRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G IEAE A  G +  L+ I+    +P P   PK+  F    + S  +P+WLPE DL +Y 
Sbjct  158  GVIEAEIACAGTEEVLKKILTG-RKPGPPCLPKENPFGIYPEESVTMPSWLPEADLSFYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +Y + GFTGG+NYYRAL L+WELTA W+G+ V+VP KF+VGDLD+VY  PG KE++++G
Sbjct  217  TKYSQKGFTGGLNYYRALDLNWELTASWTGAPVIVPVKFVVGDLDMVYTTPGMKEFVNSG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K+ VPLLE+VVV++GV HF+NQE  +E++NHI ++++K+
Sbjct  277  GFKHYVPLLEEVVVMEGVGHFINQEKAEEISNHIYDYISKY  317



>ref|XP_011041992.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 164/220 (75%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+ C+ RPD++KALVN+SV F PR+P    V+  R ++G+D+YICRFQEP
Sbjct  98   VGHDWGAVVAWYFCLLRPDRIKALVNMSVVFQPRNPDKSFVQISRDLFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GE+E +FA +     ++  + +   P+P   PK+ GF     +  LP+WL E+D+++Y  
Sbjct  158  GEVEEDFAQMDTARIIRKFLTS-RNPKPPRIPKEVGFRGLPDNPNLPSWLSEKDINHYAG  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ KTGFTGG+NYYR L L+WELTA W+G ++ VP KFIVGDLD+ Y +PGA++YI  GG
Sbjct  217  KFNKTGFTGGLNYYRCLDLNWELTAAWTGLQIKVPVKFIVGDLDITYNMPGAQDYISEGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK  VP L++V +++GVAHFLNQE P+EV++HI +F+ KF
Sbjct  277  LKKYVPFLQEVAIMEGVAHFLNQEKPEEVSSHIYDFIKKF  316



>ref|XP_006344695.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=314

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 157/219 (72%), Gaps = 3/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+I W+LC+FRPD VKA V LSV   PRHP +  +   RA  G+D+Y+CRFQ+P
Sbjct  98   VAHDWGAMIGWYLCLFRPDLVKAYVCLSVPLRPRHPKMKPIPTMRAFLGDDYYMCRFQDP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF-TDGSTALPAWLPEEDLDYYVNR  412
            G +E E A  G +  L+ I+    +P P   PKD  F       LP WL ++DL+YY  +
Sbjct  158  G-MEDEMAKYGSEAVLKKILID-RKPGPPCLPKDNPFGISTDDKLPLWLSQDDLNYYSTK  215

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +++ GFTGG+NYYRAL L+WELTAPW+G KV VP KF+VGDLD+VY  PG KEY+H GG 
Sbjct  216  FDQKGFTGGLNYYRALDLNWELTAPWTGVKVNVPVKFVVGDLDVVYTTPGMKEYVHGGGF  275

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K DVP+L+DVVVL+G AHF+NQE  QE N+HI +F+NKF
Sbjct  276  KKDVPMLDDVVVLEGAAHFINQERAQETNSHIYDFINKF  314



>ref|XP_010038234.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50059.1| hypothetical protein EUGRSUZ_K03500 [Eucalyptus grandis]
Length=325

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 160/226 (71%), Gaps = 10/226 (4%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW+LC+ RPD+VKALVN SV +FPR+P    VE  RA +G+D+Y+CRFQEP
Sbjct  99   VGHDWGAIIAWYLCLLRPDRVKALVNTSVAWFPRNPERKPVEKLRATFGDDYYVCRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFT-------DGSTALPAWLPEED  433
            GE EA+FA        +  +F   R P P   PKD GF+       D    LP+WL E+D
Sbjct  159  GEAEADFAKADPAKLFK--LFLVSRDPSPPILPKDVGFSGMTKIFEDHQVDLPSWLSEDD  216

Query  432  LDYYVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKE  253
            +++Y  ++ +TGFTGG+NYYR   L+WEL+A W+G  + VP KFIVGDLDL Y IPG KE
Sbjct  217  INFYAAQFSRTGFTGGLNYYRCSDLNWELSASWTGVPIEVPVKFIVGDLDLTYHIPGVKE  276

Query  252  YIHNGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            YI+ GG K  VP LE+VVV++GVAHFL QE P++V +HI +F+ KF
Sbjct  277  YINGGGFKRAVPNLEEVVVMEGVAHFLQQEKPRDVTSHIHDFIKKF  322



>ref|XP_002270853.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   257 bits (657),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 154/221 (70%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA I W+LC+FRPD+VKALVNLSV F PR+     ++  RA+YG+D+YICRFQEP
Sbjct  98   VGHDWGAFIGWNLCLFRPDRVKALVNLSVSFSPRNAMNKPLQTFRALYGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDG---STALPAWLPEEDLDYYV  418
            G IE EFA IG+   L+  + +     PL+ PK K   D       LP+WL EE+L+YYV
Sbjct  158  GAIETEFAEIGIDKVLKYFLTSL-PAGPLFLPKGKALRDQLGIPITLPSWLSEEELNYYV  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +YE TGFTGG+NYYR L L WELTAPW+GS+V VP KFIVGDLDL Y  PG  E +   
Sbjct  217  TKYENTGFTGGLNYYRNLDLSWELTAPWTGSQVEVPAKFIVGDLDLTYNTPGFNESMTFD  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             LK  VPLLE+VVV++GV HFL +E   E+N HI  F  +F
Sbjct  277  ELKKHVPLLEEVVVMKGVGHFLQEEKADEINQHIHAFFQRF  317



>ref|XP_006359858.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   257 bits (657),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 158/223 (71%), Gaps = 7/223 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW  C+FRPD++KALVNLS    PR+P    ++  R + G+D+Y+CRFQ+P
Sbjct  98   VGHDWGALIAWFFCLFRPDRIKALVNLSCELRPRNPLRKPIDCLRELLGDDYYMCRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTDGSTALPA----WLPEEDLDY  424
            GE+E EFA I     +  I F   R   P   PK+ GF      LPA    WL +ED++Y
Sbjct  158  GEVEEEFASIDTAKLM--IGFLTSRDTRPPCIPKEIGFHQAFAQLPATLPSWLTQEDVNY  215

Query  423  YVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH  244
            YV +  KTGFTGG+NYYR +  +WELTAP+SG K+ VPTKF+VG+LDL Y IPG KEYIH
Sbjct  216  YVEKLNKTGFTGGLNYYRNMDKNWELTAPFSGCKIQVPTKFVVGELDLTYHIPGIKEYIH  275

Query  243  NGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            NGG K +VP LE+VVV++G AHF+NQE P E+N HI +F+ KF
Sbjct  276  NGGFKKEVPSLEEVVVMEGAAHFINQEKPDEINAHIYDFIQKF  318



>tpg|DAA53983.1| TPA: epoxide hydrolase 2 [Zea mays]
Length=325

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 150/221 (68%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AW LC+ RPD V+ALVNLSV + PR P +  ++  RA  G DHY+CRFQE 
Sbjct  106  VGHDWGATVAWQLCLLRPDLVRALVNLSVVYHPRRPEMSPLQAIRAACGEDHYMCRFQEF  165

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDYYV  418
            G  EAEFA   +K   +   F   +P PL  PKDK F    D     P WL EED+ YY 
Sbjct  166  GVAEAEFALYDIKWVFKKT-FGMRKPAPLILPKDKSFFDSLDSDGTCPPWLSEEDISYYA  224

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ KTGFTGG+NYYR +   WEL+A W+G+ + VP+KFIVGDLD+ Y  PG  +YIH G
Sbjct  225  EKFAKTGFTGGLNYYRCIDRSWELSAAWTGAPIKVPSKFIVGDLDITYNAPGVPDYIHKG  284

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K  VP LEDVVV++GV+HF+NQE P EV++HI  F +KF
Sbjct  285  GFKASVPNLEDVVVMEGVSHFINQEKPNEVSDHICEFFSKF  325



>emb|CAA55294.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 161/220 (73%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPDKVKA V LSV    R P++  V+G RA+YG+D+Y+CRFQ+P
Sbjct  123  VAHDWGAIIGWYLCMFRPDKVKAYVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKP  182

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFT-DGSTALPAWLPEEDLDYYVN  415
            GE+EA+ A +G +  L+NI+     P P   PK +  F  +    LP+WL EEDL YYV+
Sbjct  183  GEMEAQMAEVGTEYVLENILTT-RNPGPPILPKGRFQFNPEMPNTLPSWLTEEDLAYYVS  241

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++EKTGFTG +NYYR   L+WELTAPW+G ++ VP K+I G+LD+VY     KEYIH GG
Sbjct  242  KFEKTGFTGPLNYYRNFNLNWELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGG  301

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVP LE V+V +GVAHF NQEA +E++N+I +F+NKF
Sbjct  302  FKQDVPNLEQVIVQKGVAHFNNQEAAEEIDNYIYDFINKF  341



>ref|NP_001238563.1| epoxide hydrolase [Glycine max]
 dbj|BAA09852.1| Epoxide hydrolase [Glycine max]
 emb|CAA55293.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 161/220 (73%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPDKVKA V LSV    R P++  V+G RA+YG+D+Y+CRFQ+P
Sbjct  123  VAHDWGAIIGWYLCMFRPDKVKAYVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKP  182

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFT-DGSTALPAWLPEEDLDYYVN  415
            GE+EA+ A +G +  L+NI+     P P   PK +  F  +    LP+WL EEDL YYV+
Sbjct  183  GEMEAQMAEVGTEYVLKNILTT-RNPGPPILPKGRFQFNPEMPNTLPSWLTEEDLAYYVS  241

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++EKTGFTG +NYYR   L+WELTAPW+G ++ VP K+I G+LD+VY     KEYIH GG
Sbjct  242  KFEKTGFTGPLNYYRNFNLNWELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGG  301

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVP LE V+V +GVAHF NQEA +E++N+I +F+NKF
Sbjct  302  FKQDVPNLEQVIVQKGVAHFNNQEAAEEIDNYIYDFINKF  341



>ref|XP_006472971.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=571

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 163/221 (74%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAIIAW+LC+F P++VKA V LSV F PR+P++  VE  RA++G+D+YICRFQEP
Sbjct  98   VAHDWGAIIAWYLCLFCPERVKAFVCLSVPFLPRNPNIKPVESMRALFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G+IEA+ A +G    L+NI+ A  +P P  FP++  F    +    LP+W  E+DL +Y 
Sbjct  158  GKIEAQIAQVGTAEVLKNIL-ANRKPGPSCFPEENAFGIDPENRVTLPSWFSEQDLSFYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             ++ +TGFTG +NYYRA+ L+WE+TA W+  +V VP KFIVG+LD+VY  PG KEY+HNG
Sbjct  217  TKFNQTGFTGALNYYRAMNLNWEMTAAWTEVQVKVPVKFIVGELDMVYTTPGIKEYVHNG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLE++VV++   HF+NQE  +E+N HI +F+ KF
Sbjct  277  GFKKDVPLLEEIVVIEDAGHFINQERAEEINAHIYDFIKKF  317


 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 3/140 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HD+GAIIAWHLC+FRP++VK+ V+L + + P  P+L  VE  RAMYG++ YIC+FQEP
Sbjct  419  VAHDFGAIIAWHLCLFRPERVKSFVSLGMPYLPTDPNLKPVETLRAMYGDNFYICKFQEP  478

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKD--KGFTDGSTALPAWLPEEDLDYYVN  415
            G +EA  A IG K  L + +    RP P    +D        +  LP WL EE+ +YYV 
Sbjct  479  GVLEAGIAHIGSKLMLASSL-TTRRPGPPIISEDAIAHLARETINLPFWLSEEEFNYYVT  537

Query  414  RYEKTGFTGGVNYYRALKLD  355
            ++++TGFTGG+NYYRA+ L+
Sbjct  538  KFDQTGFTGGLNYYRAIDLN  557



>ref|XP_010449872.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=379

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 161/221 (73%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW LC +RPDKVKALVN+SV F PR+     V   R ++G+D+YICRFQ+P
Sbjct  159  VGHDWGAMLAWQLCQYRPDKVKALVNMSVLFSPRNSERVPVPTLRHIFGDDYYICRFQKP  218

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            GEIEAEF  +G +  L+  +  +  P PL+ PK K F    + + ALP WL +EDLDYYV
Sbjct  219  GEIEAEFMKLGTEKVLKEFL-TYKTPGPLHLPKGKCFECSENDACALPPWLTQEDLDYYV  277

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +Y+K GFTG +NYYR +  +WELTAPW+G+K+ VP KFIVGD DL Y  PGAKEYI+ G
Sbjct  278  TKYDKKGFTGPINYYRNIDRNWELTAPWTGAKIHVPVKFIVGDQDLTYNFPGAKEYINGG  337

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
              K +VPLL++ VVL+G+ HFL++E P  +N HI +F +KF
Sbjct  338  CFKREVPLLDETVVLKGLGHFLHEEDPDVINQHIHSFFHKF  378



>ref|XP_009393200.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 155/218 (71%), Gaps = 3/218 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA IAW+LC+FRPD+VKALVNLSV F PR+P     +  R+ YG+D Y+CRFQEP
Sbjct  100  VGHDWGAQIAWNLCLFRPDRVKALVNLSVPFMPRNPAGKPTQHFRSFYGDDFYVCRFQEP  159

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G IEAEFA IG    L+ I+       PL   +     +   ALP+WL EED+DY+ ++ 
Sbjct  160  GAIEAEFARIGTGKLLR-IVLCNRNAGPLLLSEVD--FEAEVALPSWLSEEDIDYFASKL  216

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
            +K+GFTG VNYYR L L+WEL APWSG ++ VP KFI+GD D+ Y  PG KEYI  GG +
Sbjct  217  DKSGFTGPVNYYRCLDLNWELGAPWSGVQIQVPVKFIIGDQDMTYHFPGIKEYIQGGGFR  276

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             DVP+LE+ VV++GVAHF+NQE   E+ +HI +F+ +F
Sbjct  277  RDVPMLEEAVVMEGVAHFINQEKAPEITDHICDFIRRF  314



>ref|XP_002320333.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|ABK93786.1| unknown [Populus trichocarpa]
 gb|EEE98648.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 163/220 (74%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA++AW+ C+ RPD+VKALVN+SV F PR+PH   V+  R ++G+D+YICRFQEP
Sbjct  98   VGHDWGAMVAWYFCLLRPDRVKALVNMSVVFQPRNPHKSFVQISRDLFGDDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYVN  415
            GE+E +FA +     ++  + +   P+P   PK+ GF     +  LP+WL E+D++YY  
Sbjct  158  GEVEEDFAQMDTARIIRKFLTS-RNPKPPCIPKEVGFRGLPDNPNLPSWLSEKDINYYAG  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++ +TGFTGG+NYYR L L+WEL A W+G ++ VP KFIVGDLD+ Y +P A++YI  GG
Sbjct  217  KFNQTGFTGGLNYYRCLDLNWELMAAWTGLQIKVPVKFIVGDLDITYNMPEAQDYISKGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            LK  VP L++V +++GVAHFLNQE P+EV++HI +F+ KF
Sbjct  277  LKKYVPFLQEVAIMEGVAHFLNQEKPEEVSSHIYDFIKKF  316



>emb|CAD31713.1| epoxide hydrolase [Cicer arietinum]
Length=275

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 157/222 (71%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+ CMFRP+++KA V LSV    R+P +  V+  RA YG+D+YICRFQEP
Sbjct  55   VAHDWGAIIGWYFCMFRPERIKAYVCLSVPLLHRNPKIKTVDAMRAAYGDDYYICRFQEP  114

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFT-DGSTALPAWLPEEDLDYY  421
            G++EA+ A +G    L+NI+       P+  PK +   GF  D    LP+WL E DL Y+
Sbjct  115  GKMEAQMAEVGTAYVLKNILTTRKTGPPI-LPKGEYGTGFNPDTPDTLPSWLTEADLAYF  173

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V+++EKTGFTGG+NYYR L L+WEL APW G+KV VP KFI G+LD+VY     KEYIH 
Sbjct  174  VSKFEKTGFTGGLNYYRNLNLNWELMAPWRGAKVYVPVKFITGELDMVYTSLNMKEYIHG  233

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE+V+V +GVAHF NQEA +E++NHI  F+ KF
Sbjct  234  GGFKEDVPNLEEVIVQKGVAHFNNQEAAEEISNHIYEFIKKF  275



>ref|XP_006397371.1| hypothetical protein EUTSA_v10022504mg [Eutrema salsugineum]
 gb|ESQ38824.1| hypothetical protein EUTSA_v10022504mg [Eutrema salsugineum]
Length=318

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 161/223 (72%), Gaps = 6/223 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSV--HFFPRHPHLDLVEGHRAMYGNDHYICRFQ  595
            VGHDWGA+IAW+LC+FRPDKVKALVNLSV   F P +P +  ++G R  YG D Y+CRFQ
Sbjct  97   VGHDWGALIAWYLCLFRPDKVKALVNLSVPFSFRPTNPTVKPLDGLRKFYGEDFYMCRFQ  156

Query  594  EPGEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF---TDGSTALPAWLPEEDLDY  424
            E GEIEAE + +G++  ++ I+  +  P PL  PKDK F    D +  LP+WL EED+ Y
Sbjct  157  EVGEIEAEISEVGIERVVRRIL-TYRMPRPLILPKDKSFWGSKDETIPLPSWLREEDVAY  215

Query  423  YVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH  244
            YV ++E+ GFTGGVN+YR    + E+  PW G K+ VPTKF++GD DLVY +PG KEYIH
Sbjct  216  YVRKFEEKGFTGGVNFYRNFDRNNEMLGPWVGCKIQVPTKFVIGDQDLVYYMPGVKEYIH  275

Query  243  NGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
                K DVPLLE+ VV++GVAHF+NQE PQE+   I++F+ KF
Sbjct  276  GPNFKEDVPLLEEPVVMEGVAHFINQEKPQEILRLIVDFIFKF  318



>gb|AES82420.2| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 163/222 (73%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHD GAII W+LCMFRP+++KA V LSV F  R+P +  V+G RA+YG+D+YICRFQEP
Sbjct  99   VGHDMGAIIGWYLCMFRPERIKAYVCLSVPFLHRNPKIRTVDGMRAVYGDDYYICRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFT-DGSTALPAWLPEEDLDYY  421
            GE+EA+ A +G    ++NI+       P+ FPK +   GF  D    LP+WL E+DL Y+
Sbjct  159  GEMEAQMAEVGTTYVMKNILTTRKTGPPI-FPKGEYGTGFNPDTPDNLPSWLTEDDLAYF  217

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V+++EKTGFTGG+NYYR   L+WELTAPW+G K+ VP KFI G+LD+VY     KEYIH 
Sbjct  218  VSKFEKTGFTGGLNYYRNFNLNWELTAPWTGVKIKVPVKFITGELDMVYTSFNLKEYIHG  277

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE+V++ +GVAHF NQEA +E++N+I  F+ KF
Sbjct  278  GGFKEDVPNLEEVIIQKGVAHFNNQEAEEEISNYIYEFIMKF  319



>gb|ACU23321.1| unknown [Glycine max]
Length=318

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 164/222 (74%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA++ W+LCMFRP+KVKA V LSV F PR+P++  V+G RAMYG D+YI RFQ+P
Sbjct  98   VAHDWGALMGWYLCMFRPEKVKAYVCLSVPFIPRNPNVRTVDGLRAMYGEDYYISRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFTDGST-ALPAWLPEEDLDYY  421
            GE+EA+ A +G +  L+N++    +  P  FPK +   GF    T  LP+WL EEDL YY
Sbjct  158  GEMEAQMAEVGTEYVLKNLLTT-RKTGPPTFPKGEYGTGFNPNMTDILPSWLTEEDLAYY  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V+++EKTGFTGG+NYYR +  +WELT PW+  ++ VP KFI G+LD+VY   G KEYIH 
Sbjct  217  VSKFEKTGFTGGLNYYRNINSNWELTTPWTRVQIKVPVKFIAGELDMVYTSLGIKEYIHG  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE V+V +GVAHF NQEA ++++N+I +F+NKF
Sbjct  277  GGFKEDVPNLEQVIVQKGVAHFNNQEAAEDISNYIHDFINKF  318



>ref|XP_008775992.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=319

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 163/220 (74%), Gaps = 3/220 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA +AWHLC+FRPD+VKALVNLSV F PR+P    +   RA+ G+++YI RFQE 
Sbjct  101  VGHDWGAFVAWHLCLFRPDRVKALVNLSVPFMPRNPAAKPLNHVRALNGDEYYISRFQEH  160

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G +EAEFA +G  T L+  +  +  P PL+ PK+  G  +    LP+WL EED++Y+ ++
Sbjct  161  GAVEAEFARLGTATVLRKFL-TYRNPGPLFIPKEGWGSPNEHITLPSWLSEEDINYFTSK  219

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKE-YIHNGG  235
            +EK+GFTG +NYYR L L+WEL A W+G+++ VP KFI+GDLDL Y  P  ++ YIH GG
Sbjct  220  FEKSGFTGPINYYRCLDLNWELAAAWTGAQIKVPAKFIIGDLDLNYHDPPRRQDYIHKGG  279

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
             K DVPLL++VVV++GVAHF+NQE  QE+ +HI +F+ KF
Sbjct  280  FKKDVPLLQEVVVMEGVAHFINQEKAQEITDHIFDFIQKF  319



>ref|XP_003554635.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43313.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 164/222 (74%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA++ W+LCMFRP+KVKA V LSV F PR+P++  V+G RAMYG D+YI RFQ+P
Sbjct  98   VAHDWGALMGWYLCMFRPEKVKAYVCLSVPFIPRNPNVRTVDGLRAMYGEDYYISRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFTDGST-ALPAWLPEEDLDYY  421
            GE+EA+ A +G +  L+N++    +  P  FPK +   GF    T  LP+WL EEDL YY
Sbjct  158  GEMEAQMAEVGTEYVLKNLLTT-RKTGPPTFPKGEYGTGFNPNMTDILPSWLTEEDLAYY  216

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V+++EKTGFTGG+NYYR +  +WELT PW+  ++ VP KFI G+LD+VY   G KEYIH 
Sbjct  217  VSKFEKTGFTGGLNYYRNINSNWELTTPWTRVQIKVPVKFIAGELDMVYTSLGIKEYIHG  276

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE V+V +GVAHF NQEA ++++N+I +F+NKF
Sbjct  277  GGFKEDVPNLEQVIVQKGVAHFNNQEAAEDISNYIHDFINKF  318



>emb|CDY05187.1| BnaC05g46160D [Brassica napus]
Length=340

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 155/224 (69%), Gaps = 7/224 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+ W+LC+FRP+K+K  V LSV + PR+P +  VEG +A++G+D+YICRFQEP
Sbjct  111  VGHDWGAIVGWYLCLFRPEKIKGFVCLSVPYRPRNPKVKPVEGFKAVFGDDYYICRFQEP  170

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDG------STALPAWLPEEDLD  427
            G+ E E A    +  L+NI F      P   PKD  F            LP W  +EDLD
Sbjct  171  GKAEGEIACADPRRVLKNI-FTGRELGPPILPKDNPFGANPNPNCEQVELPEWFSKEDLD  229

Query  426  YYVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYI  247
            YYV+++EKTGFTGG+NYYRA+ L WELTAPW+G+K+ VP KF+ GDLD+VY  PG KEYI
Sbjct  230  YYVSKFEKTGFTGGLNYYRAMDLTWELTAPWTGAKIQVPVKFMTGDLDMVYTTPGVKEYI  289

Query  246  HNGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            H GG   DVP L++VVV++   HF+NQE PQEV  HI +F  K 
Sbjct  290  HGGGFAADVPNLQEVVVIEDAGHFVNQEKPQEVTAHINDFFTKL  333



>gb|EMS45147.1| Epoxide hydrolase 2 [Triticum urartu]
Length=212

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 159/212 (75%), Gaps = 2/212 (1%)
 Frame = -2

Query  747  IIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEPGEIEAEF  568
            +IAW LC+FRPD+VKALV LSV F PR P    V+G +A+YG+++YICR QEPG IEAEF
Sbjct  1    MIAWSLCLFRPDRVKALVALSVPFSPRSPARKPVDGLKALYGDEYYICRIQEPGAIEAEF  60

Query  567  APIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNRYEKTGFT  391
            A +G +  L+   F +  P PL+ PK   G  D    LP+W+ EED+ YY ++++K+GFT
Sbjct  61   ARLGTELVLRKF-FTYRTPGPLFIPKSGWGSPDDEVPLPSWITEEDIKYYASQFDKSGFT  119

Query  390  GGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLKNDVPLL  211
            G +NYYRAL   WELT+PW+G+++ VPTKFIVGD+DL Y + GA ++++ GGLK  VPLL
Sbjct  120  GALNYYRALNKTWELTSPWTGAEIKVPTKFIVGDVDLSYHVAGAHDFVNKGGLKKFVPLL  179

Query  210  EDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            +DVVV++ V HF+N+E P+E++ HII+FL KF
Sbjct  180  DDVVVMKDVGHFINEEKPEEISAHIISFLKKF  211



>gb|KCW50060.1| hypothetical protein EUGRSUZ_K03501 [Eucalyptus grandis]
Length=332

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 152/214 (71%), Gaps = 10/214 (5%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI+AWHLC+ RPD+VKALVN SV +FPR+P    VE  RA +G+D+Y+CRFQEP
Sbjct  99   VGHDWGAIMAWHLCLVRPDRVKALVNTSVAWFPRNPERKPVESMRATFGDDYYVCRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFT-------DGSTALPAWLPEED  433
            G  E +FA   +   +Q  +F  GR P P   PKD G +            LP+WL ++D
Sbjct  159  GVAEEDFAKADIAKLIQ--LFLTGRDPSPPIVPKDVGISGLIKLLDQQQVELPSWLTDDD  216

Query  432  LDYYVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKE  253
            + YY  ++ +TGFTGG NYYR L L+WEL+APW+G+++ VP KFIVGDLDL Y  PG KE
Sbjct  217  ISYYATQFSRTGFTGGFNYYRCLDLNWELSAPWTGARIEVPVKFIVGDLDLTYHFPGVKE  276

Query  252  YIHNGGLKNDVPLLEDVVVLQGVAHFLNQEAPQE  151
            YIH+GG K  VP LEDVVV++GVAHFL QE PQE
Sbjct  277  YIHDGGFKKAVPNLEDVVVMEGVAHFLQQEKPQE  310



>ref|XP_006444387.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 ref|XP_006479995.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR57627.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 gb|KDO87172.1| hypothetical protein CISIN_1g021184mg [Citrus sinensis]
Length=316

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/221 (54%), Positives = 162/221 (73%), Gaps = 5/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGA+IAW+ C+ RPD+VKALVNLSV F  R+P    V+ +RA++G+D YICRFQEP
Sbjct  98   VGHDWGALIAWYFCLLRPDRVKALVNLSVVFRSRNPATKPVDQYRALFGDDFYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGR-PEPLYFPKDKGFTD--GSTALPAWLPEEDLDYYV  418
            G  E +FA I     ++   F  GR P+P   PK+ GF        LP+WL EED++YY 
Sbjct  158  GVAEEDFAQIDTARLIKK--FLGGRSPKPPCVPKEIGFRGLPDLRTLPSWLSEEDVNYYA  215

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
            +++ + GFTGG+NYYR L L+WEL APW+G+++ +P KF+VGDLD+ Y IPG +EYI NG
Sbjct  216  SKFSQKGFTGGLNYYRCLDLNWELLAPWTGAQIKIPVKFMVGDLDITYHIPGIREYIQNG  275

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVP L++V+V++GVAHF+NQE   EV++HI +F+ +F
Sbjct  276  GFKKDVPGLQEVIVMEGVAHFINQEKADEVSSHIYDFIKQF  316



>gb|KEH24503.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 160/222 (72%), Gaps = 5/222 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRP+++KA V LSV F  R+P +  V+G RA YG+D+YI RFQEP
Sbjct  99   VAHDWGAIIGWYLCMFRPERIKAYVCLSVPFTRRNPKIRTVDGMRAAYGDDYYISRFQEP  158

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK---GFT-DGSTALPAWLPEEDLDYY  421
            G++EA+ A +G    +++ +       P+ FPK +   GF  D    LP+WL E+DL Y+
Sbjct  159  GKMEAQMAEVGTAYVMKSTLTTRKTGPPI-FPKGEFGTGFNPDTPDKLPSWLTEDDLAYF  217

Query  420  VNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHN  241
            V+++EKTGF GG+NYYR L L+WEL APW+G K+ VP KFI GDLD+VY  P  KEYIH 
Sbjct  218  VSKFEKTGFVGGLNYYRNLNLNWELMAPWNGVKIKVPVKFITGDLDIVYTSPKVKEYIHG  277

Query  240  GGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            GG K DVP LE+V+V +GVAHF NQEA +E++NHI  F+ KF
Sbjct  278  GGFKEDVPNLEEVIVQKGVAHFNNQEAAEEISNHIYEFIKKF  319



>gb|ACU19450.1| unknown [Glycine max]
Length=315

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 160/219 (73%), Gaps = 3/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPDKVKA V LSV    R P++  V+G RA+YG+D+Y+CRFQ+P
Sbjct  98   VAHDWGAIIGWYLCMFRPDKVKAYVCLSVPLLRRDPNIRTVDGMRALYGDDYYVCRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFT-DGSTALPAWLPEEDLDYYVN  415
            GE+EA+ A +G +  L+NI+     P P   PK +  F  +    LP+WL EEDL YYV+
Sbjct  158  GEMEAQMAEVGTEYVLENILTT-RNPGPPILPKGRFQFNPEMPNTLPSWLTEEDLAYYVS  216

Query  414  RYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGG  235
            ++EKTGFTG +NYYR   L+WELTAPW+G ++ VP K+I G+LD+VY     KEYIH GG
Sbjct  217  KFEKTGFTGPLNYYRNFNLNWELTAPWTGGQIKVPVKYITGELDMVYNSLNLKEYIHGGG  276

Query  234  LKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNK  118
             K DVP LE V+V +GVAHF NQEA +E++N+I +F+NK
Sbjct  277  FKQDVPNLEQVIVQKGVAHFNNQEAAEEIDNYIYDFINK  315



>ref|NP_001276233.1| bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|ACU18052.1| unknown [Glycine max]
Length=318

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 163/223 (73%), Gaps = 7/223 (3%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGAII W+LCMFRPDKVKA V LSV F  R+P++  V+G RAMYG D+YICRFQ+P
Sbjct  98   VAHDWGAIIGWYLCMFRPDKVKAYVCLSVPFIRRNPNVRTVDGMRAMYGEDYYICRFQKP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTD-----GSTALPAWLPEEDLDY  424
            GE+EA+ A +G +  L+NI+    +P P  FPK +  T          LP+WL ++DL Y
Sbjct  158  GEMEAQMAQVGTEYVLKNIL-TIRKPGPPIFPKGEFGTGLNPNMSDDTLPSWLTDDDLAY  216

Query  423  YVNRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIH  244
            YV++YEK+GFTG +NYYR + L+WELTAPW+G ++ V  K+I G+LD+VY   G KEY+H
Sbjct  217  YVSKYEKSGFTGPLNYYRNMNLNWELTAPWTGVQIQVVVKYITGELDMVYTSLGMKEYVH  276

Query  243  NGGLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            +GG K DVP L+ VVV +GV HF N EA +E+NNHI +F+NKF
Sbjct  277  SGGFKQDVPNLQ-VVVQKGVTHFNNLEAAEEINNHIHDFINKF  318



>gb|ACE82565.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   255 bits (651),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 161/220 (73%), Gaps = 4/220 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+I W+LC+FRPD VKA V LSV F PRHP +  +   RA +G+D+Y+CRFQ+P
Sbjct  98   VAHDWGAMIGWYLCLFRPDLVKAYVCLSVPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF-TDGSTALPAWLPEEDLDYYVNR  412
            G +E E A  G +  L+ I+    +P P   PK   F     + LP+WL ++DL+YY  +
Sbjct  158  G-MEEEIAKYGSEVVLKKIL-TDRKPGPPCLPKGSPFGISPDSKLPSWLSQDDLNYYSTK  215

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +++ GFTGG+NYYRAL L+WELTA W+G+KV VP KF+VG+LDLVY  PG KEY+H GG 
Sbjct  216  FDRKGFTGGLNYYRALDLNWELTAAWTGAKVKVPVKFMVGELDLVYTTPGMKEYVHGGGF  275

Query  231  KNDVPLL-EDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K DVP+L EDVVV++G AHF+NQE  QE+N+HI +F+NKF
Sbjct  276  KKDVPMLDEDVVVMEGAAHFINQERAQEINSHIYDFINKF  315



>ref|XP_004230258.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=314

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 157/219 (72%), Gaps = 3/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HDWGA+I W+LCMFRPD VKA V LSV F PR+P +  +   RA  G+D+Y+CRFQ+P
Sbjct  98   VAHDWGAMIGWYLCMFRPDLVKAYVCLSVPFRPRNPKMKPIPTMRAFLGDDYYMCRFQDP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGF-TDGSTALPAWLPEEDLDYYVNR  412
            G +E E A  G +  L+ I+     P P   PK+  F    +  LP WL ++DL+YY  +
Sbjct  158  G-MEDEIAKYGSEAILKKILID-RTPGPPRLPKENPFGISTNDKLPLWLSQDDLNYYSTK  215

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            +++ GFTGG+NYYRAL L+WELTAPW+G KV VP KF+VGDLD+VY  PG KEY+H GG 
Sbjct  216  FDQKGFTGGLNYYRALDLNWELTAPWTGVKVNVPVKFVVGDLDVVYTTPGVKEYVHGGGF  275

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K DVP+LE VVVL+G AHF+NQE  QE N+HI +F+NKF
Sbjct  276  KKDVPMLEGVVVLEGAAHFINQERAQETNSHIYDFINKF  314



>emb|CDY65635.1| BnaAnng20800D [Brassica napus]
Length=315

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 153/219 (70%), Gaps = 2/219 (1%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAIIAW +CM RPD+VKALVN+SV F PR+P +  V+ ++A++G D+YICRFQEP
Sbjct  98   VGHDWGAIIAWWMCMIRPDRVKALVNMSVEFHPRNPSVKTVDAYKALFGEDYYICRFQEP  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDK-GFTDGSTALPAWLPEEDLDYYVNR  412
            G+IE +FA +  K  L N  F      P   PK    +     ALP W  E+D+ +Y ++
Sbjct  158  GDIEEDFAQVDTKK-LVNGFFTSHNTRPPCIPKSVFRYLPDPPALPGWFTEQDVCFYADK  216

Query  411  YEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGL  232
            + + GFTGG+NYYRA+ L WELTAPW G ++ VP K+I GDLD  Y IPG KEYIH GGL
Sbjct  217  FSQKGFTGGLNYYRAMNLSWELTAPWDGLQIKVPVKYITGDLDPTYHIPGTKEYIHEGGL  276

Query  231  KNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            K  VP L++VVV++GV HFL QE P+E+ +HI  F  KF
Sbjct  277  KKHVPFLQEVVVMEGVGHFLQQEKPKEITDHIYGFFKKF  315



>ref|XP_010674075.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=317

 Score =   254 bits (650),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            V HD GA++ W+LCMFRPD++KA V+LSV F PR+P L   +  RA++G+ +YICRFQE 
Sbjct  98   VAHDMGAMVGWYLCMFRPDRIKAFVSLSVPFRPRNPKLKPTQTLRAIFGDAYYICRFQEA  157

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFT---DGSTALPAWLPEEDLDYYV  418
            G+IEAE    G+K  L+ I+ +     P+  PK K F    +    LP+WL EED+DYY 
Sbjct  158  GDIEAEITECGIKHVLKKILTSRDPGAPM-LPKGKSFDVSPESPIILPSWLSEEDIDYYA  216

Query  417  NRYEKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNG  238
             +YE+ GFTG +N+YR L  +WELTAPW+G ++ VP K +VGDLD+VY + G K+Y+HNG
Sbjct  217  AKYEEKGFTGPLNHYRNLDWNWELTAPWTGVELKVPAKLVVGDLDMVYNMFGVKDYVHNG  276

Query  237  GLKNDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF  115
            G K DVPLLEDVVV++GV HF+NQE  +EVN HII F +KF
Sbjct  277  GFKKDVPLLEDVVVMEGVGHFINQEKAEEVNQHIIEFFSKF  317



>ref|XP_004981166.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=330

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 154/220 (70%), Gaps = 1/220 (0%)
 Frame = -2

Query  768  VGHDWGAIIAWHLCMFRPDKVKALVNLSVHFFPRHPHLDLVEGHRAMYGNDHYICRFQEP  589
            VGHDWGAI++W+LC+ RPD+V+ALVNLSV F PR P +  VE  RA YG+D+Y+CRFQEP
Sbjct  102  VGHDWGAIVSWNLCVLRPDRVRALVNLSVAFMPRRPGVKPVEYFRAAYGDDYYVCRFQEP  161

Query  588  GEIEAEFAPIGVKTCLQNIIFAFGRPEPLYFPKDKGFTDGSTALPAWLPEEDLDYYVNRY  409
            G +EAEFA   +K+  +  +            +     +   ALP+WL EED+ Y  + Y
Sbjct  162  G-VEAEFAAFDLKSFFKLALTVNTTGSSSMNLRKMQAYNKEIALPSWLSEEDVSYLASVY  220

Query  408  EKTGFTGGVNYYRALKLDWELTAPWSGSKVMVPTKFIVGDLDLVYQIPGAKEYIHNGGLK  229
             KTGF GGVNYYR L L+WEL APW+G+KV VPTKFIVGD DL Y  PG + YIH GGLK
Sbjct  221  AKTGFAGGVNYYRCLDLNWELMAPWTGAKVQVPTKFIVGDGDLAYHHPGVRSYIHKGGLK  280

Query  228  NDVPLLEDVVVLQGVAHFLNQEAPQEVNNHIINFLNKF*T  109
             DVP+LE+VVV++G  HF+ QE  QE++ HI +++ KF T
Sbjct  281  RDVPMLEEVVVIKGAGHFIQQERAQEISKHIYDYIKKFET  320



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100