BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020D05

Length=766
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595430.1|  PREDICTED: uncharacterized protein LOC104091732    163   3e-42   Nicotiana tomentosiformis
ref|XP_009769069.1|  PREDICTED: uncharacterized protein LOC104219993    162   1e-41   Nicotiana sylvestris
ref|XP_011084036.1|  PREDICTED: uncharacterized protein LOC105166393    157   3e-40   Sesamum indicum [beniseed]
ref|XP_010323258.1|  PREDICTED: uncharacterized protein LOC101249097    154   8e-39   Solanum lycopersicum
emb|CDP10517.1|  unnamed protein product                                151   6e-38   Coffea canephora [robusta coffee]
ref|XP_006359539.1|  PREDICTED: uncharacterized protein LOC102594159    151   9e-38   Solanum tuberosum [potatoes]
ref|XP_003549703.1|  PREDICTED: uncharacterized protein LOC100781443    140   8e-34   Glycine max [soybeans]
ref|XP_003542623.1|  PREDICTED: uncharacterized protein LOC100802615    139   1e-33   Glycine max [soybeans]
gb|EEC83275.1|  hypothetical protein OsI_28629                          135   5e-33   Oryza sativa Indica Group [Indian rice]
gb|EEE68404.1|  hypothetical protein OsJ_26758                          135   2e-32   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ84968.1|  predicted protein                                      129   2e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006660014.1|  PREDICTED: uncharacterized protein LOC102712285    134   3e-32   Oryza brachyantha
ref|NP_001061456.1|  Os08g0288500                                       134   6e-32   
ref|XP_004973180.1|  PREDICTED: uncharacterized protein LOC101758421    133   2e-31   Setaria italica
ref|XP_010542083.1|  PREDICTED: uncharacterized protein LOC104815398    130   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_009358504.1|  PREDICTED: uncharacterized protein LOC103949129    129   1e-30   
gb|EYU25294.1|  hypothetical protein MIMGU_mgv1a003157mg                126   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_009338424.1|  PREDICTED: uncharacterized protein LOC103930775    126   4e-29   
gb|EMT16376.1|  Tuftelin-interacting protein 11                         126   4e-29   
ref|NP_001152479.1|  LOC100286119                                       125   6e-29   Zea mays [maize]
ref|XP_010109666.1|  Zinc finger CCCH-type with G patch domain-co...    125   1e-28   
ref|XP_003573663.1|  PREDICTED: uncharacterized protein LOC100845409    125   1e-28   Brachypodium distachyon [annual false brome]
ref|XP_008801998.1|  PREDICTED: uncharacterized protein LOC103715...    124   2e-28   Phoenix dactylifera
ref|XP_008801999.1|  PREDICTED: uncharacterized protein LOC103715...    124   2e-28   
ref|XP_011017950.1|  PREDICTED: uncharacterized protein LOC105121122    123   5e-28   Populus euphratica
ref|XP_007013705.1|  Zinc finger protein, putative isoform 2            122   7e-28   
ref|XP_007013704.1|  Zinc finger protein, putative isoform 1            122   1e-27   
tpg|DAA46961.1|  TPA: hypothetical protein ZEAMMB73_831663              113   1e-27   
gb|KEH32162.1|  D111/G-patch domain protein                             121   2e-27   Medicago truncatula
gb|KJB64581.1|  hypothetical protein B456_010G054900                    121   2e-27   Gossypium raimondii
ref|XP_002325162.2|  D111/G-patch domain-containing family protein      120   4e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006381899.1|  hypothetical protein POPTR_0006s20370g             115   5e-27   
ref|XP_010913385.1|  PREDICTED: uncharacterized protein LOC105039...    119   8e-27   Elaeis guineensis
ref|XP_010913384.1|  PREDICTED: uncharacterized protein LOC105039...    119   8e-27   Elaeis guineensis
ref|XP_011033482.1|  PREDICTED: uncharacterized protein LOC105131955    119   9e-27   Populus euphratica
ref|XP_010040586.1|  PREDICTED: probable LRR receptor-like serine...    119   2e-26   
ref|XP_009387541.1|  PREDICTED: uncharacterized protein LOC103974...    118   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009387542.1|  PREDICTED: uncharacterized protein LOC103974...    118   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687767.1|  PREDICTED: uncharacterized protein LOC104901840    118   3e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002523543.1|  zinc finger protein, putative                      117   5e-26   Ricinus communis
ref|XP_006407631.1|  hypothetical protein EUTSA_v10020109mg             116   1e-25   Eutrema salsugineum [saltwater cress]
gb|AES91716.2|  D111/G-patch domain protein                             115   2e-25   Medicago truncatula
ref|XP_003609519.1|  Zinc finger CCCH-type with G patch domain-co...    115   3e-25   
gb|KCW82693.1|  hypothetical protein EUGRSUZ_C04073                     110   6e-25   Eucalyptus grandis [rose gum]
ref|XP_008443898.1|  PREDICTED: uncharacterized protein LOC103487...    114   7e-25   Cucumis melo [Oriental melon]
ref|XP_008443896.1|  PREDICTED: uncharacterized protein LOC103487...    114   7e-25   Cucumis melo [Oriental melon]
gb|KFK38375.1|  hypothetical protein AALP_AA3G105800                    114   9e-25   Arabis alpina [alpine rockcress]
gb|KDP38622.1|  hypothetical protein JCGZ_03975                         113   1e-24   Jatropha curcas
ref|XP_010042746.1|  PREDICTED: septin and tuftelin-interacting p...    109   1e-24   
ref|XP_009341849.1|  PREDICTED: uncharacterized protein LOC103933875    113   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_009341804.1|  PREDICTED: uncharacterized protein LOC103933838    113   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_009366281.1|  PREDICTED: uncharacterized protein LOC103956064    113   1e-24   
gb|KGN65218.1|  hypothetical protein Csa_1G266150                       112   2e-24   Cucumis sativus [cucumbers]
ref|XP_004146703.1|  PREDICTED: uncharacterized protein LOC101215133    112   2e-24   Cucumis sativus [cucumbers]
ref|XP_004508396.1|  PREDICTED: uncharacterized protein LOC101505169    112   4e-24   
ref|XP_007203786.1|  hypothetical protein PRUPE_ppa001771mg             112   4e-24   Prunus persica
ref|XP_004162452.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    112   4e-24   
ref|XP_008242893.1|  PREDICTED: uncharacterized protein LOC103341193    111   6e-24   Prunus mume [ume]
ref|XP_008336930.1|  PREDICTED: uncharacterized protein LOC103400027    110   8e-24   
gb|KCW82695.1|  hypothetical protein EUGRSUZ_C04076                     103   1e-23   Eucalyptus grandis [rose gum]
ref|XP_010041360.1|  PREDICTED: zinc finger CCCH-type with G patc...    105   3e-23   
ref|XP_007155121.1|  hypothetical protein PHAVU_003G175300g             109   3e-23   Phaseolus vulgaris [French bean]
gb|KCW44417.1|  hypothetical protein EUGRSUZ_L02096                     105   3e-23   Eucalyptus grandis [rose gum]
ref|XP_002884758.1|  hypothetical protein ARALYDRAFT_478310             108   4e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_010464642.1|  PREDICTED: uncharacterized protein LOC104745...    108   5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010464640.1|  PREDICTED: uncharacterized protein LOC104745...    108   5e-23   
ref|XP_010486561.1|  PREDICTED: dentin sialophosphoprotein-like i...    108   8e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006453696.1|  hypothetical protein CICLE_v10007567mg             108   9e-23   Citrus clementina [clementine]
ref|XP_010486559.1|  PREDICTED: dentin sialophosphoprotein-like i...    108   9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004287228.1|  PREDICTED: uncharacterized protein LOC101294206    107   1e-22   Fragaria vesca subsp. vesca
emb|CDY41580.1|  BnaC05g43170D                                          107   1e-22   Brassica napus [oilseed rape]
ref|XP_010265699.1|  PREDICTED: uncharacterized protein LOC104603377    106   3e-22   Nelumbo nucifera [Indian lotus]
ref|XP_006299668.1|  hypothetical protein CARUB_v10015856mg             106   3e-22   Capsella rubella
ref|XP_010477969.1|  PREDICTED: uncharacterized protein LOC104756959    106   4e-22   Camelina sativa [gold-of-pleasure]
emb|CDY54616.1|  BnaA05g28700D                                          105   5e-22   Brassica napus [oilseed rape]
ref|XP_009146893.1|  PREDICTED: uncharacterized protein LOC103870513    103   2e-21   Brassica rapa
ref|NP_566359.1|  D111/G-patch domain-containing protein                100   3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244790.1|  PREDICTED: uncharacterized protein LOC104588524  97.1    4e-19   Nelumbo nucifera [Indian lotus]
gb|EPS60366.1|  hypothetical protein M569_14436                       72.0    5e-13   Genlisea aurea
ref|XP_001776479.1|  predicted protein                                78.6    5e-13   
ref|XP_002265219.2|  PREDICTED: uncharacterized protein LOC100260114  72.0    5e-11   Vitis vinifera
emb|CBI25601.3|  unnamed protein product                              72.0    5e-11   Vitis vinifera
ref|XP_006679437.1|  hypothetical protein BATDEDRAFT_25372            69.3    6e-10   Batrachochytrium dendrobatidis JAM81
ref|XP_010906679.1|  PREDICTED: septin and tuftelin-interacting p...  68.9    6e-10   Elaeis guineensis
ref|XP_008804692.1|  PREDICTED: septin and tuftelin-interacting p...  67.0    2e-09   Phoenix dactylifera
ref|XP_004300043.1|  PREDICTED: septin and tuftelin-interacting p...  67.0    3e-09   Fragaria vesca subsp. vesca
sp|Q0IIX9.2|TFP11_XENTR  RecName: Full=Tuftelin-interacting prote...  66.2    4e-09   Xenopus tropicalis [western clawed frog]
ref|NP_001090845.1|  tuftelin-interacting protein 11                  66.2    5e-09   Xenopus tropicalis [western clawed frog]
ref|XP_009397719.1|  PREDICTED: septin and tuftelin-interacting p...  66.2    5e-09   
ref|XP_005850261.1|  hypothetical protein CHLNCDRAFT_50559            65.9    7e-09   Chlorella variabilis
ref|NP_001091088.1|  Sip1/TFIP11 interacting protein                  65.5    9e-09   Ciona intestinalis [sea vase]
ref|XP_005645320.1|  hypothetical protein COCSUDRAFT_57335            65.1    9e-09   Coccomyxa subellipsoidea C-169
gb|KJB44347.1|  hypothetical protein B456_007G247300                  65.5    1e-08   Gossypium raimondii
gb|KHG03685.1|  Tuftelin-interacting 11                               65.5    1e-08   Gossypium arboreum [tree cotton]
ref|XP_009399051.1|  PREDICTED: septin and tuftelin-interacting p...  65.5    1e-08   
ref|XP_009861899.1|  PREDICTED: sip1/TFIP11 interacting protein i...  65.1    1e-08   Ciona intestinalis [sea vase]
ref|XP_005649692.1|  TFP11-domain-containing protein                  65.1    1e-08   Coccomyxa subellipsoidea C-169
ref|XP_011098023.1|  PREDICTED: septin and tuftelin-interacting p...  65.1    1e-08   Sesamum indicum [beniseed]
ref|XP_007058458.1|  PREDICTED: tuftelin-interacting protein 11       64.7    1e-08   Chelonia mydas [green seaturtle]
ref|XP_002501462.1|  predicted protein                                65.1    2e-08   Micromonas commoda
gb|EMP37184.1|  Tuftelin-interacting protein 11                       64.7    2e-08   Chelonia mydas [green seaturtle]
ref|XP_006137534.1|  PREDICTED: tuftelin-interacting protein 11       64.7    2e-08   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005298544.1|  PREDICTED: tuftelin-interacting protein 11       64.7    2e-08   Chrysemys picta bellii
gb|ABC69931.1|  STIP                                                  64.3    2e-08   Ciona savignyi [transparent tunicate]
ref|XP_001418877.1|  predicted protein                                60.1    2e-08   Ostreococcus lucimarinus CCE9901
ref|XP_003080850.1|  Tuftelin-interacting protein TIP39, contains...  63.5    3e-08   Ostreococcus tauri
ref|XP_008339239.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.9    3e-08   
ref|XP_004615574.1|  PREDICTED: tuftelin-interacting protein 11       63.9    3e-08   Sorex araneus [Eurasian shrew]
ref|XP_008140712.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Eptesicus fuscus
ref|XP_006261823.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Alligator mississippiensis
ref|XP_005869775.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Myotis brandtii
ref|XP_006102063.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Myotis lucifugus
ref|XP_006015340.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   
gb|EPS61679.1|  hypothetical protein M569_13115                       63.5    4e-08   Genlisea aurea
ref|XP_006762106.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Myotis davidii
ref|XP_010117527.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Chlamydotis macqueenii
ref|XP_010016065.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Nestor notabilis
ref|XP_009676417.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Struthio camelus australis
ref|XP_002524028.1|  tuftelin interacting protein, putative           63.5    4e-08   Ricinus communis
ref|XP_005144938.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.5    4e-08   Melopsittacus undulatus
ref|XP_010373885.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Rhinopithecus roxellana
ref|XP_003789889.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   
emb|CAL37965.1|  hypothetical protein                                 63.5    4e-08   synthetic construct
ref|XP_008462814.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Cucumis melo [Oriental melon]
ref|XP_009633041.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Egretta garzetta
ref|XP_009281103.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Aptenodytes forsteri
ref|XP_005336129.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   
ref|XP_006869252.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Chrysochloris asiatica
ref|XP_008050251.1|  PREDICTED: tuftelin-interacting protein 11       63.5    4e-08   Carlito syrichta
ref|NP_001126744.1|  tuftelin-interacting protein 11                  63.5    4e-08   Pongo abelii [orang utan]
ref|NP_001073621.1|  tuftelin-interacting protein 11                  63.5    4e-08   Pan troglodytes
ref|NP_001073589.1|  tuftelin-interacting protein 11                  63.5    4e-08   Macaca mulatta [rhesus macaque]
ref|NP_036275.1|  tuftelin-interacting protein 11                     63.5    4e-08   Homo sapiens [man]
ref|XP_009332696.1|  PREDICTED: tuftelin-interacting protein 11       63.2    4e-08   Pygoscelis adeliae
ref|XP_009006562.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Callithrix jacchus [common marmoset]
ref|XP_006213616.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Vicugna pacos
ref|XP_006185809.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Camelus ferus
ref|XP_003277776.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.2    5e-08   Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001073577.1|  tuftelin-interacting protein 11                  63.2    5e-08   Canis lupus familiaris [dogs]
gb|AAH33080.1|  Tuftelin interacting protein 11                       63.2    5e-08   Homo sapiens [man]
ref|NP_001087642.1|  tuftelin-interacting protein 11                  63.2    5e-08   
ref|XP_010081004.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Pterocles gutturalis
ref|XP_004479136.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Dasypus novemcinctus
gb|KFQ39573.1|  Tuftelin-interacting protein 11                       63.2    5e-08   Mesitornis unicolor
ref|XP_009927441.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Haliaeetus albicilla
ref|XP_003761206.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Sarcophilus harrisii
ref|NP_001091078.1|  tuftelin-interacting protein 11                  63.2    5e-08   Monodelphis domestica
ref|XP_010347495.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Saimiri boliviensis boliviensis
ref|XP_010718697.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Meleagris gallopavo [common turkey]
gb|ELK18625.1|  Tuftelin-interacting protein 11                       63.2    5e-08   Pteropus alecto
sp|A1XD95.1|TFP11_MACFA  RecName: Full=Tuftelin-interacting prote...  63.2    5e-08   Macaca fascicularis [crab eating macaque]
ref|XP_008576508.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004164520.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.2    5e-08   
ref|XP_003994807.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    5e-08   Felis catus [cat]
ref|XP_010188640.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Mesitornis unicolor
ref|XP_004151854.1|  PREDICTED: tuftelin-interacting protein 11-like  63.2    5e-08   
ref|XP_006904928.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Pteropus alecto
ref|XP_004766607.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    5e-08   Mustela putorius furo [black ferret]
ref|XP_002922821.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   
gb|KFO88150.1|  Tuftelin-interacting protein 11                       63.2    5e-08   Buceros rhinoceros silvestris
ref|XP_010094613.1|  Tuftelin-interacting protein 11                  63.2    5e-08   
ref|XP_009466848.1|  PREDICTED: tuftelin-interacting protein 11       63.2    5e-08   Nipponia nippon
ref|NP_001070682.1|  tuftelin-interacting protein 11                  63.2    6e-08   Sus scrofa [pigs]
ref|XP_010602003.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Fukomys damarensis [Damara mole rat]
ref|XP_006738156.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Leptonychotes weddellii
ref|XP_005396205.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Chinchilla lanigera
ref|XP_004690914.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Condylura cristata
ref|XP_004429903.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004412506.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Odobenus rosmarus divergens
ref|XP_004893175.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    6e-08   
ref|XP_009082323.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Acanthisitta chloris
ref|XP_005230545.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   
ref|NP_001025836.1|  tuftelin-interacting protein 11                  63.2    6e-08   Gallus gallus [bantam]
ref|XP_001499886.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    6e-08   Equus caballus [domestic horse]
ref|XP_006890530.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004387681.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Trichechus manatus latirostris
ref|XP_004628080.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Octodon degus
ref|XP_007082567.1|  PREDICTED: tuftelin-interacting protein 11 i...  63.2    6e-08   Panthera tigris altaica
ref|XP_004715371.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010580348.1|  PREDICTED: tuftelin-interacting protein 11       63.2    6e-08   Haliaeetus leucocephalus
ref|XP_008684908.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  63.2    6e-08   Ursus maritimus [white bear]
ref|NP_001008292.1|  tuftelin-interacting protein 11                  63.2    6e-08   Rattus norvegicus [brown rat]
gb|EKC18985.1|  Tuftelin-interacting protein 11                       62.8    6e-08   Crassostrea gigas
ref|XP_009558777.1|  PREDICTED: tuftelin-interacting protein 11       62.8    6e-08   Cuculus canorus
ref|XP_005498249.1|  PREDICTED: tuftelin-interacting protein 11       62.8    6e-08   
ref|XP_003478401.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    6e-08   Cavia porcellus [guinea pig]
ref|NP_001093435.1|  tuftelin-interacting protein 11                  62.8    6e-08   Oryctolagus cuniculus [domestic rabbit]
ref|XP_001499556.2|  PREDICTED: tuftelin-interacting protein 11-like  62.8    6e-08   
ref|XP_009887465.1|  PREDICTED: tuftelin-interacting protein 11       62.8    6e-08   Charadrius vociferus
ref|XP_008272828.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    6e-08   Oryctolagus cuniculus [domestic rabbit]
ref|XP_009908031.1|  PREDICTED: tuftelin-interacting protein 11       62.8    6e-08   Picoides pubescens
ref|XP_008847245.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Nannospalax galili
ref|XP_003506733.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_010528677.1|  PREDICTED: septin and tuftelin-interacting p...  62.8    7e-08   Tarenaya hassleriana [spider flower]
emb|CDP06007.1|  unnamed protein product                              62.8    7e-08   Coffea canephora [robusta coffee]
ref|XP_010396785.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   
gb|KFV77367.1|  Tuftelin-interacting protein 11                       62.8    7e-08   Picoides pubescens
ref|XP_004893177.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    7e-08   
ref|XP_007627359.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   
ref|NP_001039495.2|  tuftelin-interacting protein 11                  62.8    7e-08   Bos taurus [bovine]
ref|XP_005489007.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Zonotrichia albicollis
ref|XP_010223913.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Tinamus guttatus
ref|XP_008492988.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Calypte anna
ref|XP_008632303.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Corvus brachyrhynchos
ref|XP_009090637.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Serinus canaria [canary]
ref|XP_005421487.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Geospiza fortis
ref|XP_007946133.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Orycteropus afer afer
sp|Q29RR5.2|TFP11_BOVIN  RecName: Full=Tuftelin-interacting prote...  62.8    7e-08   Bos taurus [bovine]
gb|AAI14059.1|  Tuftelin interacting protein 11                       62.8    7e-08   Bos taurus [bovine]
ref|XP_005078969.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Mesocricetus auratus [Syrian golden hamster]
gb|ABC69921.1|  STIP                                                  62.8    7e-08   Bos taurus [bovine]
dbj|BAE28260.1|  unnamed protein product                              62.8    7e-08   Mus musculus [mouse]
gb|AAH17682.1|  Tuftelin interacting protein 11                       62.8    7e-08   Mus musculus [mouse]
ref|XP_006147932.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  62.8    7e-08   Tupaia chinensis
ref|XP_002197903.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Taeniopygia guttata
ref|XP_005524389.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Pseudopodoces humilis [Tibetan ground-jay]
ref|NP_061253.2|  tuftelin-interacting protein 11                     62.8    7e-08   Mus musculus [mouse]
ref|XP_006055630.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.8    7e-08   Bubalus bubalis [domestic water buffalo]
ref|XP_006984175.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Peromyscus maniculatus bairdii
ref|XP_007181010.1|  PREDICTED: tuftelin-interacting protein 11       62.8    7e-08   Balaenoptera acutorostrata scammoni
ref|XP_011449175.1|  PREDICTED: tuftelin-interacting protein 11-like  62.8    7e-08   Crassostrea gigas
ref|XP_004283827.1|  PREDICTED: tuftelin-interacting protein 11       62.8    8e-08   
ref|XP_005344283.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.4    8e-08   Microtus ochrogaster [prairie voles]
ref|XP_005055056.1|  PREDICTED: tuftelin-interacting protein 11       62.4    8e-08   Ficedula albicollis
gb|EHB00444.1|  G patch domain-containing protein 2                   62.4    8e-08   Heterocephalus glaber [naked mole rat]
ref|XP_004880608.1|  PREDICTED: G patch domain-containing protein...  62.4    8e-08   
gb|KFO59493.1|  Tuftelin-interacting protein 11                       62.4    9e-08   Corvus brachyrhynchos
ref|XP_004592001.1|  PREDICTED: tuftelin-interacting protein 11       62.4    9e-08   Ochotona princeps [southern American pika]
ref|XP_011399724.1|  hypothetical protein F751_0708                   62.4    9e-08   Auxenochlorella protothecoides
gb|ABC69949.1|  STIP                                                  62.4    9e-08   Chlamydomonas reinhardtii
ref|XP_007461197.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.4    9e-08   Lipotes vexillifer [baiji]
emb|CDQ06825.1|  Protein Bm9097, isoform a                            62.0    9e-08   
ref|XP_010553814.1|  PREDICTED: septin and tuftelin-interacting p...  62.4    9e-08   Tarenaya hassleriana [spider flower]
ref|XP_006938603.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.4    1e-07   
ref|XP_006938601.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.4    1e-07   
ref|XP_007082566.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.4    1e-07   Panthera tigris altaica
ref|XP_007101983.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.4    1e-07   Physeter catodon
gb|KFU89033.1|  Tuftelin-interacting protein 11                       62.4    1e-07   Chaetura pelagica
ref|XP_007082564.1|  PREDICTED: tuftelin-interacting protein 11 i...  62.4    1e-07   
ref|XP_010827007.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  62.0    1e-07   Bison bison bison
gb|KDP39564.1|  hypothetical protein JCGZ_02584                       62.0    1e-07   Jatropha curcas
ref|XP_001702893.1|  predicted protein                                62.0    1e-07   Chlamydomonas reinhardtii
ref|XP_007525292.1|  PREDICTED: tuftelin-interacting protein 11       62.0    1e-07   Erinaceus europaeus [common hedgehog]
ref|XP_004330837.1|  PREDICTED: tuftelin-interacting protein 11-like  62.0    1e-07   
ref|XP_006836389.1|  hypothetical protein AMTR_s00092p00133670        62.0    1e-07   Amborella trichopoda
gb|ELR60645.1|  Tuftelin-interacting protein 11                       62.0    1e-07   Bos mutus
ref|XP_010670678.1|  PREDICTED: septin and tuftelin-interacting p...  62.0    1e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|KIZ04951.1|  Tuftelin-interacting protein 11                       61.6    1e-07   Monoraphidium neglectum
gb|ELK08915.1|  G patch domain-containing protein 2                   57.8    2e-07   Pteropus alecto
ref|XP_009995165.1|  PREDICTED: tuftelin-interacting protein 11       61.6    2e-07   Chaetura pelagica
ref|XP_004671000.1|  PREDICTED: tuftelin-interacting protein 11       61.6    2e-07   Jaculus jaculus
ref|XP_006848800.1|  hypothetical protein AMTR_s00026p00123370        61.6    2e-07   Amborella trichopoda
ref|XP_007029764.1|  GC-rich sequence DNA-binding factor-like pro...  61.6    2e-07   
ref|XP_008516973.1|  PREDICTED: tuftelin-interacting protein 11 i...  61.6    2e-07   Equus przewalskii [Przewalski horse]
ref|XP_002955122.1|  hypothetical protein VOLCADRAFT_65509            61.2    2e-07   Volvox carteri f. nagariensis
ref|XP_009801630.1|  PREDICTED: septin and tuftelin-interacting p...  61.2    2e-07   Nicotiana sylvestris
ref|XP_009616253.1|  PREDICTED: septin and tuftelin-interacting p...  61.2    2e-07   Nicotiana tomentosiformis
ref|XP_009616302.1|  PREDICTED: septin and tuftelin-interacting p...  61.2    2e-07   Nicotiana tomentosiformis
ref|XP_003380487.1|  tuftelin-interacting protein 11                  61.2    2e-07   Trichinella spiralis
ref|XP_009603610.1|  PREDICTED: septin and tuftelin-interacting p...  61.2    2e-07   Nicotiana tomentosiformis
ref|XP_002506795.1|  hypothetical protein MICPUN_113307               61.2    2e-07   Micromonas commoda
emb|CDS30657.1|  tuftelin interacting protein 11                      61.2    2e-07   Hymenolepis microstoma
ref|XP_004017498.1|  PREDICTED: tuftelin-interacting protein 11       60.8    3e-07   
ref|XP_006416746.1|  hypothetical protein EUTSA_v10006789mg           60.8    3e-07   Eutrema salsugineum [saltwater cress]
ref|XP_007908723.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.8    3e-07   Callorhinchus milii [Australian ghost shark]
ref|XP_003577528.1|  PREDICTED: septin and tuftelin-interacting p...  60.8    3e-07   Brachypodium distachyon [annual false brome]
ref|XP_010256250.1|  PREDICTED: septin and tuftelin-interacting p...  60.8    3e-07   Nelumbo nucifera [Indian lotus]
gb|EXX77934.1|  Spp382p                                               60.8    3e-07   Rhizophagus irregularis DAOM 197198w
ref|XP_006306528.1|  hypothetical protein CARUB_v10012542mg           60.5    4e-07   Capsella rubella
ref|XP_007908724.1|  PREDICTED: tuftelin-interacting protein 11 i...  60.5    4e-07   Callorhinchus milii [Australian ghost shark]
ref|XP_009350135.1|  PREDICTED: septin and tuftelin-interacting p...  60.5    4e-07   
ref|NP_173150.1|  GC-rich sequence DNA-binding factor-like protei...  60.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010597714.1|  PREDICTED: G patch domain-containing protein...  60.1    4e-07   Loxodonta africana [African bush elephant]
gb|ETE71201.1|  Tuftelin-interacting protein 11                       60.1    4e-07   Ophiophagus hannah
ref|XP_008192741.1|  PREDICTED: sip1/TFIP11 interacting protein i...  60.5    5e-07   Tribolium castaneum [rust-red flour beetle]
gb|KJB73095.1|  hypothetical protein B456_011G214400                  60.1    5e-07   Gossypium raimondii
ref|XP_001600459.1|  PREDICTED: tuftelin-interacting protein 11       60.1    5e-07   
emb|CEP17389.1|  hypothetical protein                                 60.5    5e-07   Parasitella parasitica
ref|XP_008548434.1|  PREDICTED: tuftelin-interacting protein 11       60.1    5e-07   Microplitis demolitor
emb|CDI97359.1|  tuftelin interacting protein 11                      60.1    5e-07   
ref|XP_006890634.1|  PREDICTED: G patch domain-containing protein...  60.1    5e-07   
ref|XP_009350134.1|  PREDICTED: septin and tuftelin-interacting p...  60.1    5e-07   
ref|XP_002949572.1|  hypothetical protein VOLCADRAFT_89953            60.1    5e-07   
ref|XP_002890202.1|  D111/G-patch domain-containing protein           60.1    5e-07   
ref|XP_007151865.1|  hypothetical protein PHAVU_004G082100g           60.1    6e-07   
ref|NP_001073624.1|  Sip1/TFIP11 interacting protein                  60.1    6e-07   
gb|EUB61106.1|  Tuftelin-interacting protein                          60.1    6e-07   
ref|XP_008218613.1|  PREDICTED: tuftelin-interacting protein 11-like  60.1    6e-07   
ref|XP_010065638.1|  PREDICTED: septin and tuftelin-interacting p...  60.1    6e-07   
ref|XP_007443812.1|  PREDICTED: tuftelin-interacting protein 11       60.1    6e-07   
ref|XP_007227462.1|  hypothetical protein PRUPE_ppa004892mg           59.7    6e-07   
emb|CDS21638.1|  tuftelin interacting protein 11                      60.1    6e-07   
ref|XP_005104240.1|  PREDICTED: tuftelin-interacting protein 11-like  59.7    7e-07   
ref|XP_008220637.1|  PREDICTED: zinc finger CCCH domain-containin...  59.7    7e-07   
ref|XP_004291980.1|  PREDICTED: zinc finger CCCH domain-containin...  59.7    7e-07   
gb|EXX77932.1|  Spp382p                                               59.7    8e-07   
gb|EXX77931.1|  Spp382p                                               59.7    8e-07   
ref|XP_001419174.1|  predicted protein                                58.5    8e-07   
ref|XP_004751526.1|  PREDICTED: G patch domain-containing protein 2   59.3    8e-07   
gb|EHH50537.1|  hypothetical protein EGM_01387                        59.3    8e-07   
gb|KDR14564.1|  Tuftelin-interacting protein 11                       59.7    8e-07   
emb|CDX81801.1|  BnaC08g38000D                                        59.7    8e-07   
gb|EHH15544.1|  hypothetical protein EGK_01651                        59.3    8e-07   
ref|XP_008378967.1|  PREDICTED: tuftelin-interacting protein 11-like  59.7    8e-07   
ref|XP_007211094.1|  hypothetical protein PRUPE_ppa001175mg           59.7    8e-07   
ref|XP_009355402.1|  PREDICTED: septin and tuftelin-interacting p...  59.7    9e-07   
ref|XP_006007268.1|  PREDICTED: tuftelin-interacting protein 11       59.3    9e-07   
ref|XP_005959627.1|  PREDICTED: tuftelin-interacting protein 11-l...  58.5    9e-07   
ref|XP_007986612.1|  PREDICTED: G patch domain-containing protein...  59.3    9e-07   
ref|XP_005540923.1|  PREDICTED: G patch domain-containing protein...  59.3    9e-07   
emb|CDY21767.1|  BnaA09g45180D                                        59.3    9e-07   
ref|XP_005540921.1|  PREDICTED: G patch domain-containing protein...  59.3    9e-07   
ref|XP_010361517.1|  PREDICTED: G patch domain-containing protein...  59.3    1e-06   
ref|XP_007986613.1|  PREDICTED: G patch domain-containing protein...  59.3    1e-06   
ref|XP_003893154.1|  PREDICTED: G patch domain-containing protein...  59.3    1e-06   
ref|XP_005540922.1|  PREDICTED: G patch domain-containing protein...  59.3    1e-06   
ref|NP_001091840.1|  septin and tuftelin interacting protein          59.3    1e-06   
ref|XP_009117727.1|  PREDICTED: septin and tuftelin-interacting p...  59.3    1e-06   
gb|KFK43898.1|  hypothetical protein AALP_AA1G188300                  59.3    1e-06   
ref|XP_010662048.1|  PREDICTED: septin and tuftelin-interacting p...  59.3    1e-06   
gb|ELW66488.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
ref|XP_007225316.1|  hypothetical protein PRUPE_ppa001171mg           59.3    1e-06   
ref|XP_004415667.1|  PREDICTED: G patch domain-containing protein 2   58.9    1e-06   
ref|XP_005879952.1|  PREDICTED: G patch domain-containing protein...  58.9    1e-06   
ref|XP_010692950.1|  PREDICTED: zinc finger CCCH domain-containin...  58.9    1e-06   
ref|XP_005540924.1|  PREDICTED: G patch domain-containing protein...  58.9    1e-06   
ref|XP_003080235.1|  Tuftelin-interacting protein TIP39, contains...  57.8    1e-06   
gb|EMS50756.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
ref|XP_006761403.1|  PREDICTED: G patch domain-containing protein 2   58.9    1e-06   
gb|KFP23981.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
gb|ELK32169.1|  G patch domain-containing protein 2                   58.9    1e-06   
ref|XP_010208491.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
ref|XP_009063581.1|  hypothetical protein LOTGIDRAFT_221309           58.9    1e-06   
ref|XP_004685296.1|  PREDICTED: G patch domain-containing protein 2   58.9    1e-06   
dbj|BAK01621.1|  predicted protein                                    58.9    1e-06   
ref|XP_007442990.1|  PREDICTED: zinc finger CCCH-type with G patc...  57.4    1e-06   
gb|EPQ16193.1|  G patch domain-containing protein 2                   58.9    1e-06   
gb|KDO59352.1|  hypothetical protein CISIN_1g043289mg                 58.9    1e-06   
ref|XP_009511274.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
gb|KFO95848.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
ref|XP_009707726.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
ref|XP_009877288.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
gb|KFM09886.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
ref|XP_009490572.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
ref|XP_008683891.1|  PREDICTED: G patch domain-containing protein...  58.5    1e-06   
ref|XP_010459271.1|  PREDICTED: septin and tuftelin-interacting p...  58.9    1e-06   
ref|XP_009809419.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
gb|KFV01223.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
gb|KFW83342.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
ref|XP_010476842.1|  PREDICTED: septin and tuftelin-interacting p...  58.9    1e-06   
ref|XP_009957952.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  58.9    1e-06   
ref|XP_010176320.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
gb|KFR13925.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
gb|KFR00697.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
ref|XP_002926699.1|  PREDICTED: G patch domain-containing protein...  58.5    1e-06   
gb|KFV72048.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
ref|XP_010294372.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
ref|XP_001172096.1|  PREDICTED: G patch domain-containing protein...  58.5    1e-06   
gb|ELW55478.1|  G patch domain-containing protein 2                   55.1    1e-06   
ref|XP_009359150.1|  PREDICTED: zinc finger CCCH domain-containin...  58.5    1e-06   
gb|KFP95623.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
gb|KFP35899.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
ref|XP_009936877.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
ref|XP_008925041.1|  PREDICTED: tuftelin-interacting protein 11       58.9    1e-06   
gb|EMT28946.1|  Tuftelin-interacting protein 11                       58.9    1e-06   
ref|XP_008683889.1|  PREDICTED: G patch domain-containing protein...  58.5    1e-06   
ref|XP_001757427.1|  predicted protein                                58.5    1e-06   
gb|KFZ55957.1|  Tuftelin-interacting protein 11                       58.9    2e-06   
ref|XP_009983332.1|  PREDICTED: tuftelin-interacting protein 11       58.9    2e-06   
gb|KFP12550.1|  Tuftelin-interacting protein 11                       58.9    2e-06   
ref|XP_011232417.1|  PREDICTED: G patch domain-containing protein...  58.5    2e-06   
ref|XP_008965018.1|  PREDICTED: G patch domain-containing protein...  58.5    2e-06   
ref|XP_009571985.1|  PREDICTED: tuftelin-interacting protein 11       58.9    2e-06   
gb|KFQ43028.1|  Tuftelin-interacting protein 11                       58.9    2e-06   
gb|KFQ79462.1|  Tuftelin-interacting protein 11                       58.9    2e-06   
gb|KII63443.1|  Tuftelin-interacting protein 11                       58.9    2e-06   
gb|KFQ35436.1|  Tuftelin-interacting protein 11                       58.9    2e-06   
ref|XP_009359084.1|  PREDICTED: zinc finger CCCH domain-containin...  58.5    2e-06   
ref|XP_009965680.1|  PREDICTED: tuftelin-interacting protein 11       58.9    2e-06   
ref|XP_010306276.1|  PREDICTED: tuftelin-interacting protein 11       58.9    2e-06   
gb|EOB05036.1|  Tuftelin-interacting protein 11                       58.5    2e-06   
ref|XP_010131846.1|  PREDICTED: tuftelin-interacting protein 11       58.9    2e-06   
gb|KFW62564.1|  Tuftelin-interacting protein 11                       58.9    2e-06   
gb|EHJ75286.1|  septin and tuftelin interacting protein               58.9    2e-06   
emb|CDM81682.1|  unnamed protein product                              58.9    2e-06   
gb|KGL96598.1|  Tuftelin-interacting protein 11                       58.5    2e-06   
ref|XP_008944614.1|  PREDICTED: tuftelin-interacting protein 11       58.5    2e-06   
ref|XP_008148048.1|  PREDICTED: G patch domain-containing protein 2   58.5    2e-06   
ref|XP_008334938.1|  PREDICTED: tuftelin-interacting protein 11 i...  58.9    2e-06   
gb|KGL84782.1|  Tuftelin-interacting protein 11                       58.5    2e-06   
gb|KFQ48373.1|  Tuftelin-interacting protein 11                       58.5    2e-06   
ref|XP_009439775.1|  PREDICTED: G patch domain-containing protein...  58.5    2e-06   
ref|XP_002325453.2|  D111/G-patch domain-containing family protein    58.5    2e-06   
ref|NP_060510.1|  G patch domain-containing protein 2 isoform 1       58.5    2e-06   
ref|XP_005014621.1|  PREDICTED: tuftelin-interacting protein 11       58.5    2e-06   
ref|XP_003265143.1|  PREDICTED: G patch domain-containing protein 2   58.5    2e-06   
ref|XP_005889904.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  58.5    2e-06   
gb|KHN00685.1|  Tuftelin-interacting protein 11                       58.5    2e-06   
ref|XP_005691760.1|  PREDICTED: tuftelin-interacting protein 11       58.5    2e-06   
ref|XP_011051117.1|  PREDICTED: tuftelin-interacting protein 11       58.5    2e-06   
gb|ACR37118.1|  unknown                                               53.9    2e-06   
ref|XP_008334939.1|  PREDICTED: tuftelin-interacting protein 11 i...  58.5    2e-06   
ref|XP_010270966.1|  PREDICTED: septin and tuftelin-interacting p...  58.5    2e-06   
ref|XP_002319771.1|  D111/G-patch domain-containing family protein    58.5    2e-06   
ref|XP_010972318.1|  PREDICTED: G patch domain-containing protein...  58.2    2e-06   
ref|XP_001659237.1|  AAEL008437-PA                                    58.5    2e-06   
gb|KHN32772.1|  Tuftelin-interacting protein 11                       58.5    2e-06   
emb|CAG08558.1|  unnamed protein product                              58.5    2e-06   
ref|XP_006203714.1|  PREDICTED: G patch domain-containing protein 2   58.2    2e-06   
ref|XP_003548069.1|  PREDICTED: tuftelin-interacting protein 11-l...  58.5    2e-06   
ref|XP_006188221.1|  PREDICTED: G patch domain-containing protein 2   58.2    2e-06   
gb|KFH45698.1|  G-patch domain-containing protein -like protein       58.2    2e-06   
emb|CEF98642.1|  G-patch domain                                       58.2    2e-06   
ref|XP_010498050.1|  PREDICTED: septin and tuftelin-interacting p...  58.2    2e-06   
ref|XP_008377483.1|  PREDICTED: zinc finger CCCH domain-containin...  58.2    2e-06   
ref|XP_003930395.1|  PREDICTED: G patch domain-containing protein...  58.2    2e-06   
ref|XP_011237225.1|  PREDICTED: G patch domain-containing protein...  57.4    2e-06   
ref|XP_006094376.1|  PREDICTED: G patch domain-containing protein 2   55.5    2e-06   
ref|XP_008608077.1|  hypothetical protein SDRG_04193                  58.2    2e-06   
ref|XP_004510195.1|  PREDICTED: tuftelin-interacting protein 11-like  58.2    2e-06   
ref|XP_011044415.1|  PREDICTED: septin and tuftelin-interacting p...  58.2    2e-06   
ref|XP_006916287.1|  PREDICTED: G patch domain-containing protein...  57.8    3e-06   
dbj|BAE37777.1|  unnamed protein product                              55.8    3e-06   
ref|XP_011140063.1|  PREDICTED: tuftelin-interacting protein 11       58.2    3e-06   
emb|CBN76810.1|  conserved unknown protein                            57.8    3e-06   
dbj|BAC38928.1|  unnamed protein product                              57.4    3e-06   
ref|XP_008117816.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  57.8    3e-06   
ref|XP_011014808.1|  PREDICTED: septin and tuftelin-interacting p...  58.2    3e-06   
gb|ERL85681.1|  hypothetical protein D910_03097                       58.2    3e-06   
gb|ABC69927.1|  STIP                                                  58.2    3e-06   
gb|ABC69939.1|  STIP                                                  58.2    3e-06   
ref|XP_001952828.1|  PREDICTED: zinc finger CCCH-type with G patc...  57.8    3e-06   
gb|EAZ21226.1|  hypothetical protein OsJ_36879                        57.8    3e-06   
ref|NP_001067277.1|  Os12g0615800                                     57.8    3e-06   
ref|XP_007471923.1|  PREDICTED: G patch domain-containing protein 2   57.8    3e-06   
gb|KDO27238.1|  hypothetical protein SPRG_07487                       57.8    3e-06   
ref|NP_001091095.1|  tuftelin interacting protein 11                  57.8    3e-06   
ref|XP_003705694.1|  PREDICTED: tuftelin-interacting protein 11-like  57.8    3e-06   
ref|XP_006352537.1|  PREDICTED: tuftelin-interacting protein 11-like  57.8    3e-06   
ref|XP_007250033.1|  PREDICTED: tuftelin-interacting protein 11-like  57.8    3e-06   
dbj|BAC26744.1|  unnamed protein product                              57.8    3e-06   
ref|NP_080643.4|  G patch domain-containing protein 2                 57.8    3e-06   
ref|XP_006943032.1|  PREDICTED: G patch domain-containing protein...  57.8    3e-06   
emb|CBK20550.2|  unnamed protein product                              53.9    3e-06   
ref|XP_006497258.1|  PREDICTED: G patch domain-containing protein...  57.4    3e-06   
ref|XP_005804061.1|  PREDICTED: tuftelin-interacting protein 11-like  57.8    3e-06   
gb|EDL13047.1|  G patch domain containing 2, isoform CRA_c            57.4    4e-06   
gb|AAH54810.1|  G patch domain containing 2                           57.4    4e-06   
gb|EAY83899.1|  hypothetical protein OsI_39121                        57.8    4e-06   
ref|XP_004613109.1|  PREDICTED: G patch domain-containing protein 2   57.4    4e-06   
ref|XP_005374769.1|  PREDICTED: G patch domain-containing protein...  57.4    4e-06   
ref|XP_005374768.1|  PREDICTED: G patch domain-containing protein...  57.4    4e-06   
dbj|BAC35520.1|  unnamed protein product                              57.4    4e-06   
ref|XP_006497260.1|  PREDICTED: G patch domain-containing protein...  57.4    4e-06   
ref|XP_007514715.1|  predicted protein                                57.4    4e-06   
ref|XP_005940191.1|  PREDICTED: tuftelin-interacting protein 11-l...  57.4    4e-06   
ref|XP_004544557.1|  PREDICTED: tuftelin-interacting protein 11-like  57.4    5e-06   
ref|XP_011348865.1|  PREDICTED: tuftelin-interacting protein 11       57.4    5e-06   
ref|XP_006784241.1|  PREDICTED: tuftelin-interacting protein 11-l...  57.4    5e-06   
ref|XP_006784240.1|  PREDICTED: tuftelin-interacting protein 11-l...  57.4    5e-06   
ref|XP_002430896.1|  Tuftelin-interacting protein, putative           57.4    5e-06   
ref|XP_002508044.1|  predicted protein                                57.0    5e-06   
ref|XP_010903424.1|  PREDICTED: tuftelin-interacting protein 11-like  57.4    5e-06   
ref|XP_011188833.1|  PREDICTED: septin-interacting protein 1          57.0    5e-06   
dbj|GAN05273.1|  TFP11-domain-containing protein                      57.0    5e-06   
gb|EPB85923.1|  hypothetical protein HMPREF1544_07255                 57.0    5e-06   
ref|XP_005722307.1|  PREDICTED: tuftelin-interacting protein 11-l...  57.0    6e-06   
ref|XP_007126186.1|  PREDICTED: G patch domain-containing protein...  57.0    6e-06   
ref|XP_007126185.1|  PREDICTED: G patch domain-containing protein...  57.0    6e-06   
ref|XP_002880634.1|  zinc finger (CCCH-type) family protein           57.0    6e-06   
gb|EFN69166.1|  Tuftelin-interacting protein 11                       57.0    6e-06   
ref|XP_011255037.1|  PREDICTED: tuftelin-interacting protein 11       57.0    6e-06   
ref|XP_007173585.1|  PREDICTED: G patch domain-containing protein 2   57.0    6e-06   
ref|XP_011501452.1|  PREDICTED: tuftelin-interacting protein 11       57.0    6e-06   
ref|XP_010894625.1|  PREDICTED: LOW QUALITY PROTEIN: tuftelin-int...  57.0    6e-06   
emb|CEG01704.1|  Diphthamide synthesis, eukaryotic DPH1/archaeal ...  57.0    7e-06   
gb|EPQ19912.1|  Tuftelin-interacting protein 11                       56.6    7e-06   
ref|XP_011364422.1|  PREDICTED: G patch domain-containing protein...  56.6    7e-06   
gb|KEH18055.1|  tuftelin-interacting protein                          57.0    7e-06   
ref|XP_004271079.1|  PREDICTED: G patch domain-containing protein 2   56.6    7e-06   
ref|XP_002163283.2|  PREDICTED: tuftelin-interacting protein 11-like  57.0    7e-06   
ref|XP_011364423.1|  PREDICTED: G patch domain-containing protein...  56.6    7e-06   
ref|XP_004533235.1|  PREDICTED: septin-interacting protein 1-like...  57.0    7e-06   
ref|XP_011197264.1|  PREDICTED: septin-interacting protein 1          57.0    7e-06   
ref|XP_011364424.1|  PREDICTED: G patch domain-containing protein...  56.6    7e-06   
ref|XP_009658212.1|  hypothetical protein VDAG_10214                  57.0    7e-06   
ref|XP_001963018.1|  GF15731                                          56.6    7e-06   
gb|ABC69929.1|  STIP                                                  56.6    7e-06   
ref|XP_004314146.1|  PREDICTED: G patch domain-containing protein 2   56.6    7e-06   
ref|XP_008467794.1|  PREDICTED: tuftelin-interacting protein 11       56.6    7e-06   
gb|EFB16756.1|  hypothetical protein PANDA_016389                     53.5    8e-06   
ref|XP_005885804.1|  PREDICTED: tuftelin-interacting protein 11-like  56.6    8e-06   
ref|NP_180056.1|  zinc finger CCCH domain-containing protein 22       56.2    8e-06   
ref|XP_011506183.1|  PREDICTED: zinc finger CCCH-type with G patc...  56.2    8e-06   
ref|XP_007641342.1|  PREDICTED: G patch domain-containing protein...  56.2    8e-06   
gb|ERE73020.1|  G patch domain-containing protein 2                   56.2    8e-06   
ref|XP_001773432.1|  predicted protein                                56.6    8e-06   
ref|XP_007950687.1|  PREDICTED: G patch domain-containing protein 2   56.2    9e-06   
ref|NP_001002721.1|  tuftelin-interacting protein 11                  56.6    9e-06   
ref|XP_009295001.1|  PREDICTED: tuftelin-interacting protein 11 i...  56.6    9e-06   



>ref|XP_009595430.1| PREDICTED: uncharacterized protein LOC104091732 [Nicotiana tomentosiformis]
Length=786

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 108/146 (74%), Gaps = 9/146 (6%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HTTG GSKMM KMG+  G GLGKDGQGI+EPI+  QRPKALGLGA++PETS+ +  K  
Sbjct  647  MHTTGFGSKMMAKMGYQEGRGLGKDGQGISEPIEARQRPKALGLGAEIPETSSGSAKKDF  706

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             PKS     ++ +RS KS +K S          GF  FE HTKGFGSKMMAKMGFVEGTG
Sbjct  707  LPKSAVRSAEVVSRSGKSSRKESSI--------GFAGFEMHTKGFGSKMMAKMGFVEGTG  758

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGK+SQGI  P++A RRPKSQGLGAK
Sbjct  759  LGKNSQGIVNPLVAVRRPKSQGLGAK  784


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            +G+FE HT GFGSKMMAKMG+ EG GLGKD QGI+ PI A +RPK+ GLGA+
Sbjct  642  YGAFEMHTTGFGSKMMAKMGYQEGRGLGKDGQGISEPIEARQRPKALGLGAE  693


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  625
            +HT G GSKMM KMGF  G GLGK+ QGI  P+   +RPK+ GLGA V
Sbjct  738  MHTKGFGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVRRPKSQGLGAKV  785



>ref|XP_009769069.1| PREDICTED: uncharacterized protein LOC104219993 [Nicotiana sylvestris]
Length=787

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 107/146 (73%), Gaps = 9/146 (6%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HTTG GSKMM KMG+  G GLGKDGQGI+EPI+  QRPKALGLGA++PETS+ +  K  
Sbjct  648  MHTTGFGSKMMAKMGYEEGRGLGKDGQGISEPIEARQRPKALGLGAEIPETSSGSAKKDF  707

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             PKS     ++  RS KS +K S          GF  FE HTKGFGSKMMAKMGFVEGTG
Sbjct  708  LPKSAVRSAEVVGRSAKSSRKESSI--------GFAGFEMHTKGFGSKMMAKMGFVEGTG  759

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGK+SQGI  P++A RRPKSQGLGAK
Sbjct  760  LGKNSQGIVNPLVAVRRPKSQGLGAK  785


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            +G+FE HT GFGSKMMAKMG+ EG GLGKD QGI+ PI A +RPK+ GLGA+
Sbjct  643  YGAFEMHTTGFGSKMMAKMGYEEGRGLGKDGQGISEPIEARQRPKALGLGAE  694


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  625
            +HT G GSKMM KMGF  G GLGK+ QGI  P+   +RPK+ GLGA V
Sbjct  739  MHTKGFGSKMMAKMGFVEGTGLGKNSQGIVNPLVAVRRPKSQGLGAKV  786



>ref|XP_011084036.1| PREDICTED: uncharacterized protein LOC105166393 [Sesamum indicum]
Length=762

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 103/145 (71%), Gaps = 10/145 (7%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HTTG GSKMM KMG+  G GLGKDGQG+A+PI+VSQRPK+LGLGA+VPE S  +     
Sbjct  625  IHTTGFGSKMMAKMGYIEGTGLGKDGQGMAQPIEVSQRPKSLGLGAEVPEASGKSSITQS  684

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P S G         R +   G+  + A+  +  FGSFE HTKGFGSKMMAKMGFVEG G
Sbjct  685  RPNSTG---------RSAKSSGTNVKSAKSDNHKFGSFEKHTKGFGSKMMAKMGFVEGMG  735

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKDSQGI  P+LA RRPKS GLGA
Sbjct  736  LGKDSQGIVNPLLAVRRPKSMGLGA  760


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            + +FE HT GFGSKMMAKMG++EGTGLGKD QG+  PI  ++RPKS GLGA+
Sbjct  620  YKAFEIHTTGFGSKMMAKMGYIEGTGLGKDGQGMAQPIEVSQRPKSLGLGAE  671



>ref|XP_010323258.1| PREDICTED: uncharacterized protein LOC101249097 [Solanum lycopersicum]
Length=789

 Score =   154 bits (389),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 104/147 (71%), Gaps = 10/147 (7%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANE-TKT  592
            +HTTG GSK+M KMG+  G GLGKDGQGI+EPI+  QRPKALGLGA++PETS  +   K 
Sbjct  650  MHTTGIGSKLMAKMGYQEGRGLGKDGQGISEPIEARQRPKALGLGAEIPETSIRSSGKKD  709

Query  591  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  412
              PKS G G ++          GS     +  S GF  FE HTKGFGSK+MAKMGFVEG 
Sbjct  710  SLPKSSGRGAEV--------VGGSGKSIRKESSVGFAGFERHTKGFGSKIMAKMGFVEGM  761

Query  411  GLGKDSQGITAPILATRRPKSQGLGAK  331
            GLG+ SQGIT P++A RRPKSQGLGAK
Sbjct  762  GLGRSSQGITNPLVAVRRPKSQGLGAK  788


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            +G+FE HT G GSK+MAKMG+ EG GLGKD QGI+ PI A +RPK+ GLGA+
Sbjct  645  YGAFEMHTTGIGSKLMAKMGYQEGRGLGKDGQGISEPIEARQRPKALGLGAE  696



>emb|CDP10517.1| unnamed protein product [Coffea canephora]
Length=770

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 102/146 (70%), Gaps = 12/146 (8%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            LHT G GSKMM +MG+  G GLGKDGQG+AEPI+V QRPK+LGLGA++ ETS     K  
Sbjct  633  LHTRGFGSKMMARMGYVEGCGLGKDGQGMAEPIEVLQRPKSLGLGAEIAETSDKLAKKEC  692

Query  588  TPKSVGFGEDLP-TRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  412
             P   G   +LP TR++   K+ +Q          F SFE HTKGFGSK+MAKMGFVEG 
Sbjct  693  RPTVSGLSSELPGTRNKLGKKESAQ----------FASFERHTKGFGSKVMAKMGFVEGM  742

Query  411  GLGKDSQGITAPILATRRPKSQGLGA  334
            GLGKDSQG+  P++  RRPKS+GLGA
Sbjct  743  GLGKDSQGMIRPLVVARRPKSRGLGA  768


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            +G+FE HT+GFGSKMMA+MG+VEG GLGKD QG+  PI   +RPKS GLGA+
Sbjct  628  YGAFELHTRGFGSKMMARMGYVEGCGLGKDGQGMAEPIEVLQRPKSLGLGAE  679



>ref|XP_006359539.1| PREDICTED: uncharacterized protein LOC102594159 [Solanum tuberosum]
Length=790

 Score =   151 bits (381),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 104/147 (71%), Gaps = 10/147 (7%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HTTG GSK+M KMG+  G GLGKDGQGI+EPI+  QRPKALGLGA++ ETS+ +  K  
Sbjct  651  MHTTGIGSKLMAKMGYQEGRGLGKDGQGISEPIEARQRPKALGLGAEILETSSRSSAKKD  710

Query  588  T-PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  412
            + PKS   G ++          GS     +  S GF  FE HTKGFGSKMMAKMGFVEG 
Sbjct  711  SLPKSSVRGAEV--------VGGSGKSIRKESSVGFAGFERHTKGFGSKMMAKMGFVEGM  762

Query  411  GLGKDSQGITAPILATRRPKSQGLGAK  331
            GLG+ SQGIT P++A RRPKSQGLGAK
Sbjct  763  GLGRSSQGITNPLVAVRRPKSQGLGAK  789


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            +G+FE HT G GSK+MAKMG+ EG GLGKD QGI+ PI A +RPK+ GLGA+
Sbjct  646  YGAFEMHTTGIGSKLMAKMGYQEGRGLGKDGQGISEPIEARQRPKALGLGAE  697



>ref|XP_003549703.1| PREDICTED: uncharacterized protein LOC100781443 [Glycine max]
 gb|KHN18591.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Glycine soja]
Length=767

 Score =   140 bits (352),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 98/148 (66%), Gaps = 13/148 (9%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA---NETK  595
            HTTG GSKMM KMG+T G GLGK+GQG+A+PI+V QRPK+LGLG +    S     N++ 
Sbjct  628  HTTGFGSKMMAKMGYTEGAGLGKNGQGMAQPIEVIQRPKSLGLGVEFYNNSAEPARNKSS  687

Query  594  TPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEG  415
                KS+G G +      +  +  S            GSFE HTKGFGSKMMAKMGFVEG
Sbjct  688  RVGAKSLGLGVEFSNSPAEPARNKSSK---------VGSFEKHTKGFGSKMMAKMGFVEG  738

Query  414  TGLGKDSQGITAPILATRRPKSQGLGAK  331
             GLG++SQGIT P+ A R PKS+GLGAK
Sbjct  739  NGLGRESQGITTPLSAVRLPKSRGLGAK  766


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
              GSFE HT GFGSKMMAKMG+ EG GLGK+ QG+  PI   +RPKS GLG +
Sbjct  621  NIGSFEEHTTGFGSKMMAKMGYTEGAGLGKNGQGMAQPIEVIQRPKSLGLGVE  673



>ref|XP_003542623.1| PREDICTED: uncharacterized protein LOC100802615 [Glycine max]
 gb|KHN22105.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Glycine soja]
Length=762

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 100/148 (68%), Gaps = 13/148 (9%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA---NETK  595
            HTTG GSKMM KMG+T G GLGK+GQG+A+PI+V QRPK+LGLG +    S     N++ 
Sbjct  623  HTTGFGSKMMAKMGYTEGAGLGKNGQGMAQPIEVIQRPKSLGLGVEFSNNSAEPARNKSS  682

Query  594  TPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEG  415
                KS+G G +            S  + A   S   G+FE HTKGFGSKMMAKMGFVEG
Sbjct  683  RVGAKSLGVGVEFSN---------SPAKPAPNKSSNVGAFEKHTKGFGSKMMAKMGFVEG  733

Query  414  TGLGKDSQGITAPILATRRPKSQGLGAK  331
            TGLG++SQGIT P+ A R PKS+GLGAK
Sbjct  734  TGLGRESQGITTPLSAVRLPKSRGLGAK  761


 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
              GSFE HT GFGSKMMAKMG+ EG GLGK+ QG+  PI   +RPKS GLG +
Sbjct  616  NIGSFEEHTTGFGSKMMAKMGYTEGAGLGKNGQGMAQPIEVIQRPKSLGLGVE  668



>gb|EEC83275.1| hypothetical protein OsI_28629 [Oryza sativa Indica Group]
Length=519

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 94/146 (64%), Gaps = 15/146 (10%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  G GLGKDGQG+ +PIQ  QRPK+LGLG +    + A + ++ 
Sbjct  385  MHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIQPIQRPKSLGLGVEFDSEAEAIKARSE  444

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P         P R+ +  + G           G GSFE HTKGFGSKMMA+MGFVEG+G
Sbjct  445  PPTK---ARSEPWRNLRKVEIG-----------GVGSFERHTKGFGSKMMARMGFVEGSG  490

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKD QGI  P+ A RRPKS GLGAK
Sbjct  491  LGKDGQGIVNPLTAVRRPKSMGLGAK  516


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QG+  PI   +RPKS GLG +
Sbjct  380  LGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIQPIQRPKSLGLGVE  431



>gb|EEE68404.1| hypothetical protein OsJ_26758 [Oryza sativa Japonica Group]
Length=640

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 94/146 (64%), Gaps = 15/146 (10%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  G GLGKDGQG+ +PIQ  QRPK+LGLG +    + A + ++ 
Sbjct  506  MHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIQPIQRPKSLGLGVEFDSEAEAIKARSE  565

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P         P R+ +  + G           G GSFE HTKGFGSKMMA+MGFVEG+G
Sbjct  566  PPTK---ARSEPWRNLRKVEIG-----------GVGSFERHTKGFGSKMMARMGFVEGSG  611

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKD QGI  P+ A RRPKS GLGAK
Sbjct  612  LGKDGQGIVNPLTAVRRPKSMGLGAK  637


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QG+  PI   +RPKS GLG +
Sbjct  501  LGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIQPIQRPKSLGLGVE  552



>dbj|BAJ84968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 89/144 (62%), Gaps = 8/144 (6%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  586
            HT G GSKMM KMGF  G GLGKDGQGI +P+Q  QRPK+LGLG +      A ++++  
Sbjct  88   HTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGVEFDSELEAAKSRSEP  147

Query  585  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  406
            P +       P R     +   +           G+FE HTKGFGSKMM KMGFV G+GL
Sbjct  148  PAN-------PRRELGRSRSEPRRNTRPPEMYDCGTFERHTKGFGSKMMVKMGFVPGSGL  200

Query  405  GKDSQGITAPILATRRPKSQGLGA  334
            GKD QGI  P+ A RRPKS+GLGA
Sbjct  201  GKDGQGIVNPLTAVRRPKSRGLGA  224


 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QGI  P+ A +RPKS GLG +
Sbjct  82   LGTFETHTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGVE  133



>ref|XP_006660014.1| PREDICTED: uncharacterized protein LOC102712285, partial [Oryza 
brachyantha]
Length=678

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 94/147 (64%), Gaps = 17/147 (12%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT-  592
            +HT G GSKMM KMGF  G GLGKDGQG+ +PI+  QRPK+LGLG      + A + ++ 
Sbjct  544  MHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIETVQRPKSLGLGVVFDSEAEAIKARSE  603

Query  591  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  412
            PT K+       P R  +  +             G GSFE HTKGFGSKMMA+MGFVEG+
Sbjct  604  PTAKA----RSEPKRFSRKVEMS-----------GVGSFERHTKGFGSKMMARMGFVEGS  648

Query  411  GLGKDSQGITAPILATRRPKSQGLGAK  331
            GLGKD QGI  P+ A RRPKS GLGAK
Sbjct  649  GLGKDGQGIVTPLTAVRRPKSMGLGAK  675


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QG+  PI   +RPKS GLG 
Sbjct  539  LGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIETVQRPKSLGLGV  589



>ref|NP_001061456.1| Os08g0288500 [Oryza sativa Japonica Group]
 dbj|BAD01347.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD01361.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23370.1| Os08g0288500 [Oryza sativa Japonica Group]
Length=742

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 94/146 (64%), Gaps = 15/146 (10%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  G GLGKDGQG+ +PIQ  QRPK+LGLG +    + A + ++ 
Sbjct  608  MHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIQPIQRPKSLGLGVEFDSEAEAIKARSE  667

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P         P R+ +  + G           G GSFE HTKGFGSKMMA+MGFVEG+G
Sbjct  668  PPTK---ARSEPWRNLRKVEIG-----------GVGSFERHTKGFGSKMMARMGFVEGSG  713

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKD QGI  P+ A RRPKS GLGAK
Sbjct  714  LGKDGQGIVNPLTAVRRPKSMGLGAK  739


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QG+  PI   +RPKS GLG +
Sbjct  603  LGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGMMQPIQPIQRPKSLGLGVE  654



>ref|XP_004973180.1| PREDICTED: uncharacterized protein LOC101758421 [Setaria italica]
Length=756

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 96/146 (66%), Gaps = 9/146 (6%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  G GLGKDGQGI +PIQ   RPK+LGLG +    + A + +T 
Sbjct  616  VHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAIHRPKSLGLGVEFNSEAEAIKARTE  675

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
              K+       P++ R   ++  +  +      G GSFE HTKGFGSKMMAKMGFV G+G
Sbjct  676  PMKA----RSEPSKVRPELRRNVRALETS----GVGSFERHTKGFGSKMMAKMGFVPGSG  727

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LG+D QGI  P+ A RRPKSQGLGAK
Sbjct  728  LGRDGQGIPTPLTAVRRPKSQGLGAK  753


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             GSFE HTKGFGSKMMAKMGF+EGTGLGKD QGI  PI A  RPKS GLG +
Sbjct  611  LGSFEVHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAIHRPKSLGLGVE  662



>ref|XP_010542083.1| PREDICTED: uncharacterized protein LOC104815398 [Tarenaya hassleriana]
Length=798

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 103/150 (69%), Gaps = 7/150 (5%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD----VPETSTANE  601
            +HT G GSKMM KMG+  G GLGKDG+G+A+PI+V QRPK+LGLG D    V E   ++ 
Sbjct  639  VHTKGFGSKMMAKMGYIEGAGLGKDGKGLAQPIEVVQRPKSLGLGLDFSPSVEENQPSSS  698

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
            + +   K    G+D   +  K     S+      G  GFG+FE HTKGFGS+MMAKMGFV
Sbjct  699  SGSGRRKGNSSGKD--PKHEKGVSGSSRSGGGGGGGKGFGAFEQHTKGFGSRMMAKMGFV  756

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            EGTGLG+DSQG+T P+ A RRPK++GLGA+
Sbjct  757  EGTGLGRDSQGMTNPLFAVRRPKARGLGAE  786


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             FG+FE HTKGFGSKMMAKMG++EG GLGKD +G+  PI   +RPKS GLG
Sbjct  633  NFGAFEVHTKGFGSKMMAKMGYIEGAGLGKDGKGLAQPIEVVQRPKSLGLG  683



>ref|XP_009358504.1| PREDICTED: uncharacterized protein LOC103949129 [Pyrus x bretschneideri]
 ref|XP_009358505.1| PREDICTED: uncharacterized protein LOC103949129 [Pyrus x bretschneideri]
Length=640

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  586
            LHT G GSKM+ KMG+  GGLGKDGQG+A PI+V QRPK+LGLG +    +     KTP 
Sbjct  507  LHTKGFGSKMLAKMGYIEGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSTPAEIPVGKTPP  566

Query  585  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  406
                    ++P + R   +      +        G FE HTKGFGSKMMAKMGFV G GL
Sbjct  567  ------ANNIPVKRRSQAQSSQTQSER------VGYFEKHTKGFGSKMMAKMGFVGGMGL  614

Query  405  GKDSQGITAPILATRRPKSQGLGA  334
            GKDSQGI  P+ A R PKS+GLGA
Sbjct  615  GKDSQGIVNPLAAVRLPKSRGLGA  638


 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +
Sbjct  502  YRSFELHTKGFGSKMLAKMGYIEG-GLGKDGQGMAAPIEVIQRPKSLGLGVE  552



>gb|EYU25294.1| hypothetical protein MIMGU_mgv1a003157mg [Erythranthe guttata]
Length=604

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 106/148 (72%), Gaps = 15/148 (10%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HTTG GSKM+ KMG+  GGGLGKDGQG+A+PI+V QRPK+LGLGA  PE S++ +  T 
Sbjct  462  MHTTGFGSKMLAKMGYVEGGGLGKDGQGVAKPIEVFQRPKSLGLGAVAPEASSSKQPTTN  521

Query  588  T---PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVE  418
                PKSV           +S   G++ + A+  +  FGSFE HTKGFGSKMMAKMGFVE
Sbjct  522  VKAQPKSV-----------RSKSCGTKAKPAKIENNNFGSFEKHTKGFGSKMMAKMGFVE  570

Query  417  GTGLGKDSQGITAPILATRRPKSQGLGA  334
            G GLGKD+QGI  P++A RRPKS GLGA
Sbjct  571  GAGLGKDAQGIINPLVAVRRPKSVGLGA  598


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  628
            HT G GSKMM KMGF  G GLGKD QGI  P+   +RPK++GLGA+
Sbjct  554  HTKGFGSKMMAKMGFVEGAGLGKDAQGIINPLVAVRRPKSVGLGAN  599


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            +G+FE HT GFGSKM+AKMG+VEG GLGKD QG+  PI   +RPKS GLGA
Sbjct  457  YGAFEMHTTGFGSKMLAKMGYVEGGGLGKDGQGVAKPIEVFQRPKSLGLGA  507



>ref|XP_009338424.1| PREDICTED: uncharacterized protein LOC103930775 [Pyrus x bretschneideri]
Length=762

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 91/144 (63%), Gaps = 13/144 (9%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  586
            LHT G GSKM+ KMG+  GGLGKDGQG+A PI+V QRPK+LGLG +             T
Sbjct  630  LHTKGFGSKMLAKMGYVEGGLGKDGQGMAAPIEVIQRPKSLGLGVEFS-----------T  678

Query  585  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  406
            P  +  G+  P  +    +  +Q  + Q    G+  FE HTKGFG KMMAKMGFV G GL
Sbjct  679  PVEIPVGKTPPANNIPVKRSQAQSSQTQSERVGY--FEKHTKGFGLKMMAKMGFVGGMGL  736

Query  405  GKDSQGITAPILATRRPKSQGLGA  334
            GKDSQGI  P+ + R PKS+GLGA
Sbjct  737  GKDSQGIVNPLASVRLPKSRGLGA  760


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 73/143 (51%), Gaps = 31/143 (22%)
 Frame = -2

Query  684  IAEPIQVSQRPKALGLGAD--VPETSTANETKTP----------------TPKSV-----  574
            + EP +   RP+ +G G D   PE+  ++E KTP                TP S      
Sbjct  539  VVEPGRDKNRPRKIGKGIDFKTPESKQSSERKTPKTSAKRGSGNMDSYANTPVSFVSSGV  598

Query  573  --GFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGK  400
                 E L   S ++ K     +  +     + SFE HTKGFGSKM+AKMG+VEG GLGK
Sbjct  599  MQSAAESLTVDSIEASKNKVAAESTE-----YRSFELHTKGFGSKMLAKMGYVEG-GLGK  652

Query  399  DSQGITAPILATRRPKSQGLGAK  331
            D QG+ API   +RPKS GLG +
Sbjct  653  DGQGMAAPIEVIQRPKSLGLGVE  675



>gb|EMT16376.1| Tuftelin-interacting protein 11 [Aegilops tauschii]
Length=779

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV-PETSTANETKTP  589
            HT G GSKMM KMGF  G GLGKDGQGI +P+Q  QRPK+LGLG +   E   A     P
Sbjct  631  HTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGVEFDSELEAAKARSEP  690

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
              K+         R     +   +           G+FE HTKGFGSKMM KMGFV G+G
Sbjct  691  PAKARPEPAANARRELSRSRSEPRRNTRPPEMYDCGTFERHTKGFGSKMMVKMGFVPGSG  750

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKD QGI  P+ A RRPKS+GLGA
Sbjct  751  LGKDGQGIVNPLTAVRRPKSRGLGA  775


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QGI  P+ A +RPKS GLG +
Sbjct  625  LGTFETHTKGFGSKMMAKMGFIEGTGLGKDGQGILQPVQAIQRPKSLGLGVE  676



>ref|NP_001152479.1| LOC100286119 [Zea mays]
 gb|ACG47812.1| G-patch domain containing protein [Zea mays]
 tpg|DAA46960.1| TPA: g-patch domain containing protein [Zea mays]
Length=733

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 86/146 (59%), Gaps = 16/146 (11%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  G GLGKDGQGI +PIQ   RPK+LGLG +    + A + +  
Sbjct  600  VHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAVHRPKSLGLGVEFDSVAEAIKARAE  659

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
              K +                  +       + G GSFE HTKGFGSKMM  MGFV G+G
Sbjct  660  PIKLIS---------------ELRRNVWAPETSGVGSFEKHTKGFGSKMMVNMGFVPGSG  704

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKD QGI  P+   RRPKS+GLGA+
Sbjct  705  LGKDGQGIATPLTGVRRPKSRGLGAE  730


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             GSFE HTKGFGSKMMAKMGF+EGTGLGKD QGI  PI A  RPKS GLG +
Sbjct  595  LGSFEVHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAVHRPKSLGLGVE  646



>ref|XP_010109666.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Morus notabilis]
 gb|EXC23988.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Morus notabilis]
Length=804

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 89/145 (61%), Gaps = 26/145 (18%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  586
            HT G GSKMM KMGF  G GLGKD QGI  PI+   RPK+LGLG +   +   ++T +  
Sbjct  684  HTKGFGSKMMAKMGFVEGKGLGKDSQGIVNPIK---RPKSLGLGVEF--SHIVDDTASSD  738

Query  585  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  406
            P S       P +S+                   G+FE HTKGFGSKMMAKMGFVEG GL
Sbjct  739  PAS-----SRPLKSKSQK---------------LGAFEKHTKGFGSKMMAKMGFVEGKGL  778

Query  405  GKDSQGITAPILATRRPKSQGLGAK  331
            GKDSQGI  P+LA R PKS+GLGAK
Sbjct  779  GKDSQGIVNPLLAVRLPKSRGLGAK  803


 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 84/145 (58%), Gaps = 26/145 (18%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANETKTPT  586
            HT G GSKMM KMGF  GG        IAEPI+V +RPK+LGLG +   +   ++T +  
Sbjct  607  HTKGFGSKMMAKMGFIEGGGLGKEGKGIAEPIEVIKRPKSLGLGVEF--SHIVDDTASND  664

Query  585  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  406
            P S       P +S+                   G+FE HTKGFGSKMMAKMGFVEG GL
Sbjct  665  PAS-----SRPLKSKSQK---------------LGAFEKHTKGFGSKMMAKMGFVEGKGL  704

Query  405  GKDSQGITAPILATRRPKSQGLGAK  331
            GKDSQGI  PI   +RPKS GLG +
Sbjct  705  GKDSQGIVNPI---KRPKSLGLGVE  726


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             FG+FE HTKGFGSKMMAKMGF+EG GLGK+ +GI  PI   +RPKS GLG +
Sbjct  600  NFGAFEEHTKGFGSKMMAKMGFIEGGGLGKEGKGIAEPIEVIKRPKSLGLGVE  652



>ref|XP_003573663.1| PREDICTED: uncharacterized protein LOC100845409 [Brachypodium 
distachyon]
Length=751

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 92/151 (61%), Gaps = 14/151 (9%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKT-  592
            +HT G GSKMM KMGF  G GLGKDGQGI +PIQ   RPK+LGLG +    + A + ++ 
Sbjct  604  MHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAIHRPKSLGLGVEFDSEAEAMKARSE  663

Query  591  -----PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMG  427
                 P P         P+++R   ++  +           G+FE HTKGFGSKMM KMG
Sbjct  664  LANARPEPSK---ARSEPSKARSEQRRNIRPADMNS----LGTFERHTKGFGSKMMVKMG  716

Query  426  FVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FV G GLGKD QGI  P+ A RRP+S+GLGA
Sbjct  717  FVPGYGLGKDGQGIVNPLTAVRRPRSRGLGA  747


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  307
             G+FE HTKGFGSKMMAKMGF+EGTGLGKD QGI  PI A  RPKS GLG +  F     
Sbjct  599  LGTFEMHTKGFGSKMMAKMGFIEGTGLGKDGQGIVQPIQAIHRPKSLGLGVE--FDSEAE  656

Query  306  SLSSREKL  283
            ++ +R +L
Sbjct  657  AMKARSEL  664



>ref|XP_008801998.1| PREDICTED: uncharacterized protein LOC103715973 isoform X1 [Phoenix 
dactylifera]
Length=794

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 89/147 (61%), Gaps = 36/147 (24%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGAD-VPETSTANETKT  592
            +HTTG GSKMM KMGF  G GLGKDGQG+ +PI+V +RPK+LGLG    P+TS       
Sbjct  681  VHTTGFGSKMMAKMGFVEGTGLGKDGQGMVQPIEVIKRPKSLGLGVQFTPDTSDVR----  736

Query  591  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  412
              P+S                              FG+FE HT GFGS+MMAKMGFV GT
Sbjct  737  IKPES------------------------------FGAFEKHTTGFGSRMMAKMGFVPGT  766

Query  411  GLGKDSQGITAPILATRRPKSQGLGAK  331
            GLGKDSQGI  P+ A + PKS+GLGAK
Sbjct  767  GLGKDSQGIINPLTAVKLPKSRGLGAK  793


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HT GFGSKMMAKMGFVEGTGLGKD QG+  PI   +RPKS GLG +
Sbjct  676  LGAFEVHTTGFGSKMMAKMGFVEGTGLGKDGQGMVQPIEVIKRPKSLGLGVQ  727



>ref|XP_008801999.1| PREDICTED: uncharacterized protein LOC103715973 isoform X2 [Phoenix 
dactylifera]
Length=786

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 89/147 (61%), Gaps = 36/147 (24%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGAD-VPETSTANETKT  592
            +HTTG GSKMM KMGF  G GLGKDGQG+ +PI+V +RPK+LGLG    P+TS       
Sbjct  673  VHTTGFGSKMMAKMGFVEGTGLGKDGQGMVQPIEVIKRPKSLGLGVQFTPDTSDVR----  728

Query  591  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  412
              P+S                              FG+FE HT GFGS+MMAKMGFV GT
Sbjct  729  IKPES------------------------------FGAFEKHTTGFGSRMMAKMGFVPGT  758

Query  411  GLGKDSQGITAPILATRRPKSQGLGAK  331
            GLGKDSQGI  P+ A + PKS+GLGAK
Sbjct  759  GLGKDSQGIINPLTAVKLPKSRGLGAK  785


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HT GFGSKMMAKMGFVEGTGLGKD QG+  PI   +RPKS GLG +
Sbjct  668  LGAFEVHTTGFGSKMMAKMGFVEGTGLGKDGQGMVQPIEVIKRPKSLGLGVQ  719



>ref|XP_011017950.1| PREDICTED: uncharacterized protein LOC105121122 [Populus euphratica]
Length=737

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 93/146 (64%), Gaps = 19/146 (13%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GGGLGKDGQG+A+PI+V+QRPK+LGLG D  + S  +    P
Sbjct  609  VHTKGFGSKMMEKMGFIQGGGLGKDGQGMAQPIEVTQRPKSLGLGVDFSDISVDSVKNKP  668

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
                 G                         +   G+FE HTKGFGSKMMAKMGFVEG G
Sbjct  669  QSSRTG------------------TSIKHSKTENLGAFEMHTKGFGSKMMAKMGFVEGMG  710

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKDSQGI  PI+A RRPK++GLGAK
Sbjct  711  LGKDSQGIVNPIVAVRRPKARGLGAK  736


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FG+FE HTKGFGSKMM KMGF++G GLGKD QG+  PI  T+RPKS GLG 
Sbjct  604  FGAFEVHTKGFGSKMMEKMGFIQGGGLGKDGQGMAQPIEVTQRPKSLGLGV  654



>ref|XP_007013705.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007013706.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 ref|XP_007013707.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31324.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31325.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY31326.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
Length=650

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 91/152 (60%), Gaps = 24/152 (16%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANE----  601
            +HT G GSKMM KMGF  GG        +A PI+V QRPK+LGLG D P  S+ ++    
Sbjct  515  VHTKGFGSKMMAKMGFVDGGGLGKDGQGMARPIEVIQRPKSLGLGVDFPSASSDSDMVQN  574

Query  600  --TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMG  427
              +     ++ GFG                   A+    GFG+FE HTKGFGSKMMAKMG
Sbjct  575  ISSGASERRTKGFG-----------------NSARGQHKGFGAFEKHTKGFGSKMMAKMG  617

Query  426  FVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            FVEG GLGKDSQG+  P++A R PKS+GLGAK
Sbjct  618  FVEGMGLGKDSQGMVNPLVAARLPKSRGLGAK  649


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 46/64 (72%), Gaps = 6/64 (9%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  307
            FG+FE HTKGFGSKMMAKMGFV+G GLGKD QG+  PI   +RPKS GLG      V F 
Sbjct  510  FGAFEVHTKGFGSKMMAKMGFVDGGGLGKDGQGMARPIEVIQRPKSLGLG------VDFP  563

Query  306  SLSS  295
            S SS
Sbjct  564  SASS  567



>ref|XP_007013704.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY31323.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
Length=765

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 91/152 (60%), Gaps = 24/152 (16%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANE----  601
            +HT G GSKMM KMGF  GG        +A PI+V QRPK+LGLG D P  S+ ++    
Sbjct  630  VHTKGFGSKMMAKMGFVDGGGLGKDGQGMARPIEVIQRPKSLGLGVDFPSASSDSDMVQN  689

Query  600  --TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMG  427
              +     ++ GFG                   A+    GFG+FE HTKGFGSKMMAKMG
Sbjct  690  ISSGASERRTKGFGN-----------------SARGQHKGFGAFEKHTKGFGSKMMAKMG  732

Query  426  FVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            FVEG GLGKDSQG+  P++A R PKS+GLGAK
Sbjct  733  FVEGMGLGKDSQGMVNPLVAARLPKSRGLGAK  764


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 46/64 (72%), Gaps = 6/64 (9%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  307
            FG+FE HTKGFGSKMMAKMGFV+G GLGKD QG+  PI   +RPKS GLG      V F 
Sbjct  625  FGAFEVHTKGFGSKMMAKMGFVDGGGLGKDGQGMARPIEVIQRPKSLGLG------VDFP  678

Query  306  SLSS  295
            S SS
Sbjct  679  SASS  682



>tpg|DAA46961.1| TPA: hypothetical protein ZEAMMB73_831663 [Zea mays]
Length=125

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 79/137 (58%), Gaps = 16/137 (12%)
 Frame = -2

Query  738  MMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKSVGFGE  562
            MM KMGF  G GLGKDGQGI +PIQ   RPK+LGLG +    + A + +    K +    
Sbjct  1    MMAKMGFIEGTGLGKDGQGIVQPIQAVHRPKSLGLGVEFDSVAEAIKARAEPIKLI----  56

Query  561  DLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGIT  382
                          +       + G GSFE HTKGFGSKMM  MGFV G+GLGKD QGI 
Sbjct  57   -----------SELRRNVWAPETSGVGSFEKHTKGFGSKMMVNMGFVPGSGLGKDGQGIA  105

Query  381  APILATRRPKSQGLGAK  331
             P+   RRPKS+GLGA+
Sbjct  106  TPLTGVRRPKSRGLGAE  122


 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGAD  628
            HT G GSKMMV MGF  G GLGKDGQGIA P+   +RPK+ GLGA+
Sbjct  77   HTKGFGSKMMVNMGFVPGSGLGKDGQGIATPLTGVRRPKSRGLGAE  122



>gb|KEH32162.1| D111/G-patch domain protein [Medicago truncatula]
Length=783

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 100/152 (66%), Gaps = 7/152 (5%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA------DVPETSTA  607
            +HTTG GSKMM KMG+T GGGLGK+GQG+A+PI+V QRPK+LGLG       D P   + 
Sbjct  631  VHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIQRPKSLGLGVEFSSNVDDPTRDSI  690

Query  606  NETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMG  427
              +K  T  S   G         S     +       + G GSFE HTKGFGSKMMAKMG
Sbjct  691  GTSKKHTKSSSRVGSSEKRTKGSSSIGSFEKHTKGSSTSGIGSFEKHTKGFGSKMMAKMG  750

Query  426  FVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            FVEG+GLG++SQGITAP+ A R PKS+GLGAK
Sbjct  751  FVEGSGLGRESQGITAPLGAVRLPKSRGLGAK  782


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
              GSFE HT GFGSKMMAKMG+ EG GLGK+ QG+  PI   +RPKS GLG +
Sbjct  625  NVGSFEVHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIQRPKSLGLGVE  677



>gb|KJB64581.1| hypothetical protein B456_010G054900 [Gossypium raimondii]
Length=786

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 99/145 (68%), Gaps = 13/145 (9%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GGGLGKDGQG+A+PI+V QRPK+LGLG +   TS+ ++    
Sbjct  652  VHTKGFGSKMMAKMGFVEGGGLGKDGQGMAQPIEVVQRPKSLGLGVNFTSTSSDSDR---  708

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
              KS G  E+   R   S K              FG+FE HTKGFGSKMMAKMGFVEG G
Sbjct  709  VHKSGGASENHSKRFGDSSKDQH---------KSFGAFEKHTKGFGSKMMAKMGFVEGMG  759

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKDSQGI  P++A+R PKS+GLGA
Sbjct  760  LGKDSQGIVNPLVASRLPKSRGLGA  784


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 47/64 (73%), Gaps = 6/64 (9%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  307
            FG+FE HTKGFGSKMMAKMGFVEG GLGKD QG+  PI   +RPKS GLG      V+F 
Sbjct  647  FGAFEVHTKGFGSKMMAKMGFVEGGGLGKDGQGMAQPIEVVQRPKSLGLG------VNFT  700

Query  306  SLSS  295
            S SS
Sbjct  701  STSS  704


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGAD  628
            HT G GSKMM KMGF  G GLGKD QGI  P+  S+ PK+ GLGA+
Sbjct  740  HTKGFGSKMMAKMGFVEGMGLGKDSQGIVNPLVASRLPKSRGLGAN  785



>ref|XP_002325162.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
 gb|EEF03727.2| D111/G-patch domain-containing family protein [Populus trichocarpa]
Length=737

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 94/146 (64%), Gaps = 19/146 (13%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GGGLGKDGQG+A+P++V+QRPK+LGLG D  + S  +    P
Sbjct  609  VHTKGFGSKMMAKMGFIEGGGLGKDGQGMAQPVEVTQRPKSLGLGVDFSDISVDSVKNKP  668

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
                 G                      Q  +   G+FE HTKGFGSK+MAKMGFVEG G
Sbjct  669  QSSRTG------------------TSGKQSKTENLGAFEKHTKGFGSKIMAKMGFVEGMG  710

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKDSQGI  PI+A +RPK++GLGAK
Sbjct  711  LGKDSQGIVNPIVAVKRPKARGLGAK  736


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FG+FE HTKGFGSKMMAKMGF+EG GLGKD QG+  P+  T+RPKS GLG 
Sbjct  604  FGAFEVHTKGFGSKMMAKMGFIEGGGLGKDGQGMAQPVEVTQRPKSLGLGV  654



>ref|XP_006381899.1| hypothetical protein POPTR_0006s20370g, partial [Populus trichocarpa]
 gb|ERP59696.1| hypothetical protein POPTR_0006s20370g, partial [Populus trichocarpa]
Length=275

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 92/146 (63%), Gaps = 15/146 (10%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GGGLGKDGQG+A+PI+V QRPK+LGLG D    S  +    P
Sbjct  143  VHTKGFGSKMMEKMGFIQGGGLGKDGQGMAQPIEVIQRPKSLGLGVDFSNISGDSVKNKP  202

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
                 G                +        +P FG+FE HTKGFGSKMM +MGFVEG G
Sbjct  203  QSLETG--------------TATGKSGKHSKTPSFGAFEKHTKGFGSKMMTRMGFVEGKG  248

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKDSQGI  P++A RR K++GLGAK
Sbjct  249  LGKDSQGIVNPLVAVRRRKARGLGAK  274


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 6/63 (10%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  307
            +G+FE HTKGFGSKMM KMGF++G GLGKD QG+  PI   +RPKS GLG      V F 
Sbjct  138  YGAFEVHTKGFGSKMMEKMGFIQGGGLGKDGQGMAQPIEVIQRPKSLGLG------VDFS  191

Query  306  SLS  298
            ++S
Sbjct  192  NIS  194



>ref|XP_010913385.1| PREDICTED: uncharacterized protein LOC105039084 isoform X2 [Elaeis 
guineensis]
Length=772

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 88/146 (60%), Gaps = 36/146 (25%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-PETSTANETKTP  589
            HT G GSKMM KMGF  G GLGK+GQG+ +PI+V +RPK+LGLG  + P+ S        
Sbjct  661  HTKGFGSKMMAKMGFVDGAGLGKEGQGMVQPIEVIKRPKSLGLGVQITPDISDVR----V  716

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P+S+G                              +FE HTKGFGS+MMAKMGFV GTG
Sbjct  717  KPESLG------------------------------AFEKHTKGFGSRMMAKMGFVPGTG  746

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKD+QGI  P+ A + PKS+GLGAK
Sbjct  747  LGKDAQGIINPLTAVKLPKSRGLGAK  772


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGSKMMAKMGFV+G GLGK+ QG+  PI   +RPKS GLG +
Sbjct  655  LGAFEEHTKGFGSKMMAKMGFVDGAGLGKEGQGMVQPIEVIKRPKSLGLGVQ  706



>ref|XP_010913384.1| PREDICTED: uncharacterized protein LOC105039084 isoform X1 [Elaeis 
guineensis]
Length=776

 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 88/146 (60%), Gaps = 36/146 (25%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-PETSTANETKTP  589
            HT G GSKMM KMGF  G GLGK+GQG+ +PI+V +RPK+LGLG  + P+ S        
Sbjct  665  HTKGFGSKMMAKMGFVDGAGLGKEGQGMVQPIEVIKRPKSLGLGVQITPDISDVR----V  720

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P+S+G                              +FE HTKGFGS+MMAKMGFV GTG
Sbjct  721  KPESLG------------------------------AFEKHTKGFGSRMMAKMGFVPGTG  750

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKD+QGI  P+ A + PKS+GLGAK
Sbjct  751  LGKDAQGIINPLTAVKLPKSRGLGAK  776


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGSKMMAKMGFV+G GLGK+ QG+  PI   +RPKS GLG +
Sbjct  659  LGAFEEHTKGFGSKMMAKMGFVDGAGLGKEGQGMVQPIEVIKRPKSLGLGVQ  710



>ref|XP_011033482.1| PREDICTED: uncharacterized protein LOC105131955 [Populus euphratica]
Length=724

 Score =   119 bits (298),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 95/146 (65%), Gaps = 17/146 (12%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GGGLGKDGQG+A+PI+  QRPK+LGLG D    S  +  K P
Sbjct  594  VHTKGFGSKMMEKMGFIQGGGLGKDGQGMAQPIEAIQRPKSLGLGVDFSNISGDSVKKKP  653

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
                 G G+                 +    +P FG+FE HTKGFGSKMM +MGFVEG G
Sbjct  654  QILETGTGK----------------FEKHSKTPSFGAFEKHTKGFGSKMMTRMGFVEGKG  697

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKDSQGI +P++A  RPK++GLGAK
Sbjct  698  LGKDSQGIVSPLVAVTRPKARGLGAK  723


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 6/63 (10%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  307
            +G+FE HTKGFGSKMM KMGF++G GLGKD QG+  PI A +RPKS GLG      V F 
Sbjct  589  YGAFEVHTKGFGSKMMEKMGFIQGGGLGKDGQGMAQPIEAIQRPKSLGLG------VDFS  642

Query  306  SLS  298
            ++S
Sbjct  643  NIS  645



>ref|XP_010040586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Eucalyptus grandis]
Length=981

 Score =   119 bits (297),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 67/136 (49%), Positives = 81/136 (60%), Gaps = 20/136 (15%)
 Frame = -2

Query  726  MGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA----NETKTPTPKSVGFGE  562
            MGFT   GLGK G G+AEPI+V +RPK+LGLG   PE+        E+++ + KS   G 
Sbjct  1    MGFTEARGLGKGGTGLAEPIEVIKRPKSLGLGMSFPESGVEPERNRESESQSAKSKQSGR  60

Query  561  DLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGIT  382
                R                     G+FE HTKGFGS++MAKMGFVEG GLGKDSQGI 
Sbjct  61   GASVRRTPQS---------------IGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQGIV  105

Query  381  APILATRRPKSQGLGA  334
             P+ A R PKS+GLGA
Sbjct  106  NPLAAVRLPKSRGLGA  121


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  631
            HT G GS++M KMGF  G GLGKD QGI  P+   + PK+ GLGA
Sbjct  77   HTKGFGSRVMAKMGFVEGMGLGKDSQGIVNPLAAVRLPKSRGLGA  121



>ref|XP_009387541.1| PREDICTED: uncharacterized protein LOC103974432 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=728

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 88/147 (60%), Gaps = 36/147 (24%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVP-ETSTANETKT  592
            +HT G GS++M KMGF  G GLGK GQG+ +PIQV +RPK+LGLG     ETS+A     
Sbjct  615  VHTKGFGSRLMAKMGFVEGTGLGKAGQGMVQPIQVVKRPKSLGLGVQFEDETSSA-----  669

Query  591  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  412
                    G ++                        G+FE HTKGFGSKMM KMGFV GT
Sbjct  670  --------GAEIGR---------------------IGAFERHTKGFGSKMMVKMGFVPGT  700

Query  411  GLGKDSQGITAPILATRRPKSQGLGAK  331
            GLGKDSQGI  P+ A ++PKS+GLGAK
Sbjct  701  GLGKDSQGIINPLTAVKQPKSRGLGAK  727


 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGS++MAKMGFVEGTGLGK  QG+  PI   +RPKS GLG +
Sbjct  610  IGAFEVHTKGFGSRLMAKMGFVEGTGLGKAGQGMVQPIQVVKRPKSLGLGVQ  661



>ref|XP_009387542.1| PREDICTED: uncharacterized protein LOC103974432 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=712

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 88/147 (60%), Gaps = 36/147 (24%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVP-ETSTANETKT  592
            +HT G GS++M KMGF  G GLGK GQG+ +PIQV +RPK+LGLG     ETS+A     
Sbjct  599  VHTKGFGSRLMAKMGFVEGTGLGKAGQGMVQPIQVVKRPKSLGLGVQFEDETSSA-----  653

Query  591  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  412
                    G ++                        G+FE HTKGFGSKMM KMGFV GT
Sbjct  654  --------GAEIGR---------------------IGAFERHTKGFGSKMMVKMGFVPGT  684

Query  411  GLGKDSQGITAPILATRRPKSQGLGAK  331
            GLGKDSQGI  P+ A ++PKS+GLGAK
Sbjct  685  GLGKDSQGIINPLTAVKQPKSRGLGAK  711


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGS++MAKMGFVEGTGLGK  QG+  PI   +RPKS GLG +
Sbjct  594  IGAFEVHTKGFGSRLMAKMGFVEGTGLGKAGQGMVQPIQVVKRPKSLGLGVQ  645



>ref|XP_010687767.1| PREDICTED: uncharacterized protein LOC104901840 [Beta vulgaris 
subsp. vulgaris]
Length=801

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 100/148 (68%), Gaps = 6/148 (4%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMG+  G GLGKDG+GI++PI+  QRPK+LGLG    E+S  NET TP
Sbjct  653  VHTKGFGSKMMAKMGYVEGDGLGKDGKGISQPIEAVQRPKSLGLGMAFVESS--NET-TP  709

Query  588  TPKSVG--FGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEG  415
              K  G    +  P  +         G   +  +P  G+FE HTKGFGSKMMA+MGFV+G
Sbjct  710  VAKRSGGSVRKSTPNTNETMPVAKRSGGSGRNSTPNIGAFEKHTKGFGSKMMARMGFVDG  769

Query  414  TGLGKDSQGITAPILATRRPKSQGLGAK  331
             GLG++SQGI  P++A RRPK++GLGA+
Sbjct  770  AGLGRNSQGIVTPLVAVRRPKARGLGAE  797


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            F SFE HTKGFGSKMMAKMG+VEG GLGKD +GI+ PI A +RPKS GLG
Sbjct  648  FASFEVHTKGFGSKMMAKMGYVEGDGLGKDGKGISQPIEAVQRPKSLGLG  697



>ref|XP_002523543.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38882.1| zinc finger protein, putative [Ricinus communis]
Length=775

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 96/147 (65%), Gaps = 23/147 (16%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETS-TANETKT  592
            +HT G GSKMM KMGF  GGGLG+DGQGIAEPI+  QRPK+LGLGA++P+T+    + K 
Sbjct  649  VHTKGFGSKMMAKMGFVEGGGLGRDGQGIAEPIEAIQRPKSLGLGANIPDTNGDPMDNKL  708

Query  591  PTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGT  412
             +   +G    L +                      G+FE HTKGFGSKMMA+MGFVEG 
Sbjct  709  QSAGRLGKHAKLQS---------------------LGAFEKHTKGFGSKMMARMGFVEGM  747

Query  411  GLGKDSQGITAPILATRRPKSQGLGAK  331
            GLGK+SQGI  P+ A R PKS+GLGAK
Sbjct  748  GLGKNSQGIVNPLAAVRLPKSRGLGAK  774


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            G+FE HTKGFGSKMMAKMGFVEG GLG+D QGI  PI A +RPKS GLGA
Sbjct  645  GAFEVHTKGFGSKMMAKMGFVEGGGLGRDGQGIAEPIEAIQRPKSLGLGA  694


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  625
            HT G GSKMM +MGF  G GLGK+ QGI  P+   + PK+ GLGA V
Sbjct  729  HTKGFGSKMMARMGFVEGMGLGKNSQGIVNPLAAVRLPKSRGLGAKV  775



>ref|XP_006407631.1| hypothetical protein EUTSA_v10020109mg [Eutrema salsugineum]
 gb|ESQ49084.1| hypothetical protein EUTSA_v10020109mg [Eutrema salsugineum]
Length=783

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 101/151 (67%), Gaps = 11/151 (7%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GGGLGKDG+GIA+PI+  QRPK+LGLG D P  S     + P
Sbjct  637  VHTKGFGSKMMAKMGFIEGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFPINS-----EDP  691

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgq-----kaqygSPGFGSFENHTKGFGSKMMAKMGF  424
            +P S     + P+ S K  K+ S         A+      G+FE HT GFGS+MMA+MGF
Sbjct  692  SPSSNNAKRNKPSSSGKHVKRISHESGGASGSARIRDKRLGAFEQHTTGFGSRMMARMGF  751

Query  423  VEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            VEG+GLG+DSQGI  P+ A RRPK++GLGA+
Sbjct  752  VEGSGLGRDSQGIVNPLFAVRRPKARGLGAE  782


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HTKGFGSKMMAKMGF+EG GLGKD +GI  PI A +RPKS GLG
Sbjct  632  IGAFEVHTKGFGSKMMAKMGFIEGGGLGKDGKGIAQPIEAVQRPKSLGLG  681



>gb|AES91716.2| D111/G-patch domain protein [Medicago truncatula]
Length=798

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 106/167 (63%), Gaps = 22/167 (13%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA------DVPETST-  610
            +HTTG GSKMM KMG+T GGGLGK+GQG+A+PI+V QRPK+LGLG       D P   + 
Sbjct  631  VHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIQRPKSLGLGVEFSSNVDDPTRDSI  690

Query  609  --------------ANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFE  472
                          ++E +T    S+G  E     S  SG    +       + G GSFE
Sbjct  691  GTSKKHTKSSSRVGSSEKRTKGSSSIGSFEKHTKGSSTSGIGSFEKHTKGSSTSGIGSFE  750

Query  471  NHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             HTKGFGSKMMAKMGFVEG+GLG++SQGITAP+ A R PKS+GLGAK
Sbjct  751  KHTKGFGSKMMAKMGFVEGSGLGRESQGITAPLGAVRLPKSRGLGAK  797


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
              GSFE HT GFGSKMMAKMG+ EG GLGK+ QG+  PI   +RPKS GLG +
Sbjct  625  NVGSFEVHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIQRPKSLGLGVE  677



>ref|XP_003609519.1| Zinc finger CCCH-type with G patch domain-containing protein 
[Medicago truncatula]
Length=809

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 106/167 (63%), Gaps = 22/167 (13%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGA------DVPETST-  610
            +HTTG GSKMM KMG+T GGGLGK+GQG+A+PI+V QRPK+LGLG       D P   + 
Sbjct  642  VHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIQRPKSLGLGVEFSSNVDDPTRDSI  701

Query  609  --------------ANETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFE  472
                          ++E +T    S+G  E     S  SG    +       + G GSFE
Sbjct  702  GTSKKHTKSSSRVGSSEKRTKGSSSIGSFEKHTKGSSTSGIGSFEKHTKGSSTSGIGSFE  761

Query  471  NHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             HTKGFGSKMMAKMGFVEG+GLG++SQGITAP+ A R PKS+GLGAK
Sbjct  762  KHTKGFGSKMMAKMGFVEGSGLGRESQGITAPLGAVRLPKSRGLGAK  808


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
              GSFE HT GFGSKMMAKMG+ EG GLGK+ QG+  PI   +RPKS GLG +
Sbjct  636  NVGSFEVHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIQRPKSLGLGVE  688



>gb|KCW82693.1| hypothetical protein EUGRSUZ_C04073 [Eucalyptus grandis]
Length=304

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 93/174 (53%), Gaps = 31/174 (18%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET----STANE  601
            + T G GSKM  K     G GLGK G  +AEPIQ  +RP++LGLG   PE+        E
Sbjct  145  VQTRGFGSKMRRKWDLIEGQGLGKGGTSLAEPIQAIKRPQSLGLGMSFPESGEEPERNKE  204

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
            +++ + KS   G     R                     G+FE HTKGFGS++MAKMGFV
Sbjct  205  SESQSAKSKQSGRGASVRRTPQ---------------SIGAFERHTKGFGSRVMAKMGFV  249

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGA-----------K**FMVSFHSLSSR  292
            EG GLGKDSQGI  P+ A R PKS+GLGA              ++VS+ +L SR
Sbjct  250  EGMGLGKDSQGIVNPLAAVRLPKSRGLGATLVRIYRSPTSASSYLVSYSTLQSR  303


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            FG+FE  T+GFGSKM  K   +EG GLGK    +  PI A +RP+S GLG
Sbjct  140  FGAFEVQTRGFGSKMRRKWDLIEGQGLGKGGTSLAEPIQAIKRPQSLGLG  189



>ref|XP_008443898.1| PREDICTED: uncharacterized protein LOC103487380 isoform X2 [Cucumis 
melo]
Length=795

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 92/146 (63%), Gaps = 16/146 (11%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            LHT G GSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST+      
Sbjct  664  LHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTS----AA  719

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
                  +     TRS    K               G+FE HTKGFGSKMMAKMGFVEG G
Sbjct  720  GDNQASWVSSARTRSGALEKSKR-----------IGAFEVHTKGFGSKMMAKMGFVEGMG  768

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKDSQGI  P+L  RRPK++GLGAK
Sbjct  769  LGKDSQGIVNPLLPVRRPKARGLGAK  794


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             GSFE HTKGFGSKMMAKMGFVEG GLGKD QG+T PI   +RPKS GLG
Sbjct  659  IGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLG  708



>ref|XP_008443896.1| PREDICTED: uncharacterized protein LOC103487380 isoform X1 [Cucumis 
melo]
Length=800

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 92/146 (63%), Gaps = 16/146 (11%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            LHT G GSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST+      
Sbjct  669  LHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTS----AA  724

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
                  +     TRS    K               G+FE HTKGFGSKMMAKMGFVEG G
Sbjct  725  GDNQASWVSSARTRSGALEKSKR-----------IGAFEVHTKGFGSKMMAKMGFVEGMG  773

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGKDSQGI  P+L  RRPK++GLGAK
Sbjct  774  LGKDSQGIVNPLLPVRRPKARGLGAK  799


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             GSFE HTKGFGSKMMAKMGFVEG GLGKD QG+T PI   +RPKS GLG
Sbjct  664  IGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLG  713



>gb|KFK38375.1| hypothetical protein AALP_AA3G105800 [Arabis alpina]
Length=761

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 98/151 (65%), Gaps = 11/151 (7%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADV-----PETSTAN  604
            +HT G GSKMM KMGF  GGGLGKDG+GIA+PI+  QRPK+LGLG D        +S++N
Sbjct  615  VHTRGFGSKMMAKMGFIEGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFSISTEDPSSSSN  674

Query  603  ETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGF  424
              K   P S G         R S   G     A+      G+FE HT GFGSKMMA+MGF
Sbjct  675  NAKRNRPSSSG-----KHVKRISHDSGGGSGSARIRDKRLGAFEQHTTGFGSKMMARMGF  729

Query  423  VEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            VEG+GLG+DSQGI  P++A RRP+ +GLGA+
Sbjct  730  VEGSGLGRDSQGIVNPLVAVRRPRVRGLGAE  760


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF+EG GLGKD +GI  PI A +RPKS GLG
Sbjct  610  IGAFEVHTRGFGSKMMAKMGFIEGGGLGKDGKGIAQPIEAVQRPKSLGLG  659



>gb|KDP38622.1| hypothetical protein JCGZ_03975 [Jatropha curcas]
Length=756

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 96/146 (66%), Gaps = 21/146 (14%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMG+  GGGLGKDGQG+AEPI+V QRPK+LGLGA++  ++  +++   
Sbjct  630  VHTKGFGSKMMAKMGYVEGGGLGKDGQGMAEPIEVIQRPKSLGLGANI--SNPTDDSMEN  687

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P+++   E                          G+FE HTKGFGSKMMA+MGFVEG G
Sbjct  688  KPQTIERFE------------------KHAKPRNLGAFEKHTKGFGSKMMARMGFVEGMG  729

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LGK SQGI  P++A R PKS+GLGAK
Sbjct  730  LGKHSQGIINPLVAARLPKSRGLGAK  755


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            GSFE HTKGFGSKMMAKMG+VEG GLGKD QG+  PI   +RPKS GLGA
Sbjct  626  GSFEVHTKGFGSKMMAKMGYVEGGGLGKDGQGMAEPIEVIQRPKSLGLGA  675



>ref|XP_010042746.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like, partial [Eucalyptus grandis]
Length=263

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 90/149 (60%), Gaps = 20/149 (13%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET----STANE  601
            +HT G GSKMM +MGF  G GLGK G G+AEPI+V +RPK+LGLG   PE+        E
Sbjct  128  VHTRGFGSKMMARMGFIEGQGLGKGGTGLAEPIEVIKRPKSLGLGMSFPESGEEPERNRE  187

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
            +++ + KS   G     R                     G+FE HTKGFGS++MAKMGFV
Sbjct  188  SESQSTKSKQSGRGASVRRIPQC---------------IGAFERHTKGFGSRVMAKMGFV  232

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGA  334
            EG GLGKDSQGI  P+ A R PKS+GL A
Sbjct  233  EGMGLGKDSQGIVNPLAAVRLPKSRGLDA  261


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            FG+FE HT+GFGSKMMA+MGF+EG GLGK   G+  PI   +RPKS GLG
Sbjct  123  FGAFEVHTRGFGSKMMARMGFIEGQGLGKGGTGLAEPIEVIKRPKSLGLG  172



>ref|XP_009341849.1| PREDICTED: uncharacterized protein LOC103933875 [Pyrus x bretschneideri]
Length=765

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKM+ KMG+  GGGLGKDGQG+A PI+V QRPK+LGLG +   +     ++TP
Sbjct  631  VHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSSSIEILVSRTP  690

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P +    +  P RSR   +               G+FE HTKGFGSKMMAKMGFVEGTG
Sbjct  691  -PVNNNAVKSNPVRSRSQTQSQR-----------VGAFERHTKGFGSKMMAKMGFVEGTG  738

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKDSQGI  P+ A R PKS+GLGA
Sbjct  739  LGKDSQGIVNPLSAVRLPKSRGLGA  763


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  307
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +  F  S  
Sbjct  626  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE--FSSSIE  683

Query  306  SLSSR  292
             L SR
Sbjct  684  ILVSR  688



>ref|XP_009341804.1| PREDICTED: uncharacterized protein LOC103933838 [Pyrus x bretschneideri]
Length=765

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKM+ KMG+  GGGLGKDGQG+A PI+V QRPK+LGLG +   +     ++TP
Sbjct  631  VHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSSSIEILVSRTP  690

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P +    +  P RSR   +               G+FE HTKGFGSKMMAKMGFVEGTG
Sbjct  691  -PVNNNAVKSNPVRSRSQTQSQR-----------VGAFERHTKGFGSKMMAKMGFVEGTG  738

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKDSQGI  P+ A R PKS+GLGA
Sbjct  739  LGKDSQGIVNPLSAVRLPKSRGLGA  763


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK**FMVSFH  307
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +  F  S  
Sbjct  626  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE--FSSSIE  683

Query  306  SLSSR  292
             L SR
Sbjct  684  ILVSR  688



>ref|XP_009366281.1| PREDICTED: uncharacterized protein LOC103956064 [Pyrus x bretschneideri]
Length=758

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 96/145 (66%), Gaps = 13/145 (9%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKM+ KMG+  GGGLGKDGQG+A PI+V QRPK+LGLG +   +     ++TP
Sbjct  624  VHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSSSIEIPVSRTP  683

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P +    +  P RSR   +               G+FE HTKGFGSKMMAKMGFVEGTG
Sbjct  684  -PVNNNAVKSNPVRSRSQTQSQR-----------VGAFERHTKGFGSKMMAKMGFVEGTG  731

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKDSQGI  P+ A R PKS+GLGA
Sbjct  732  LGKDSQGIVNPLSAVRLPKSRGLGA  756


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +
Sbjct  619  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  670



>gb|KGN65218.1| hypothetical protein Csa_1G266150 [Cucumis sativus]
Length=783

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 93/150 (62%), Gaps = 24/150 (16%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA----NE  601
            LHT G GSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST+    N+
Sbjct  652  LHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTSAAGDNQ  711

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
                +    G      T+                     G+FE HTKGFGSKMMAKMGFV
Sbjct  712  ASGISSARTGSSALEKTKK-------------------IGAFEVHTKGFGSKMMAKMGFV  752

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            EG GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  753  EGMGLGKDSQGIINPLLPVRRPKARGLGAK  782


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             GSFE HTKGFGSKMMAKMGFVEG GLGKD QG+T PI   +RPKS GLG
Sbjct  647  IGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLG  696



>ref|XP_004146703.1| PREDICTED: uncharacterized protein LOC101215133 [Cucumis sativus]
Length=793

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 93/150 (62%), Gaps = 24/150 (16%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTA----NE  601
            LHT G GSKMM KMGF  GGGLGKDGQG+  PI+V +RPK+LGLG +  E ST+    N+
Sbjct  662  LHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLGIEFSEASTSAAGDNQ  721

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
                +    G      T+                     G+FE HTKGFGSKMMAKMGFV
Sbjct  722  ASGISSARTGSSALEKTKK-------------------IGAFEVHTKGFGSKMMAKMGFV  762

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            EG GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  763  EGMGLGKDSQGIINPLLPVRRPKARGLGAK  792


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             GSFE HTKGFGSKMMAKMGFVEG GLGKD QG+T PI   +RPKS GLG
Sbjct  657  IGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVMKRPKSLGLG  706



>ref|XP_004508396.1| PREDICTED: uncharacterized protein LOC101505169 [Cicer arietinum]
Length=806

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 102/167 (61%), Gaps = 24/167 (14%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HTTG GSKMM KMG+T GGGLGK+GQG+A+PI+V +RPK+LGLG +   +S  +E    
Sbjct  641  VHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIKRPKSLGLGVEF--SSNLDEPTRD  698

Query  588  TPKSVGFGEDLP---------TRsrksgkkgsqgqkaqygSPGF------------GSFE  472
             P  +G  E            T+   S     +  K       F            G+FE
Sbjct  699  NPSGIGTSEKHTKGSSSIGKHTKGSSSFVSFEKHTKGSSSFASFEKHTKGSSSSSIGAFE  758

Query  471  NHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             HTKGFGSKMMAKMGFVEG GLG+DSQGITAP+ A R PKS+GLGAK
Sbjct  759  KHTKGFGSKMMAKMGFVEGAGLGRDSQGITAPLGAVRLPKSRGLGAK  805


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
              GSFE HT GFGSKMMAKMG+ EG GLGK+ QG+  PI   +RPKS GLG +
Sbjct  635  NIGSFEVHTTGFGSKMMAKMGYTEGGGLGKNGQGMAQPIEVIKRPKSLGLGVE  687



>ref|XP_007203786.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica]
 gb|EMJ04985.1| hypothetical protein PRUPE_ppa001771mg [Prunus persica]
Length=767

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 96/145 (66%), Gaps = 15/145 (10%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKM+ KMGF  GGGLGKDGQG+A PI+V QRPK+LGLG +   T       TP
Sbjct  635  VHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSNTVDLPVNNTP  694

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
                    +  P +++   ++ SQ Q+        GSFE HTKGFGSKMMAKMGFVEG G
Sbjct  695  V-------KSYPVKNKSQSQRVSQPQR-------VGSFEKHTKGFGSKMMAKMGFVEGMG  740

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKDSQGI  P+ A R PKS+GLGA
Sbjct  741  LGKDSQGIVNPLAAVRLPKSRGLGA  765


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            F SFE HTKGFGSKM+AKMGF+EG GLGKD QG+ API   +RPKS GLG +
Sbjct  630  FHSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  681



>ref|XP_004162452.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226078 
[Cucumis sativus]
Length=802

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 93/148 (63%), Gaps = 21/148 (14%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETST--ANETK  595
            LHT G GSKMM KMGF  GGGLGKDGQG+  PI+V ++PK+LGLG +  E ST  A + +
Sbjct  672  LHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVXEKPKSLGLGIEFSEASTSAAGDNQ  731

Query  594  TPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEG  415
                 S   G  L                    +   G+FE HTKGFGSKMMAKMGFVEG
Sbjct  732  ASGISSARTGSVL------------------GKTKKIGAFEVHTKGFGSKMMAKMGFVEG  773

Query  414  TGLGKDSQGITAPILATRRPKSQGLGAK  331
             GLGKDSQGI  P+L  RRPK++GLGAK
Sbjct  774  MGLGKDSQGIINPLLPVRRPKARGLGAK  801


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             GSFE HTKGFGSKMMAKMGFVEG GLGKD QG+T PI    +PKS GLG
Sbjct  667  IGSFELHTKGFGSKMMAKMGFVEGGGLGKDGQGMTHPIEVXEKPKSLGLG  716



>ref|XP_008242893.1| PREDICTED: uncharacterized protein LOC103341193 [Prunus mume]
Length=769

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 96/145 (66%), Gaps = 15/145 (10%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKM+ KMGF  GGGLGKDGQG+A PI+V QRPK+LGLG +   T       TP
Sbjct  637  VHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSNTVDLPVNNTP  696

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
               +       P +++   ++ SQ QK        GSFE HTKGFGSKMMAKMGFVEG G
Sbjct  697  VKSN-------PVKNKAQSQRVSQPQK-------VGSFEKHTKGFGSKMMAKMGFVEGMG  742

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKDSQGI  P+ A R PKS+GLGA
Sbjct  743  LGKDSQGIVNPLAAVRLPKSRGLGA  767


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            F SFE HTKGFGSKM+AKMGF+EG GLGKD QG+ API   +RPKS GLG +
Sbjct  632  FHSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  683



>ref|XP_008336930.1| PREDICTED: uncharacterized protein LOC103400027 [Malus domestica]
Length=757

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 93/144 (65%), Gaps = 13/144 (9%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKM+ KMG+  GGGLGKDGQG+A PI+V QRPK+LGLG +         +KTP
Sbjct  623  VHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVEFSTPVEIPVSKTP  682

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
              K++      P R R   +      +        GSFE HTKGFGSKMMAKMGFVEG G
Sbjct  683  PVKNI------PVRRRSQAQSSQTQSER------VGSFEKHTKGFGSKMMAKMGFVEGMG  730

Query  408  LGKDSQGITAPILATRRPKSQGLG  337
            LGKDSQGI  P+ A R PKS+GLG
Sbjct  731  LGKDSQGIVYPLAAVRLPKSRGLG  754


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            + SFE HTKGFGSKM+AKMG++EG GLGKD QG+ API   +RPKS GLG +
Sbjct  618  YRSFEVHTKGFGSKMLAKMGYIEGGGLGKDGQGMAAPIEVIQRPKSLGLGVE  669



>gb|KCW82695.1| hypothetical protein EUGRSUZ_C04076 [Eucalyptus grandis]
Length=123

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 82/138 (59%), Gaps = 24/138 (17%)
 Frame = -2

Query  726  MGFTGGG-LGKDGQGIAEPIQVSQRPKALGLGADVPET------STANETKTPTPKSVGF  568
            MGF  G  LG+ G G+AEPI+V +RPK+LGLG   PE+      +  +E+++   K  G 
Sbjct  1    MGFIEGQVLGRGGTGLAEPIEVIKRPKSLGLGMSFPESGEEPERNRESESQSAKLKQSGR  60

Query  567  GEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQG  388
            G  +                 +      G+FE HTKGFGS++MAKMGFVEG GLGKDSQG
Sbjct  61   GASV-----------------RRTPQSIGAFERHTKGFGSRVMAKMGFVEGMGLGKDSQG  103

Query  387  ITAPILATRRPKSQGLGA  334
            I  P+ A R PKS+GLGA
Sbjct  104  IVNPLAAVRFPKSRGLGA  121


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGA  631
            HT G GS++M KMGF  G GLGKD QGI  P+   + PK+ GLGA
Sbjct  77   HTKGFGSRVMAKMGFVEGMGLGKDSQGIVNPLAAVRFPKSRGLGA  121



>ref|XP_010041360.1| PREDICTED: zinc finger CCCH-type with G patch domain-containing 
protein-like [Eucalyptus grandis]
Length=278

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 87/148 (59%), Gaps = 20/148 (14%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET----STANE  601
            +H  G GSKMM KMGF  G GLGK G G+AEPI+V + PK+LGLG   PE+        E
Sbjct  123  VHARGFGSKMMAKMGFIEGQGLGKGGTGLAEPIEVIKHPKSLGLGMSFPESGEEPERNRE  182

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
            +++ + KS   G     R                     G+FE HTKGFGS++MAKMGFV
Sbjct  183  SESQSAKSKQSGRGASVRRTPQ---------------SIGAFERHTKGFGSRVMAKMGFV  227

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLG  337
            E  GLGKDSQGI  P+ A R PKS+GLG
Sbjct  228  ESMGLGKDSQGIVNPLAAVRLPKSRGLG  255


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            FG+FE H +GFGSKMMAKMGF+EG GLGK   G+  PI   + PKS GLG
Sbjct  118  FGAFEVHARGFGSKMMAKMGFIEGQGLGKGGTGLAEPIEVIKHPKSLGLG  167



>ref|XP_007155121.1| hypothetical protein PHAVU_003G175300g [Phaseolus vulgaris]
 gb|ESW27115.1| hypothetical protein PHAVU_003G175300g [Phaseolus vulgaris]
Length=759

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 92/148 (62%), Gaps = 13/148 (9%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANETKTPT  586
            HTTG GSKMM KMG+TGGG        +A+PIQV QRPK+LGLG +          KT  
Sbjct  620  HTTGFGSKMMAKMGYTGGGGLGKNGQGMAQPIQVIQRPKSLGLGVEFSSDPGEPARKTSL  679

Query  585  ---PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEG  415
                +SVG G +L  +  + G   S            G+FE HTKGFGSKMMAKMGFVEG
Sbjct  680  RVGAESVGLGVELSNKPGEPGMNRSSR---------VGAFERHTKGFGSKMMAKMGFVEG  730

Query  414  TGLGKDSQGITAPILATRRPKSQGLGAK  331
             GLG++SQGIT P+ A R PKS+GLGAK
Sbjct  731  KGLGRESQGITTPLTALRLPKSRGLGAK  758



>gb|KCW44417.1| hypothetical protein EUGRSUZ_L02096 [Eucalyptus grandis]
Length=287

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 87/148 (59%), Gaps = 20/148 (14%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET----STANE  601
            +H  G GSKMM KMGF  G GLGK G G+AEPI+V + PK+LGLG   PE+        E
Sbjct  132  VHARGFGSKMMAKMGFIEGQGLGKGGTGLAEPIEVIKHPKSLGLGMSFPESGEEPERNRE  191

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
            +++ + KS   G     R                     G+FE HTKGFGS++MAKMGFV
Sbjct  192  SESQSAKSKQSGRGASVRRTPQ---------------SIGAFERHTKGFGSRVMAKMGFV  236

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLG  337
            E  GLGKDSQGI  P+ A R PKS+GLG
Sbjct  237  ESMGLGKDSQGIVNPLAAVRLPKSRGLG  264


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            FG+FE H +GFGSKMMAKMGF+EG GLGK   G+  PI   + PKS GLG
Sbjct  127  FGAFEVHARGFGSKMMAKMGFIEGQGLGKGGTGLAEPIEVIKHPKSLGLG  176



>ref|XP_002884758.1| hypothetical protein ARALYDRAFT_478310 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61017.1| hypothetical protein ARALYDRAFT_478310 [Arabidopsis lyrata subsp. 
lyrata]
Length=777

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 92/151 (61%), Gaps = 11/151 (7%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GG        IA+PI+  QRPK+LGLG D        +T+ P
Sbjct  631  VHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVQRPKSLGLGLDF-----NIDTEDP  685

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPG-----FGSFENHTKGFGSKMMAKMGF  424
            TP S    +   + S     K    +    GS G      G+FE HT GFGS+MMA+MGF
Sbjct  686  TPSSNNNAKRNRSSSSGKHVKRISHENGASGSGGIRDKRLGAFEQHTTGFGSRMMARMGF  745

Query  423  VEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            VEG+GLG++SQGI  P++A RRP+++G+GA+
Sbjct  746  VEGSGLGRESQGIVNPLVAVRRPRARGIGAE  776


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF++G GLGKD +GI  PI A +RPKS GLG
Sbjct  626  IGAFEVHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVQRPKSLGLG  675



>ref|XP_010464642.1| PREDICTED: uncharacterized protein LOC104745160 isoform X3 [Camelina 
sativa]
Length=776

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 9/150 (6%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANE  601
            +HT G GSKMM KMGF  GG        IA+PI+  +RPK+LGLG     D  + S ++ 
Sbjct  630  MHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIDTEDMSPSSN  689

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
                  +S   G+ +    +            +      G+FE HT+GFGS+MMA+MGFV
Sbjct  690  NNAKRNRSSSSGKHV----KHISHDNGASSSGRIRDKRLGAFEQHTRGFGSRMMARMGFV  745

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            EG+GLG+DSQGI  P++A RRP+++G+GA+
Sbjct  746  EGSGLGRDSQGIVNPLVAVRRPRARGIGAE  775


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF++G GLGKD +GI  PI A +RPKS GLG
Sbjct  625  IGAFEMHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLG  674



>ref|XP_010464640.1| PREDICTED: uncharacterized protein LOC104745160 isoform X1 [Camelina 
sativa]
 ref|XP_010464641.1| PREDICTED: uncharacterized protein LOC104745160 isoform X2 [Camelina 
sativa]
Length=777

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 9/150 (6%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANE  601
            +HT G GSKMM KMGF  GG        IA+PI+  +RPK+LGLG     D  + S ++ 
Sbjct  631  MHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIDTEDMSPSSN  690

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
                  +S   G+ +    +            +      G+FE HT+GFGS+MMA+MGFV
Sbjct  691  NNAKRNRSSSSGKHV----KHISHDNGASSSGRIRDKRLGAFEQHTRGFGSRMMARMGFV  746

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            EG+GLG+DSQGI  P++A RRP+++G+GA+
Sbjct  747  EGSGLGRDSQGIVNPLVAVRRPRARGIGAE  776


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF++G GLGKD +GI  PI A +RPKS GLG
Sbjct  626  IGAFEMHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLG  675



>ref|XP_010486561.1| PREDICTED: dentin sialophosphoprotein-like isoform X3 [Camelina 
sativa]
Length=777

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 88/150 (59%), Gaps = 9/150 (6%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANE  601
            LHT G GSKMM KMGF  GG        IA+PI+  +RPK+LGLG     D  + S ++ 
Sbjct  631  LHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIDTEDMSPSSN  690

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
                  +S   G+ +    +            +      G+FE HT GFGS+MMA+MGFV
Sbjct  691  NNAKRNRSSSSGKHV----KHISHDNGASSSGRIRDKRLGAFEQHTTGFGSRMMARMGFV  746

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            EG+GLG+DSQGI  P++A RRP+++G+GA+
Sbjct  747  EGSGLGRDSQGIVNPLVAVRRPRARGIGAE  776


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF++G GLGKD +GI  PI A +RPKS GLG
Sbjct  626  IGAFELHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLG  675



>ref|XP_006453696.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 ref|XP_006453697.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66936.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66937.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
Length=744

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 93/145 (64%), Gaps = 15/145 (10%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMG+  GGGLGKDGQG+++PI+  QRPK LGLG +   T   +  K  
Sbjct  612  VHTKGFGSKMMAKMGYVEGGGLGKDGQGMSKPIEAIQRPKKLGLGVEFSNTDDDSSRKES  671

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
               S               +K S+   A+ G+   G+FE HT+GFGSKMMAKMGFVEG G
Sbjct  672  RSDSA--------------RKESRSNSAKKGAQNIGAFEKHTRGFGSKMMAKMGFVEGMG  717

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LG+DSQGI  P+ A R PKS+GLGA
Sbjct  718  LGRDSQGIVNPLAAVRLPKSRGLGA  742


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGSKMMAKMG+VEG GLGKD QG++ PI A +RPK  GLG +
Sbjct  607  IGAFEVHTKGFGSKMMAKMGYVEGGGLGKDGQGMSKPIEAIQRPKKLGLGVE  658



>ref|XP_010486559.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Camelina 
sativa]
 ref|XP_010486560.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Camelina 
sativa]
Length=775

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 88/150 (59%), Gaps = 9/150 (6%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANE  601
            LHT G GSKMM KMGF  GG        IA+PI+  +RPK+LGLG     D  + S ++ 
Sbjct  629  LHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIDTEDMSPSSN  688

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
                  +S   G+ +    +            +      G+FE HT GFGS+MMA+MGFV
Sbjct  689  NNAKRNRSSSSGKHV----KHISHDNGASSSGRIRDKRLGAFEQHTTGFGSRMMARMGFV  744

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            EG+GLG+DSQGI  P++A RRP+++G+GA+
Sbjct  745  EGSGLGRDSQGIVNPLVAVRRPRARGIGAE  774


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF++G GLGKD +GI  PI A +RPKS GLG
Sbjct  624  IGAFELHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLG  673



>ref|XP_004287228.1| PREDICTED: uncharacterized protein LOC101294206 [Fragaria vesca 
subsp. vesca]
Length=778

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 85/145 (59%), Gaps = 1/145 (1%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQGI-AEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKM+ KMGF  GG         AEPI+  QRPK+LGLG +   T       TP
Sbjct  634  VHTKGFGSKMLAKMGFIEGGGLGKDGQGRAEPIEAVQRPKSLGLGVEFSNTIGVQVINTP  693

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
            + ++          S KS    +   + +  +   GSFE HTKGFGSKMMA+MGFVEG G
Sbjct  694  SRQNPAKNTPAKRNSAKSMLAKNNPVRNKPQTERVGSFERHTKGFGSKMMARMGFVEGMG  753

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKDSQGI  P+ A R  KS+G+GA
Sbjct  754  LGKDSQGIVNPLAAVRLRKSRGIGA  778


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            F SFE HTKGFGSKM+AKMGF+EG GLGKD QG   PI A +RPKS GLG +
Sbjct  629  FRSFEVHTKGFGSKMLAKMGFIEGGGLGKDGQGRAEPIEAVQRPKSLGLGVE  680



>emb|CDY41580.1| BnaC05g43170D [Brassica napus]
Length=738

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 91/150 (61%), Gaps = 8/150 (5%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANE  601
            +HT G GSKMM KMGF  GG        IA+PI+  QRPK+LGLG     D  E S ++ 
Sbjct  591  VHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLGLDFSIDTEEASPSSN  650

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
                  +S   G+ +    R S   G     A+      G+FE HT GFGS+MMA+MGFV
Sbjct  651  NNAKRNRSSSSGKQV---KRVSHVIGGGSGSARIRDKRLGAFEQHTTGFGSRMMARMGFV  707

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            +G+GLG++SQGI  P++A RRPK++GLGA+
Sbjct  708  DGSGLGRESQGIVNPLVAVRRPKARGLGAE  737


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF+EG GLGK+ +GI  PI A +RPKS GLG
Sbjct  586  IGAFEVHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLG  635



>ref|XP_010265699.1| PREDICTED: uncharacterized protein LOC104603377 [Nelumbo nucifera]
Length=820

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 89/145 (61%), Gaps = 33/145 (23%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  586
            HT G GSKMM KMGF  GGGLGKDGQG+ EPI+  +RPK+LGLG +   + T ++T    
Sbjct  708  HTKGFGSKMMAKMGFVEGGGLGKDGQGMVEPIEAIKRPKSLGLGVNF--SKTDDDTVRSK  765

Query  585  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  406
            P+                               F +FE HTKGFGSKMMAKMGFVEG GL
Sbjct  766  PEQ------------------------------FRAFEKHTKGFGSKMMAKMGFVEGMGL  795

Query  405  GKDSQGITAPILATRRPKSQGLGAK  331
            G+DSQG+  P++A R PKS+GLGAK
Sbjct  796  GRDSQGMVNPLVAVRLPKSRGLGAK  820


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 86/145 (59%), Gaps = 33/145 (23%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GGGLGKDGQG+ EPI+  +RPK+LGLG +   + T ++T   
Sbjct  640  MHTRGFGSKMMTKMGFVEGGGLGKDGQGMVEPIEAIKRPKSLGLGVNF--SKTDDDTVRS  697

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
             P+                               F +FE HTKGFGSKMMAKMGFVEG G
Sbjct  698  KPEQ------------------------------FRAFEKHTKGFGSKMMAKMGFVEGGG  727

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LGKD QG+  PI A +RPKS GLG 
Sbjct  728  LGKDGQGMVEPIEAIKRPKSLGLGV  752


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
             G+FE HT+GFGSKMM KMGFVEG GLGKD QG+  PI A +RPKS GLG 
Sbjct  635  LGAFEMHTRGFGSKMMTKMGFVEGGGLGKDGQGMVEPIEAIKRPKSLGLGV  685



>ref|XP_006299668.1| hypothetical protein CARUB_v10015856mg [Capsella rubella]
 gb|EOA32566.1| hypothetical protein CARUB_v10015856mg [Capsella rubella]
Length=774

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 88/150 (59%), Gaps = 9/150 (6%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLG----ADVPETSTANE  601
            +HT G GSKMM KMGF  GG        I++PI+  QRPK+LGLG     D  +TS ++ 
Sbjct  628  VHTRGFGSKMMAKMGFIDGGGLGKDGKGISQPIEAVQRPKSLGLGLDFSIDTEDTSPSSN  687

Query  600  TKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFV  421
                  +S   G+     ++            +      G+FE HT GFGS+MMA+MGFV
Sbjct  688  NNAKRNRSSSSGK----HAKHISHDNGASSSGRIRDKRLGAFEQHTTGFGSRMMARMGFV  743

Query  420  EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            EG+GLG++SQGI  P++A RRP+ +G+GA+
Sbjct  744  EGSGLGRESQGIVNPLVAVRRPRVRGIGAE  773


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF++G GLGKD +GI+ PI A +RPKS GLG
Sbjct  623  IGAFEVHTRGFGSKMMAKMGFIDGGGLGKDGKGISQPIEAVQRPKSLGLG  672



>ref|XP_010477969.1| PREDICTED: uncharacterized protein LOC104756959 [Camelina sativa]
Length=775

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 85/152 (56%), Gaps = 13/152 (9%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVP-ET-----STA  607
            LHT G GSKMM KMGF  GG        IA+PI+  +RPK+LGLG D   ET     S+ 
Sbjct  629  LHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLGLDFSIETEDMSPSSN  688

Query  606  NETKTPTPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMG  427
            N  K     S G         +            +      G+FE HT GFGS+MMA+MG
Sbjct  689  NNAKRNRSSSSG------KHVKHISHDNGASSSGRIRDKRLGAFEQHTTGFGSRMMARMG  742

Query  426  FVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            FVEG+GLG+DSQGI  P+ A RRP+ +G+GA+
Sbjct  743  FVEGSGLGRDSQGIVNPLAAVRRPRGRGIGAE  774


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF++G GLGKD +GI  PI A +RPKS GLG
Sbjct  624  IGAFELHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVKRPKSLGLG  673



>emb|CDY54616.1| BnaA05g28700D [Brassica napus]
Length=701

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 91/146 (62%), Gaps = 14/146 (10%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GG        IA+PI+  QRPK+LGLG D   +   +E   P
Sbjct  568  VHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLGLDF--SIDTDEASPP  625

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
               +            K  +  S G++ + GS   G+FE HT GFGS+MMA+MGFV+G+G
Sbjct  626  INNNA-----------KKNRSSSSGKQVKRGSHDIGAFEQHTTGFGSRMMARMGFVDGSG  674

Query  408  LGKDSQGITAPILATRRPKSQGLGAK  331
            LG++SQGI  P++A RRP+++GLGA+
Sbjct  675  LGRESQGIVNPLVAVRRPRARGLGAE  700


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF+EG GLGK+ +GI  PI A +RPKS GLG
Sbjct  563  IGAFEVHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAVQRPKSLGLG  612



>ref|XP_009146893.1| PREDICTED: uncharacterized protein LOC103870513 [Brassica rapa]
Length=739

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 91/156 (58%), Gaps = 20/156 (13%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADV---------PET  616
            +HT G GSKMM KMGF  GG        IA+PI+  QRPK+LGLG D          P  
Sbjct  592  VHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAIQRPKSLGLGLDFSIDTDEAISPIN  651

Query  615  STANETKTPTP-KSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMM  439
            + A + ++ +  K V  G         S   G     A+      G+FE HT GFGS+MM
Sbjct  652  NNARKNRSSSSGKQVKRG---------SHDIGGGSSSARIRDKRLGAFEQHTTGFGSRMM  702

Query  438  AKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            A+MGFV+G+GLG++SQGI  P++A RRP+++GLGA+
Sbjct  703  ARMGFVDGSGLGRESQGIVNPLVAVRRPRARGLGAE  738


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF+EG GLGK+ +GI  PI A +RPKS GLG
Sbjct  587  IGAFEVHTRGFGSKMMAKMGFIEGGGLGKEGKGIAQPIEAIQRPKSLGLG  636



>ref|NP_566359.1| D111/G-patch domain-containing protein [Arabidopsis thaliana]
 gb|AAF23251.1|AC015985_9 hypothetical protein [Arabidopsis thaliana]
 gb|AAL09738.1| AT3g09850/F8A24_10 [Arabidopsis thaliana]
 gb|AAN18212.1| At3g09850/F8A24_10 [Arabidopsis thaliana]
 gb|AEE74821.1| D111/G-patch domain-containing protein [Arabidopsis thaliana]
Length=781

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 84/148 (57%), Gaps = 3/148 (2%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGGGLGKDGQG-IAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GG        IA+PI+  QRPK+LGLG D    +      + 
Sbjct  633  VHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVQRPKSLGLGLDFSIDTEDPSPSSN  692

Query  588  TPKSVGFGEDLPT--RsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEG  415
               +        +    ++           +      G+FE HT GFGS+MMA+MGFVEG
Sbjct  693  NNNNAKRNRSSSSGKHGKRITHDNGASGSGRIRDKRLGAFEQHTTGFGSRMMARMGFVEG  752

Query  414  TGLGKDSQGITAPILATRRPKSQGLGAK  331
            +GLG++SQGI  P++A RRP+++G+GA+
Sbjct  753  SGLGRESQGIVNPLVAVRRPRARGIGAE  780


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             G+FE HT+GFGSKMMAKMGF++G GLGKD +GI  PI A +RPKS GLG
Sbjct  628  IGAFEVHTRGFGSKMMAKMGFIDGGGLGKDGKGIAQPIEAVQRPKSLGLG  677



>ref|XP_010244790.1| PREDICTED: uncharacterized protein LOC104588524 [Nelumbo nucifera]
Length=737

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 84/145 (58%), Gaps = 34/145 (23%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            +HT G GSKMM KMGF  GGGLG+DGQG+ EP++  + PK+LGLG               
Sbjct  624  MHTKGFGSKMMAKMGFVEGGGLGRDGQGMVEPLEAIKWPKSLGLGVKFS-----------  672

Query  588  TPKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTG  409
              K++G     P R                     G+FE HTKG GS+MM +MGFVEG G
Sbjct  673  --KAIGTARSQPER--------------------IGAFEKHTKGSGSRMMERMGFVEGMG  710

Query  408  LGKDSQGITAPILATRRPKSQGLGA  334
            LG+DSQGI  P++A R PKS+GLGA
Sbjct  711  LGRDSQGIVTPLVAVRLPKSRGLGA  735


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGSKMMAKMGFVEG GLG+D QG+  P+ A + PKS GLG K
Sbjct  619  LGAFEMHTKGFGSKMMAKMGFVEGGGLGRDGQGMVEPLEAIKWPKSLGLGVK  670


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADV  625
            HT G GS+MM +MGF  G GLG+D QGI  P+   + PK+ GLGA+ 
Sbjct  691  HTKGSGSRMMERMGFVEGMGLGRDSQGIVTPLVAVRLPKSRGLGANA  737



>gb|EPS60366.1| hypothetical protein M569_14436, partial [Genlisea aurea]
Length=64

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 2/46 (4%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGG--GLGKDGQGIAEPIQVSQRPKALGLGA  631
            HTTG GSKM+ KMG+ GG  GLGKDGQGI+EPI+VSQRPK+LGLGA
Sbjct  16   HTTGFGSKMLAKMGYVGGRRGLGKDGQGISEPIEVSQRPKSLGLGA  61


 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEG-TGLGKDSQGITAPILATRRPKSQGLGA  334
            GSFE HT GFGSKM+AKMG+V G  GLGKD QGI+ PI  ++RPKS GLGA
Sbjct  11   GSFERHTTGFGSKMLAKMGYVGGRRGLGKDGQGISEPIEVSQRPKSLGLGA  61



>ref|XP_001776479.1| predicted protein [Physcomitrella patens]
 gb|EDQ58746.1| predicted protein [Physcomitrella patens]
Length=856

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
             G FE HTKGFGS+MM+KMGFVEG GLG+D QGI +P+ A +RPKS GLGA
Sbjct  799  IGHFEAHTKGFGSRMMSKMGFVEGQGLGRDGQGIYSPLEAVKRPKSLGLGA  849


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPET  616
            HT G GS+MM KMGF  G GLG+DGQGI  P++  +RPK+LGLGA  P T
Sbjct  805  HTKGFGSRMMSKMGFVEGQGLGRDGQGIYSPLEAVKRPKSLGLGAYAPST  854



>ref|XP_002265219.2| PREDICTED: uncharacterized protein LOC100260114 [Vitis vinifera]
Length=677

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGS+MMAKMGFV G GLGKD QG+   I  T+RPKS GLG +
Sbjct  624  LGAFEVHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  675


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGAD  628
            +HT G GS+MM KMGF  G GLGKDGQG+ + I+V++RPK+LGLG +
Sbjct  629  VHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  675



>emb|CBI25601.3| unnamed protein product [Vitis vinifera]
Length=636

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             G+FE HTKGFGS+MMAKMGFV G GLGKD QG+   I  T+RPKS GLG +
Sbjct  583  LGAFEVHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  634


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -2

Query  765  LHTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGAD  628
            +HT G GS+MM KMGF  G GLGKDGQG+ + I+V++RPK+LGLG +
Sbjct  588  VHTKGFGSRMMAKMGFVAGQGLGKDGQGMVKLIEVTKRPKSLGLGVE  634



>ref|XP_006679437.1| hypothetical protein BATDEDRAFT_25372 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79675.1| hypothetical protein BATDEDRAFT_25372 [Batrachochytrium dendrobatidis 
JAM81]
Length=1036

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            F +FE HTKGFGSKM+AKMG+V GTGLG +  GI API    RP   GLG
Sbjct  282  FATFERHTKGFGSKMLAKMGYVPGTGLGANRVGIIAPIDVKLRPSGMGLG  331



>ref|XP_010906679.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Elaeis guineensis]
Length=864

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FENHTKG G K++  MG+ EG+GLGK+ QGI API A  RPK+ G+G
Sbjct  197  GKFENHTKGIGMKLLKLMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMG  245



>ref|XP_008804692.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Phoenix dactylifera]
 ref|XP_008804693.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Phoenix dactylifera]
 ref|XP_008804694.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Phoenix dactylifera]
Length=868

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FE+HTKG G K++  MG+ EG+GLGK+ QGI API A  RPK+ G+G
Sbjct  201  GKFESHTKGIGLKLLKMMGYKEGSGLGKNKQGIVAPIEAKLRPKNMGMG  249



>ref|XP_004300043.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
 ref|XP_011464964.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
 ref|XP_011464965.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
 ref|XP_011464966.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Fragaria vesca subsp. vesca]
Length=860

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
             GSFE HTK FG KM+ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  192  LGSFEQHTKAFGMKMLEKMGY-KGGGLGKNQQGILAPIEAKLRPKNMGMG  240


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 5/59 (8%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  586
            HT   G KM+ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +        ETK P+
Sbjct  198  HTKAFGMKMLEKMGYKGGGLGKNQQGILAPIEAKLRPKNMGMGFN-----DYKETKQPS  251



>sp|Q0IIX9.2|TFP11_XENTR RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Xenopus 
(Silurana) tropicalis]
 gb|ABC69924.1| STIP [Xenopus (Silurana) tropicalis]
Length=825

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V+G GLGK++QGI API A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQRKGKGAVGA  188



>ref|NP_001090845.1| tuftelin-interacting protein 11 [Xenopus (Silurana) tropicalis]
 gb|AAI21498.1| LOC100038256 protein [Xenopus (Silurana) tropicalis]
Length=825

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V+G GLGK++QGI API A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVQGRGLGKNAQGIIAPIEAKQRKGKGAVGA  188



>ref|XP_009397719.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Musa acuminata subsp. malaccensis]
Length=850

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FE HTKG G K+M  MG+ EG+GLGK  QGI AP+ A  RPK+ G+G
Sbjct  185  GKFEVHTKGIGLKLMKMMGYKEGSGLGKSEQGIVAPVEAKLRPKNMGMG  233



>ref|XP_005850261.1| hypothetical protein CHLNCDRAFT_50559 [Chlorella variabilis]
 gb|EFN58159.1| hypothetical protein CHLNCDRAFT_50559 [Chlorella variabilis]
Length=915

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FE HTKG G+K++AKMG+ EG GLG+D +GI+ P+ A  RPK  G+G
Sbjct  256  GKFEAHTKGIGAKLLAKMGWAEGEGLGRDRRGISKPLEAKLRPKGMGMG  304



>ref|NP_001091088.1| Sip1/TFIP11 interacting protein [Ciona intestinalis]
 gb|ABC69930.1| STIP [Ciona intestinalis]
Length=832

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            F SFE HT+G G K++ KMG+  G GLGK +QGI  PI A +R K  GLGA
Sbjct  144  FASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGA  194



>ref|XP_005645320.1| hypothetical protein COCSUDRAFT_57335 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20776.1| hypothetical protein COCSUDRAFT_57335 [Coccomyxa subellipsoidea 
C-169]
Length=582

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            FGSFE HT GFGS+M+AK GF  +G GLG++SQG   PI A  RPK+ GLGA 
Sbjct  528  FGSFERHTTGFGSRMLAKYGFEGQGAGLGRNSQGRAEPINAVMRPKNLGLGAN  580


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTG--GGLGKDGQGIAEPIQVSQRPKALGLGAD  628
            HTTG GS+M+ K GF G   GLG++ QG AEPI    RPK LGLGA+
Sbjct  534  HTTGFGSRMLAKYGFEGQGAGLGRNSQGRAEPINAVMRPKNLGLGAN  580



>gb|KJB44347.1| hypothetical protein B456_007G247300 [Gossypium raimondii]
Length=853

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            GSFE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  191  GSFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  238


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVPETSTANE  601
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P      E
Sbjct  196  HTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKEAKLPGLQQLEE  255

Query  600  TKTPTPKSVG  571
             K+ + + VG
Sbjct  256  KKSVSQQPVG  265



>gb|KHG03685.1| Tuftelin-interacting 11 [Gossypium arboreum]
 gb|KHG18046.1| Tuftelin-interacting 11 [Gossypium arboreum]
Length=853

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            GSFE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  191  GSFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  238


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG------ADVPETSTANE  601
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G      A +P      E
Sbjct  196  HTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKEAKLPGLQQLEE  255

Query  600  TKTPTPKSVG  571
             K+ + + VG
Sbjct  256  KKSVSQQPVG  265



>ref|XP_009399051.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Musa acuminata subsp. malaccensis]
Length=853

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G F+++TKG G K+M  MG+ EG+GLGK+ QGI API A  RPK+ G+G
Sbjct  188  GKFQSYTKGIGFKLMKMMGYKEGSGLGKNEQGIVAPIEAKLRPKNMGMG  236



>ref|XP_009861899.1| PREDICTED: sip1/TFIP11 interacting protein isoform X1 [Ciona 
intestinalis]
 ref|XP_009861900.1| PREDICTED: sip1/TFIP11 interacting protein isoform X1 [Ciona 
intestinalis]
Length=826

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            F SFE HT+G G K++ KMG+  G GLGK +QGI  PI A +R K  GLGA
Sbjct  144  FASFERHTRGIGMKLLTKMGYKHGKGLGKGNQGIINPIEALKRTKKAGLGA  194



>ref|XP_005649692.1| TFP11-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25148.1| TFP11-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=862

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  492  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            P  G FE HTKG G+K++A MG+ EG GLG++ QGI+ PI    RPK  G+G
Sbjct  195  PSVGEFERHTKGIGAKLLAGMGYKEGEGLGRNRQGISKPIEVKLRPKGMGMG  246



>ref|XP_011098023.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Sesamum indicum]
Length=859

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  188  GVGAFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPIEAKMRPKNMGMG  237


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  634
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  195  HTKGIGMKLLEKMGYKGGGLGKNEQGILAPIEAKMRPKNMGMG  237



>ref|XP_007058458.1| PREDICTED: tuftelin-interacting protein 11 [Chelonia mydas]
Length=776

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  188



>ref|XP_002501462.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62720.1| predicted protein [Micromonas sp. RCC299]
Length=1485

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -2

Query  486   FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGAK  331
             FG+FE HT GFGS+M+AKMGF  EG G+GKD +GI+ PI A+ R K  GLGA+
Sbjct  1431  FGAFEAHTSGFGSRMLAKMGFQGEGAGMGKDGRGISEPIAASIRGKRVGLGAE  1483


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = -2

Query  762   HTTGXGSKMMVKMGF--TGGGLGKDGQGIAEPIQVSQRPKALGLGAD  628
             HT+G GS+M+ KMGF   G G+GKDG+GI+EPI  S R K +GLGA+
Sbjct  1437  HTSGFGSRMLAKMGFQGEGAGMGKDGRGISEPIAASIRGKRVGLGAE  1483



>gb|EMP37184.1| Tuftelin-interacting protein 11 [Chelonia mydas]
Length=1157

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  506  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  556



>ref|XP_006137534.1| PREDICTED: tuftelin-interacting protein 11 [Pelodiscus sinensis]
Length=872

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  183  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  233



>ref|XP_005298544.1| PREDICTED: tuftelin-interacting protein 11 [Chrysemys picta bellii]
Length=827

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     LGA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGALGA  188



>gb|ABC69931.1| STIP [Ciona savignyi]
Length=820

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            F SFE HTKG G K++ KMG+  G GLGK +QGI  P+ A +R K  GLG+
Sbjct  141  FASFERHTKGIGMKLLTKMGYRHGRGLGKGNQGIINPVEAIKRNKKAGLGS  191



>ref|XP_001418877.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97170.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=105

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  334
            +G+FE HT GFGS+M+AKMGF  +G+G+G++ +GI  P+ AT R K  GLGA
Sbjct  49   YGAFEKHTTGFGSRMLAKMGFQGQGSGVGREGEGIAEPVTATTRGKRVGLGA  100


 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTG--GGLGKDGQGIAEPIQVSQRPKALGLGA  631
            HTTG GS+M+ KMGF G   G+G++G+GIAEP+  + R K +GLGA
Sbjct  55   HTTGFGSRMLAKMGFQGQGSGVGREGEGIAEPVTATTRGKRVGLGA  100



>ref|XP_003080850.1| Tuftelin-interacting protein TIP39, contains G-patch domain (ISS) 
[Ostreococcus tauri]
 emb|CAL55018.1| G-patch domain [Ostreococcus tauri]
Length=328

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            G G+FE HT+GFGS+++A+ GF  G+GLG+++QGI  P+ A  R K  GLGA
Sbjct  277  GMGAFEAHTRGFGSRILARFGFKPGSGLGRENQGIVEPLSAETRAKRAGLGA  328



>ref|XP_008339239.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11-like [Malus domestica]
Length=875

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G G+FE HTKG G KM+  MG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  201  GLGAFEKHTKGIGMKMLKNMGY-KGGGLGKNEQGILAPIEAKLRPKNMGMG  250


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 5/60 (8%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETSTANETKTPT  586
            HT G G KM+  MG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ET    E K P+
Sbjct  208  HTKGIGMKMLKNMGYKGGGLGKNEQGILAPIEAKLRPKNMGMGFNDYKET----EVKRPS  263



>ref|XP_004615574.1| PREDICTED: tuftelin-interacting protein 11 [Sorex araneus]
Length=837

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIVNPIEAKQRKGKGAVGA  192



>ref|XP_008140712.1| PREDICTED: tuftelin-interacting protein 11 [Eptesicus fuscus]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192



>ref|XP_006261823.1| PREDICTED: tuftelin-interacting protein 11 [Alligator mississippiensis]
Length=828

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI +PI A +R     +GA
Sbjct  139  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIISPIEAKQRKGKGAVGA  189



>ref|XP_005869775.1| PREDICTED: tuftelin-interacting protein 11 [Myotis brandtii]
 gb|EPQ09886.1| Tuftelin-interacting protein 11 [Myotis brandtii]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192



>ref|XP_006102063.1| PREDICTED: tuftelin-interacting protein 11 [Myotis lucifugus]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192



>ref|XP_006015340.1| PREDICTED: tuftelin-interacting protein 11 [Alligator sinensis]
Length=853

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI +PI A +R     +GA
Sbjct  164  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIISPIEAKQRKGKGAVGA  214



>gb|EPS61679.1| hypothetical protein M569_13115, partial [Genlisea aurea]
Length=782

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G GSF  HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  153  GVGSFGKHTKGIGLKLLEKMGY-KGGGLGKNEQGIIAPIEAKLRPKNMGMG  202


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  634
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  160  HTKGIGLKLLEKMGYKGGGLGKNEQGIIAPIEAKLRPKNMGMG  202



>ref|XP_006762106.1| PREDICTED: tuftelin-interacting protein 11 [Myotis davidii]
 gb|ELK31482.1| Tuftelin-interacting protein 11 [Myotis davidii]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIITPIEAKQRKGKGAVGA  192



>ref|XP_010117527.1| PREDICTED: tuftelin-interacting protein 11, partial [Chlamydotis 
macqueenii]
Length=780

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  91   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  141



>ref|XP_010016065.1| PREDICTED: tuftelin-interacting protein 11, partial [Nestor notabilis]
Length=776

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  87   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  137



>ref|XP_009676417.1| PREDICTED: tuftelin-interacting protein 11 [Struthio camelus 
australis]
Length=811

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  122  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  172



>ref|XP_002524028.1| tuftelin interacting protein, putative [Ricinus communis]
 gb|EEF38396.1| tuftelin interacting protein, putative [Ricinus communis]
Length=883

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  209  GEFEKHTKGIGMKLLEKMGY-KGGGLGKNEQGILAPIEAKLRPKNMGMG  256


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  613
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G  D  ETS
Sbjct  214  HTKGIGMKLLEKMGYKGGGLGKNEQGILAPIEAKLRPKNMGMGFNDYKETS  264



>ref|XP_005144938.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11 [Melopsittacus undulatus]
Length=839

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_010373885.1| PREDICTED: tuftelin-interacting protein 11 [Rhinopithecus roxellana]
 ref|XP_010373886.1| PREDICTED: tuftelin-interacting protein 11 [Rhinopithecus roxellana]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_003789889.1| PREDICTED: tuftelin-interacting protein 11 [Otolemur garnettii]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>emb|CAL37965.1| hypothetical protein [synthetic construct]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_008462814.1| PREDICTED: tuftelin-interacting protein 11 [Cucumis melo]
Length=871

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -2

Query  492  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            PG  G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  197  PGNVGAFEKHTKGIGLKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  248


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 7/69 (10%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD-------VPETSTAN  604
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +       +P      
Sbjct  206  HTKGIGLKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFNDFKEAPKIPALQEVE  265

Query  603  ETKTPTPKS  577
            E   P P +
Sbjct  266  EKSLPQPTT  274



>ref|XP_009633041.1| PREDICTED: tuftelin-interacting protein 11 [Egretta garzetta]
Length=780

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  91   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  141



>ref|XP_009281103.1| PREDICTED: tuftelin-interacting protein 11 [Aptenodytes forsteri]
Length=777

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  88   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  138



>ref|XP_005336129.1| PREDICTED: tuftelin-interacting protein 11 [Ictidomys tridecemlineatus]
Length=821

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_006869252.1| PREDICTED: tuftelin-interacting protein 11 [Chrysochloris asiatica]
Length=834

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_008050251.1| PREDICTED: tuftelin-interacting protein 11 [Tarsius syrichta]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|NP_001126744.1| tuftelin-interacting protein 11 [Pongo abelii]
 sp|Q5R5K8.1|TFP11_PONAB RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Pongo 
abelii]
 emb|CAH92958.1| hypothetical protein [Pongo abelii]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|NP_001073621.1| tuftelin-interacting protein 11 [Pan troglodytes]
 sp|A1XD93.1|TFP11_PANTR RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Pan 
troglodytes]
 gb|ABC69918.1| STIP [Pan troglodytes]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|NP_001073589.1| tuftelin-interacting protein 11 [Macaca mulatta]
 ref|XP_005567787.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Macaca 
fascicularis]
 ref|XP_005567788.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Macaca 
fascicularis]
 ref|XP_005567789.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Macaca 
fascicularis]
 ref|XP_007973422.1| PREDICTED: tuftelin-interacting protein 11 [Chlorocebus sabaeus]
 ref|XP_007973423.1| PREDICTED: tuftelin-interacting protein 11 [Chlorocebus sabaeus]
 ref|XP_009215244.1| PREDICTED: tuftelin-interacting protein 11 [Papio anubis]
 ref|XP_009215245.1| PREDICTED: tuftelin-interacting protein 11 [Papio anubis]
 ref|XP_009215246.1| PREDICTED: tuftelin-interacting protein 11 [Papio anubis]
 sp|A1XD94.1|TFP11_MACMU RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Macaca 
mulatta]
 gb|ABC69919.1| STIP [Macaca mulatta]
 gb|EHH20106.1| hypothetical protein EGK_02894 [Macaca mulatta]
 gb|EHH65715.1| hypothetical protein EGM_02538 [Macaca fascicularis]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|NP_036275.1| tuftelin-interacting protein 11 [Homo sapiens]
 ref|NP_001008697.1| tuftelin-interacting protein 11 [Homo sapiens]
 ref|XP_003820230.1| PREDICTED: tuftelin-interacting protein 11 [Pan paniscus]
 ref|XP_004063258.1| PREDICTED: tuftelin-interacting protein 11 [Gorilla gorilla gorilla]
 ref|XP_008971830.1| PREDICTED: tuftelin-interacting protein 11 [Pan paniscus]
 sp|Q9UBB9.1|TFP11_HUMAN RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Homo 
sapiens]
 emb|CAB43360.1| hypothetical protein [Homo sapiens]
 emb|CAB45740.1| hypothetical protein [Homo sapiens]
 gb|AAH11599.1| Tuftelin interacting protein 11 [Homo sapiens]
 gb|AAP35938.1| tuftelin interacting protein 11 [Homo sapiens]
 emb|CAI17878.1| tuftelin interacting protein 11 [Homo sapiens]
 gb|AAX42152.1| tuftelin interacting protein 11 [synthetic construct]
 emb|CAJ86441.1| bK445C9.6 [Homo sapiens]
 emb|CAK54393.1| TFIP11 [synthetic construct]
 emb|CAK54692.1| TFIP11 [synthetic construct]
 gb|EAW59723.1| tuftelin interacting protein 11, isoform CRA_b [Homo sapiens]
 gb|EAW59724.1| tuftelin interacting protein 11, isoform CRA_b [Homo sapiens]
 gb|ABM83177.1| tuftelin interacting protein 11 [synthetic construct]
 gb|ABM87848.1| tuftelin interacting protein 11 [synthetic construct]
 dbj|BAG10606.1| tuftelin-interacting protein 11 [synthetic construct]
 gb|AIC56104.1| TFIP11, partial [synthetic construct]
Length=837

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_009332696.1| PREDICTED: tuftelin-interacting protein 11 [Pygoscelis adeliae]
Length=779

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  90   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  140



>ref|XP_009006562.1| PREDICTED: tuftelin-interacting protein 11 [Callithrix jacchus]
 ref|XP_009006567.1| PREDICTED: tuftelin-interacting protein 11 [Callithrix jacchus]
 ref|XP_009006571.1| PREDICTED: tuftelin-interacting protein 11 [Callithrix jacchus]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_006213616.1| PREDICTED: tuftelin-interacting protein 11 [Vicugna pacos]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_006185809.1| PREDICTED: tuftelin-interacting protein 11 [Camelus ferus]
 ref|XP_010949573.1| PREDICTED: tuftelin-interacting protein 11 [Camelus bactrianus]
 ref|XP_010990626.1| PREDICTED: tuftelin-interacting protein 11 [Camelus dromedarius]
 gb|EPY80348.1| tuftelin-interacting protein 11 [Camelus ferus]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_003277776.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11 [Nomascus leucogenys]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|NP_001073577.1| tuftelin-interacting protein 11 [Canis lupus familiaris]
 ref|XP_005636074.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Canis 
lupus familiaris]
 sp|A1XD97.1|TFP11_CANFA RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Canis 
lupus familiaris]
 gb|ABC69922.1| STIP [Canis lupus familiaris]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>gb|AAH33080.1| Tuftelin interacting protein 11 [Homo sapiens]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|NP_001087642.1| tuftelin-interacting protein 11 [Xenopus laevis]
 sp|Q66J74.1|TFP11_XENLA RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Xenopus 
laevis]
 gb|AAH81033.1| MGC81713 protein [Xenopus laevis]
 gb|ABC69925.1| STIP [Xenopus laevis]
Length=824

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG++ G GLGK++QGI API A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYMPGRGLGKNAQGIIAPIEAKQRRGKGAVGA  188



>ref|XP_010081004.1| PREDICTED: tuftelin-interacting protein 11 [Pterocles gutturalis]
Length=771

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  82   FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  132



>ref|XP_004479136.1| PREDICTED: tuftelin-interacting protein 11 [Dasypus novemcinctus]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  192



>gb|KFQ39573.1| Tuftelin-interacting protein 11 [Mesitornis unicolor]
Length=811

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  122  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  172



>ref|XP_009927441.1| PREDICTED: tuftelin-interacting protein 11, partial [Haliaeetus 
albicilla]
Length=789

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  100  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  150



>ref|XP_003761206.1| PREDICTED: tuftelin-interacting protein 11 [Sarcophilus harrisii]
Length=834

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  141  FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  191



>ref|NP_001091078.1| tuftelin-interacting protein 11 [Monodelphis domestica]
 ref|XP_007490114.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Monodelphis 
domestica]
 ref|XP_007490115.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Monodelphis 
domestica]
 sp|A4UMC6.1|TFP11_MONDO RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Monodelphis 
domestica]
 gb|ABP04113.1| septin and tuftelin-interacting protein 1 [Monodelphis domestica]
Length=834

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  141  FGSWERHTKGIGQKLLQKMGYVPGKGLGKNAQGIINPIEAKQRKGKGAVGA  191



>ref|XP_010347495.1| PREDICTED: tuftelin-interacting protein 11 [Saimiri boliviensis 
boliviensis]
 ref|XP_010347496.1| PREDICTED: tuftelin-interacting protein 11 [Saimiri boliviensis 
boliviensis]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_010718697.1| PREDICTED: tuftelin-interacting protein 11 [Meleagris gallopavo]
Length=854

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  165  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  215



>gb|ELK18625.1| Tuftelin-interacting protein 11 [Pteropus alecto]
Length=860

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  165  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  215



>sp|A1XD95.1|TFP11_MACFA RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Macaca 
fascicularis]
 gb|ABC69920.1| STIP [Macaca fascicularis]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_008576508.1| PREDICTED: tuftelin-interacting protein 11 [Galeopterus variegatus]
Length=838

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>ref|XP_004164520.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11-like [Cucumis sativus]
Length=872

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -2

Query  492  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            PG  G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  198  PGNVGAFEKHTKGIGLKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  249


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 7/69 (10%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD-------VPETSTAN  604
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +       +P      
Sbjct  207  HTKGIGLKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMGFNDFKEAPKIPALQEVE  266

Query  603  ETKTPTPKS  577
            E   P P S
Sbjct  267  EKTLPQPTS  275



>ref|XP_003994807.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Felis 
catus]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQRKGKGAVGA  192



>ref|XP_010188640.1| PREDICTED: tuftelin-interacting protein 11 [Mesitornis unicolor]
Length=795

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  106  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  156



>ref|XP_004151854.1| PREDICTED: tuftelin-interacting protein 11-like [Cucumis sativus]
 gb|KGN63340.1| hypothetical protein Csa_2G431100 [Cucumis sativus]
Length=871

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -2

Query  492  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            PG  G+FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  197  PGNVGAFEKHTKGIGLKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  248


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 7/69 (10%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGAD-------VPETSTAN  604
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +       +P      
Sbjct  206  HTKGIGLKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMGFNDFKEAPKIPALQEVE  265

Query  603  ETKTPTPKS  577
            E   P P S
Sbjct  266  EKTLPQPTS  274



>ref|XP_006904928.1| PREDICTED: tuftelin-interacting protein 11 [Pteropus alecto]
 ref|XP_011372946.1| PREDICTED: tuftelin-interacting protein 11 [Pteropus vampyrus]
 ref|XP_011372947.1| PREDICTED: tuftelin-interacting protein 11 [Pteropus vampyrus]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_004766607.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Mustela 
putorius furo]
 ref|XP_004766608.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Mustela 
putorius furo]
 ref|XP_004766609.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Mustela 
putorius furo]
 ref|XP_004816058.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Mustela 
putorius furo]
 ref|XP_004816059.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Mustela 
putorius furo]
 ref|XP_004816060.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Mustela 
putorius furo]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_002922821.1| PREDICTED: tuftelin-interacting protein 11 [Ailuropoda melanoleuca]
 ref|XP_011227643.1| PREDICTED: tuftelin-interacting protein 11 [Ailuropoda melanoleuca]
 gb|EFB16402.1| hypothetical protein PANDA_011839 [Ailuropoda melanoleuca]
Length=837

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>gb|KFO88150.1| Tuftelin-interacting protein 11, partial [Buceros rhinoceros 
silvestris]
Length=795

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122



>ref|XP_010094613.1| Tuftelin-interacting protein 11 [Morus notabilis]
 gb|EXB56432.1| Tuftelin-interacting protein 11 [Morus notabilis]
Length=940

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FE HTKG G K++ KMG+ +G GLGK++QGI API A  RPK+ G+G
Sbjct  294  GGFEKHTKGIGMKLLEKMGY-KGGGLGKNAQGIVAPIEAKLRPKNMGMG  341


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  634
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  299  HTKGIGMKLLEKMGYKGGGLGKNAQGIVAPIEAKLRPKNMGMG  341



>ref|XP_009466848.1| PREDICTED: tuftelin-interacting protein 11 [Nipponia nippon]
Length=814

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  125  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  175



>ref|NP_001070682.1| tuftelin-interacting protein 11 [Sus scrofa]
 sp|Q06AK6.1|TFP11_PIG RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Sus 
scrofa]
 gb|ABI95149.1| septin and tuftelin-interacting protein [Sus scrofa]
Length=836

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_010602003.1| PREDICTED: tuftelin-interacting protein 11 [Fukomys damarensis]
 gb|KFO23600.1| Tuftelin-interacting protein 11 [Fukomys damarensis]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_006738156.1| PREDICTED: tuftelin-interacting protein 11 [Leptonychotes weddellii]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_005396205.1| PREDICTED: tuftelin-interacting protein 11 [Chinchilla lanigera]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_004690914.1| PREDICTED: tuftelin-interacting protein 11 [Condylura cristata]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_004429903.1| PREDICTED: tuftelin-interacting protein 11 [Ceratotherium simum 
simum]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_004412506.1| PREDICTED: tuftelin-interacting protein 11 [Odobenus rosmarus 
divergens]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_004893175.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004893176.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004843406.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004843407.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Heterocephalus 
glaber]
 gb|EHB08443.1| Tuftelin-interacting protein 11 [Heterocephalus glaber]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_009082323.1| PREDICTED: tuftelin-interacting protein 11 [Acanthisitta chloris]
 gb|KFP73454.1| Tuftelin-interacting protein 11 [Acanthisitta chloris]
Length=827

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_005230545.1| PREDICTED: tuftelin-interacting protein 11 [Falco peregrinus]
 ref|XP_005439614.1| PREDICTED: tuftelin-interacting protein 11 [Falco cherrug]
Length=827

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|NP_001025836.1| tuftelin-interacting protein 11 [Gallus gallus]
 sp|Q5ZII9.1|TFP11_CHICK RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Gallus 
gallus]
 emb|CAG32454.1| hypothetical protein RCJMB04_25m16 [Gallus gallus]
Length=827

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_001499886.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Equus 
caballus]
 ref|XP_005612536.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Equus 
caballus]
 ref|XP_005612537.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Equus 
caballus]
 ref|XP_005612538.1| PREDICTED: tuftelin-interacting protein 11 isoform X4 [Equus 
caballus]
 ref|XP_005612539.1| PREDICTED: tuftelin-interacting protein 11 isoform X5 [Equus 
caballus]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGHKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_006890530.1| PREDICTED: tuftelin-interacting protein 11 [Elephantulus edwardii]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_004387681.1| PREDICTED: tuftelin-interacting protein 11 [Trichechus manatus 
latirostris]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_004628080.1| PREDICTED: tuftelin-interacting protein 11 [Octodon degus]
Length=838

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>ref|XP_007082567.1| PREDICTED: tuftelin-interacting protein 11 isoform X4 [Panthera 
tigris altaica]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQRKGKGAVGA  192



>ref|XP_004715371.1| PREDICTED: tuftelin-interacting protein 11 [Echinops telfairi]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_010580348.1| PREDICTED: tuftelin-interacting protein 11 [Haliaeetus leucocephalus]
Length=827

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_008684908.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11 [Ursus maritimus]
Length=831

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|NP_001008292.1| tuftelin-interacting protein 11 [Rattus norvegicus]
 sp|Q5U2Y6.1|TFP11_RAT RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Rattus 
norvegicus]
 gb|AAH85809.1| Tuftelin interacting protein 11 [Rattus norvegicus]
 gb|ABC69923.1| STIP [Rattus norvegicus]
 gb|EDM14003.1| tuftelin interacting protein 11 [Rattus norvegicus]
Length=837

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>gb|EKC18985.1| Tuftelin-interacting protein 11 [Crassostrea gigas]
Length=896

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            GFG +E HT+G G K++ KMGF  G GLGK  QGIT P+ A +R     +GA
Sbjct  206  GFGEWERHTRGVGKKLLEKMGFKPGEGLGKHGQGITTPVEAVKRKGKAAVGA  257



>ref|XP_009558777.1| PREDICTED: tuftelin-interacting protein 11 [Cuculus canorus]
 gb|KFO75876.1| Tuftelin-interacting protein 11 [Cuculus canorus]
Length=827

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_005498249.1| PREDICTED: tuftelin-interacting protein 11 [Columba livia]
 gb|EMC86848.1| Tuftelin-interacting protein 11 [Columba livia]
Length=827

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_003478401.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Cavia 
porcellus]
 ref|XP_005007347.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Cavia 
porcellus]
Length=837

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|NP_001093435.1| tuftelin-interacting protein 11 [Oryctolagus cuniculus]
 sp|A4UMC5.1|TFP11_RABIT RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Oryctolagus 
cuniculus]
 gb|ABP04112.1| septin and tuftelin-interacting protein [Oryctolagus cuniculus]
Length=837

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_001499556.2| PREDICTED: tuftelin-interacting protein 11-like [Equus caballus]
Length=836

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIIKPIEAKQRKGRGAVGA  192



>ref|XP_009887465.1| PREDICTED: tuftelin-interacting protein 11 [Charadrius vociferus]
Length=801

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  112  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  162



>ref|XP_008272828.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Oryctolagus 
cuniculus]
 ref|XP_008272829.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Oryctolagus 
cuniculus]
 ref|XP_008272830.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Oryctolagus 
cuniculus]
Length=837

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_009908031.1| PREDICTED: tuftelin-interacting protein 11 [Picoides pubescens]
Length=821

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_008847245.1| PREDICTED: tuftelin-interacting protein 11 [Nannospalax galili]
Length=836

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_003506733.1| PREDICTED: tuftelin-interacting protein 11 [Cricetulus griseus]
 ref|XP_007645410.1| PREDICTED: tuftelin-interacting protein 11 [Cricetulus griseus]
 gb|EGW07191.1| Tuftelin-interacting protein 11 [Cricetulus griseus]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_010528677.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Tarenaya hassleriana]
Length=880

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGAK  331
            G FE  TKGFG KM+ KMG+ +G GLGK+ QGI AP+ A  RPK+ G+G K
Sbjct  212  GQFEKFTKGFGMKMLEKMGY-KGGGLGKNEQGIVAPVEAQLRPKNMGMGYK  261


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query  759  TTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  613
            T G G KM+ KMG+ GGGLGK+ QGI  P++   RPK +G+G  D  E+S
Sbjct  218  TKGFGMKMLEKMGYKGGGLGKNEQGIVAPVEAQLRPKNMGMGYKDFKESS  267



>emb|CDP06007.1| unnamed protein product [Coffea canephora]
Length=847

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -2

Query  492  PG-FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            PG  GSFE HTKG G +++ KMG+ +G GLGK+ QGI +PI A  RPK+ G+G
Sbjct  185  PGDVGSFEKHTKGIGLRLLEKMGY-KGGGLGKNEQGIVSPIQAKLRPKNMGMG  236


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG-ADVPETS  613
            HT G G +++ KMG+ GGGLGK+ QGI  PIQ   RPK +G+G  D  ET+
Sbjct  194  HTKGIGLRLLEKMGYKGGGLGKNEQGIVSPIQAKLRPKNMGMGFNDYKETN  244



>ref|XP_010396785.1| PREDICTED: tuftelin-interacting protein 11 [Corvus cornix cornix]
Length=805

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  116  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  166



>gb|KFV77367.1| Tuftelin-interacting protein 11 [Picoides pubescens]
Length=833

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_004893177.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Heterocephalus 
glaber]
 ref|XP_004843408.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Heterocephalus 
glaber]
Length=804

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_007627359.1| PREDICTED: tuftelin-interacting protein 11 [Cricetulus griseus]
 gb|ERE76805.1| tuftelin-interacting protein 11 [Cricetulus griseus]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|NP_001039495.2| tuftelin-interacting protein 11 [Bos taurus]
 ref|XP_005218116.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Bos taurus]
 tpg|DAA20524.1| TPA: tuftelin-interacting protein 11 [Bos taurus]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_005489007.1| PREDICTED: tuftelin-interacting protein 11 [Zonotrichia albicollis]
Length=827

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_010223913.1| PREDICTED: tuftelin-interacting protein 11, partial [Tinamus 
guttatus]
Length=777

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  88   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  138



>ref|XP_008492988.1| PREDICTED: tuftelin-interacting protein 11 [Calypte anna]
Length=786

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  97   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  147



>ref|XP_008632303.1| PREDICTED: tuftelin-interacting protein 11 [Corvus brachyrhynchos]
Length=827

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_009090637.1| PREDICTED: tuftelin-interacting protein 11 [Serinus canaria]
Length=827

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_005421487.1| PREDICTED: tuftelin-interacting protein 11 [Geospiza fortis]
Length=827

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_007946133.1| PREDICTED: tuftelin-interacting protein 11 [Orycteropus afer 
afer]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>sp|Q29RR5.2|TFP11_BOVIN RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1 [Bos 
taurus]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>gb|AAI14059.1| Tuftelin interacting protein 11 [Bos taurus]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_005078969.1| PREDICTED: tuftelin-interacting protein 11 [Mesocricetus auratus]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>gb|ABC69921.1| STIP [Bos taurus]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>dbj|BAE28260.1| unnamed protein product [Mus musculus]
Length=838

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>gb|AAH17682.1| Tuftelin interacting protein 11 [Mus musculus]
Length=838

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>ref|XP_006147932.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11 [Tupaia chinensis]
Length=844

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_002197903.1| PREDICTED: tuftelin-interacting protein 11 [Taeniopygia guttata]
Length=827

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_005524389.1| PREDICTED: tuftelin-interacting protein 11 [Pseudopodoces humilis]
Length=827

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|NP_061253.2| tuftelin-interacting protein 11 [Mus musculus]
 sp|Q9ERA6.1|TFP11_MOUSE RecName: Full=Tuftelin-interacting protein 11; AltName: Full=Septin 
and tuftelin-interacting protein 1; Short=STIP-1; AltName: 
Full=Tuftelin-interacting protein 39 [Mus musculus]
 gb|AAG10198.2|AF290474_1 tuftelin-interacting protein 39 [Mus musculus]
 dbj|BAE36218.1| unnamed protein product [Mus musculus]
 dbj|BAE28444.1| unnamed protein product [Mus musculus]
 gb|EDL19976.1| tuftelin interacting protein 11 [Mus musculus]
Length=838

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>ref|XP_006055630.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Bubalus 
bubalis]
 ref|XP_006055631.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Bubalus 
bubalis]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_006984175.1| PREDICTED: tuftelin-interacting protein 11 [Peromyscus maniculatus 
bairdii]
Length=837

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_007181010.1| PREDICTED: tuftelin-interacting protein 11 [Balaenoptera acutorostrata 
scammoni]
Length=838

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>ref|XP_011449175.1| PREDICTED: tuftelin-interacting protein 11-like [Crassostrea 
gigas]
Length=817

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            GFG +E HT+G G K++ KMGF  G GLGK  QGIT P+ A +R     +GA
Sbjct  127  GFGEWERHTRGVGKKLLEKMGFKPGEGLGKHGQGITTPVEAVKRKGKAAVGA  178



>ref|XP_004283827.1| PREDICTED: tuftelin-interacting protein 11 [Orcinus orca]
Length=838

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>ref|XP_005344283.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Microtus 
ochrogaster]
 ref|XP_005344284.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Microtus 
ochrogaster]
Length=837

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_005055056.1| PREDICTED: tuftelin-interacting protein 11 [Ficedula albicollis]
Length=827

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>gb|EHB00444.1| G patch domain-containing protein 2, partial [Heterocephalus 
glaber]
Length=527

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 5/58 (9%)
 Frame = -2

Query  747  GSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKS  577
            G++M+  MG+T G GLG+DG+GIAEPIQ  QRP+ LGLG  +P++++A    TPTP S
Sbjct  471  GNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPRGLGLGFPLPKSTSA----TPTPAS  524



>ref|XP_004880608.1| PREDICTED: G patch domain-containing protein 2 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004867444.1| PREDICTED: G patch domain-containing protein 2 [Heterocephalus 
glaber]
Length=528

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 5/58 (9%)
 Frame = -2

Query  747  GSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTPKS  577
            G++M+  MG+T G GLG+DG+GIAEPIQ  QRP+ LGLG  +P++++A    TPTP S
Sbjct  471  GNRMLQNMGWTPGSGLGRDGKGIAEPIQAMQRPRGLGLGFPLPKSTSA----TPTPAS  524



>gb|KFO59493.1| Tuftelin-interacting protein 11 [Corvus brachyrhynchos]
Length=827

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  138  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  188



>ref|XP_004592001.1| PREDICTED: tuftelin-interacting protein 11 [Ochotona princeps]
Length=838

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>ref|XP_011399724.1| hypothetical protein F751_0708 [Auxenochlorella protothecoides]
 gb|KFM26776.1| hypothetical protein F751_0708 [Auxenochlorella protothecoides]
Length=955

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  489  GFGSFENHTKGFGSKMMAKMGFV-EGTGLGKDSQGITAPILATRRPKSQGLGA  334
            G+G FE HT G GSK+++K GF  EG GLGKD  G+T P+L ++R + +GLGA
Sbjct  903  GYGQFERHTTGIGSKLLSKWGFAGEGAGLGKDGVGLTEPLLVSQRARQRGLGA  955


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 2/46 (4%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTG--GGLGKDGQGIAEPIQVSQRPKALGLGA  631
            HTTG GSK++ K GF G   GLGKDG G+ EP+ VSQR +  GLGA
Sbjct  910  HTTGIGSKLLSKWGFAGEGAGLGKDGVGLTEPLLVSQRARQRGLGA  955



>gb|ABC69949.1| STIP [Chlamydomonas reinhardtii]
Length=844

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  492  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            P F +FE HTKG G K++ KMG+  G GLG++ QGI  P+ A  RPK  GLG
Sbjct  182  PTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNKQGIARPVEARMRPKGMGLG  233



>ref|XP_007461197.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007461198.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Lipotes 
vexillifer]
Length=838

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>emb|CDQ06825.1| Protein Bm9097, isoform a [Brugia malayi]
Length=434

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 58/131 (44%), Gaps = 27/131 (21%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGG-GLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPT  586
            HT G G K+++KMG+  G GLG+   GI   IQ    PK      D+  TS+  E K   
Sbjct  182  HTRGIGMKLLLKMGYRAGEGLGRKSDGIVHAIQPVIFPKNEAATNDLA-TSSWKEYKQER  240

Query  585  PKSVGFGEDLPTRsrksgkkgsqgqkaqygSPGFGSFENHTKGFGSKMMAKMGFVEGTGL  406
              +V  G+                          G +E HT+G G K++ KMG+  G GL
Sbjct  241  RGNVTIGD-------------------------IGDWEKHTRGIGMKLLLKMGYRAGEGL  275

Query  405  GKDSQGITAPI  373
            G+ S GI   I
Sbjct  276  GRKSDGIVHAI  286



>ref|XP_010553814.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1-like [Tarenaya hassleriana]
Length=881

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FE  TKGFG KM+ KMG+ +G GLGK+ QGI API A  RPK  G+G
Sbjct  213  GQFEKFTKGFGMKMLEKMGY-KGGGLGKNEQGIVAPIQAQLRPKKMGMG  260


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 11/75 (15%)
 Frame = -2

Query  759  TTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGL--------GADVPETSTAN  604
            T G G KM+ KMG+ GGGLGK+ QGI  PIQ   RPK +G+        GA +P T    
Sbjct  219  TKGFGMKMLEKMGYKGGGLGKNEQGIVAPIQAQLRPKKMGMGYNDFKETGAKLPGTKQVE  278

Query  603  ETKTPTPKSVGFGED  559
            E KT T   +G  E+
Sbjct  279  EKKTVT---IGISEN  290



>ref|XP_006938603.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Felis 
catus]
Length=862

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQRKGKGAVGA  192



>ref|XP_006938601.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Felis 
catus]
 ref|XP_006938602.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Felis 
catus]
Length=864

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQRKGKGAVGA  192



>ref|XP_007082566.1| PREDICTED: tuftelin-interacting protein 11 isoform X3 [Panthera 
tigris altaica]
Length=862

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQRKGKGAVGA  192



>ref|XP_007101983.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Physeter 
catodon]
 ref|XP_007101984.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Physeter 
catodon]
Length=838

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  143  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  193



>gb|KFU89033.1| Tuftelin-interacting protein 11, partial [Chaetura pelagica]
Length=784

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  95   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  145



>ref|XP_007082564.1| PREDICTED: tuftelin-interacting protein 11 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007082565.1| PREDICTED: tuftelin-interacting protein 11 isoform X2 [Panthera 
tigris altaica]
Length=864

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEARQRKGKGAVGA  192



>ref|XP_010827007.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 
11 [Bison bison bison]
Length=842

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>gb|KDP39564.1| hypothetical protein JCGZ_02584 [Jatropha curcas]
Length=870

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  199  GEFEKHTKGIGFKLLEKMGY-KGGGLGKNEQGIVAPIEAKMRPKNMGMG  246


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 5/63 (8%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTPTP  583
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +        E K P P
Sbjct  204  HTKGIGFKLLEKMGYKGGGLGKNEQGIVAPIEAKMRPKNMGMGFN-----DFKEAKLPQP  258

Query  582  KSV  574
            + +
Sbjct  259  EEI  261



>ref|XP_001702893.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96850.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=786

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  492  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            P F +FE HTKG G K++ KMG+  G GLG++ QGI  P+ A  RPK  GLG
Sbjct  99   PTFATFEKHTKGIGLKLLEKMGYKAGEGLGRNKQGIARPVEARMRPKGMGLG  150



>ref|XP_007525292.1| PREDICTED: tuftelin-interacting protein 11 [Erinaceus europaeus]
Length=839

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  150  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  200



>ref|XP_004330837.1| PREDICTED: tuftelin-interacting protein 11-like, partial [Tursiops 
truncatus]
Length=767

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  72   FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  122



>ref|XP_006836389.1| hypothetical protein AMTR_s00092p00133670 [Amborella trichopoda]
 gb|ERM99242.1| hypothetical protein AMTR_s00092p00133670 [Amborella trichopoda]
Length=877

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FE HTKG G +++ KMG+ +G GLGK++QGI API A  RPK+ G+G
Sbjct  199  GEFEKHTKGIGMRLLEKMGY-KGGGLGKNAQGIVAPIEAKLRPKNMGMG  246


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANETKTP  589
            HT G G +++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G +  E  +      P
Sbjct  204  HTKGIGMRLLEKMGYKGGGLGKNAQGIVAPIEAKLRPKNMGMGYNSYEEKSMGLAPLP  261



>gb|ELR60645.1| Tuftelin-interacting protein 11 [Bos mutus]
Length=839

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  142  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  192



>ref|XP_010670678.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670679.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670680.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670681.1| PREDICTED: septin and tuftelin-interacting protein 1 homolog 
1 [Beta vulgaris subsp. vulgaris]
Length=858

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = -2

Query  483  GSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            G FE HTKG G K++ KMG+ +G GLGK+ QGI API A  RPK+ G+G
Sbjct  199  GGFERHTKGIGMKLLEKMGY-KGGGLGKNEQGIVAPIEAKLRPKNMGMG  246


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  762  HTTGXGSKMMVKMGFTGGGLGKDGQGIAEPIQVSQRPKALGLG  634
            HT G G K++ KMG+ GGGLGK+ QGI  PI+   RPK +G+G
Sbjct  204  HTKGIGMKLLEKMGYKGGGLGKNEQGIVAPIEAKLRPKNMGMG  246



>gb|KIZ04951.1| Tuftelin-interacting protein 11, partial [Monoraphidium neglectum]
Length=759

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  492  PGFGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLG  337
            P F SFE  TKG GSK+++KMG+  G GLG++ QGI  PI A  RPK  G+G
Sbjct  272  PKFASFETFTKGIGSKLLSKMGYRPGEGLGREKQGIAKPIEAKLRPKGMGMG  323



>gb|ELK08915.1| G patch domain-containing protein 2 [Pteropus alecto]
Length=100

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -2

Query  747  GSKMMVKMGFT-GGGLGKDGQGIAEPIQVSQRPKALGLGADVPETSTANET  598
            G++M+  MG+T G GLG+DG+GIAEP+Q  QRPK LGLG  +P+++ A  T
Sbjct  43   GNRMLQNMGWTPGSGLGRDGKGIAEPVQAMQRPKGLGLGYPLPKSTPAATT  93



>ref|XP_009995165.1| PREDICTED: tuftelin-interacting protein 11 [Chaetura pelagica]
Length=868

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  486  FGSFENHTKGFGSKMMAKMGFVEGTGLGKDSQGITAPILATRRPKSQGLGA  334
            FGS+E HTKG G K++ KMG+V G GLGK++QGI  PI A +R     +GA
Sbjct  179  FGSWERHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGA  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890