BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020C14

Length=794
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006344428.1|  PREDICTED: uncharacterized protein LOC102597060    198   2e-57   Solanum tuberosum [potatoes]
ref|XP_004236230.1|  PREDICTED: uncharacterized protein LOC101257648    195   2e-56   Solanum lycopersicum
ref|XP_009595596.1|  PREDICTED: uncharacterized protein LOC104091859    194   5e-56   Nicotiana tomentosiformis
ref|XP_007036303.1|  Embryo defective 2759 isoform 2                    192   6e-56   
ref|XP_009763845.1|  PREDICTED: uncharacterized protein LOC104215685    194   9e-56   Nicotiana sylvestris
ref|XP_007036302.1|  Embryo defective 2759, putative isoform 1          193   2e-55   
ref|XP_007209326.1|  hypothetical protein PRUPE_ppa008249mg             192   4e-55   Prunus persica
ref|XP_002263464.1|  PREDICTED: uncharacterized protein LOC100265372    191   1e-54   Vitis vinifera
ref|XP_008351790.1|  PREDICTED: uncharacterized protein LOC103415...    187   5e-54   
emb|CAN66425.1|  hypothetical protein VITISV_007985                     188   6e-54   Vitis vinifera
ref|XP_008346735.1|  PREDICTED: uncharacterized protein LOC103409...    187   9e-54   
ref|XP_008351789.1|  PREDICTED: uncharacterized protein LOC103415...    187   2e-53   
ref|XP_008346734.1|  PREDICTED: uncharacterized protein LOC103409...    187   3e-53   
ref|XP_008245000.1|  PREDICTED: uncharacterized protein LOC103343...    186   7e-53   Prunus mume [ume]
ref|XP_008244999.1|  PREDICTED: uncharacterized protein LOC103343...    186   8e-53   
ref|XP_009362976.1|  PREDICTED: uncharacterized protein LOC103952...    184   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_009362975.1|  PREDICTED: uncharacterized protein LOC103952...    184   4e-52   Pyrus x bretschneideri [bai li]
ref|XP_004298965.1|  PREDICTED: uncharacterized protein LOC101308376    184   4e-52   Fragaria vesca subsp. vesca
gb|KHG08396.1|  Adenylosuccinate synthetase                             184   5e-52   Gossypium arboreum [tree cotton]
gb|KHG29598.1|  recA                                                    183   1e-51   Gossypium arboreum [tree cotton]
gb|KJB53102.1|  hypothetical protein B456_008G293700                    183   1e-51   Gossypium raimondii
gb|EYU22149.1|  hypothetical protein MIMGU_mgv1a009494mg                180   1e-50   Erythranthe guttata [common monkey flower]
gb|KJB08224.1|  hypothetical protein B456_001G071700                    179   4e-50   Gossypium raimondii
ref|XP_010550686.1|  PREDICTED: uncharacterized protein LOC104821...    178   5e-50   Tarenaya hassleriana [spider flower]
ref|XP_010550688.1|  PREDICTED: uncharacterized protein LOC104821...    178   6e-50   Tarenaya hassleriana [spider flower]
gb|KCW51790.1|  hypothetical protein EUGRSUZ_J01240                     172   1e-49   Eucalyptus grandis [rose gum]
ref|XP_011046159.1|  PREDICTED: uncharacterized protein LOC105140...    177   3e-49   Populus euphratica
ref|XP_011046164.1|  PREDICTED: uncharacterized protein LOC105140...    176   4e-49   Populus euphratica
ref|XP_011071908.1|  PREDICTED: uncharacterized protein LOC105157...    174   7e-49   
ref|XP_011071907.1|  PREDICTED: uncharacterized protein LOC105157...    174   1e-48   Sesamum indicum [beniseed]
ref|XP_011071906.1|  PREDICTED: uncharacterized protein LOC105157...    174   2e-48   Sesamum indicum [beniseed]
ref|XP_011071905.1|  PREDICTED: uncharacterized protein LOC105157...    175   2e-48   
emb|CDY16747.1|  BnaA09g06350D                                          174   3e-48   Brassica napus [oilseed rape]
emb|CDX87278.1|  BnaC09g05930D                                          174   3e-48   
ref|XP_010034353.1|  PREDICTED: uncharacterized protein LOC104423587    171   3e-48   Eucalyptus grandis [rose gum]
ref|XP_011071904.1|  PREDICTED: uncharacterized protein LOC105157...    174   3e-48   
ref|XP_010102523.1|  hypothetical protein L484_014579                   173   4e-48   Morus notabilis
ref|XP_002511367.1|  conserved hypothetical protein                     174   4e-48   Ricinus communis
gb|KDP31068.1|  hypothetical protein JCGZ_11444                         174   5e-48   Jatropha curcas
ref|XP_009112054.1|  PREDICTED: uncharacterized protein LOC103837445    173   6e-48   Brassica rapa
ref|XP_010027415.1|  PREDICTED: uncharacterized protein LOC104417915    173   6e-48   Eucalyptus grandis [rose gum]
ref|XP_002322176.2|  hypothetical protein POPTR_0015s09120g             172   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_008438592.1|  PREDICTED: uncharacterized protein LOC103483...    172   1e-47   Cucumis melo [Oriental melon]
ref|XP_008438584.1|  PREDICTED: uncharacterized protein LOC103483...    172   2e-47   Cucumis melo [Oriental melon]
dbj|BAB10547.1|  unnamed protein product                                168   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011046174.1|  PREDICTED: uncharacterized protein LOC105140...    171   4e-47   Populus euphratica
ref|XP_011046177.1|  PREDICTED: uncharacterized protein LOC105140...    171   4e-47   Populus euphratica
ref|XP_010545998.1|  PREDICTED: uncharacterized protein LOC104818212    170   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_011040480.1|  PREDICTED: uncharacterized protein LOC105136...    169   1e-46   Populus euphratica
ref|XP_010444166.1|  PREDICTED: uncharacterized protein LOC104726903    169   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002318084.2|  hypothetical protein POPTR_0012s09050g             169   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011040479.1|  PREDICTED: uncharacterized protein LOC105136...    168   2e-46   Populus euphratica
gb|ABK96116.1|  unknown                                                 169   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010278056.1|  PREDICTED: uncharacterized protein LOC104612...    167   3e-46   Nelumbo nucifera [Indian lotus]
ref|XP_011040478.1|  PREDICTED: uncharacterized protein LOC105136...    169   3e-46   Populus euphratica
ref|XP_011040476.1|  PREDICTED: uncharacterized protein LOC105136...    169   3e-46   Populus euphratica
ref|XP_002864832.1|  EMB2759                                            169   3e-46   
ref|NP_201110.2|  protein EMBRYO DEFECTIVE 2759                         169   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190603.1|  protein EMBRYO DEFECTIVE 2759                      169   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010051327.1|  PREDICTED: uncharacterized protein LOC104440036    165   4e-46   Eucalyptus grandis [rose gum]
ref|XP_010484025.1|  PREDICTED: uncharacterized protein LOC104762443    169   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006394322.1|  hypothetical protein EUTSA_v10004512mg             168   6e-46   Eutrema salsugineum [saltwater cress]
ref|XP_010248566.1|  PREDICTED: uncharacterized protein LOC104591...    166   6e-46   Nelumbo nucifera [Indian lotus]
gb|EPS63513.1|  hypothetical protein M569_11269                         166   7e-46   Genlisea aurea
ref|XP_010248564.1|  PREDICTED: uncharacterized protein LOC104591...    166   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010278054.1|  PREDICTED: uncharacterized protein LOC104612...    167   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_006280741.1|  hypothetical protein CARUB_v10026710mg             167   1e-45   Capsella rubella
ref|XP_010459745.1|  PREDICTED: uncharacterized protein LOC104740753    167   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010248562.1|  PREDICTED: uncharacterized protein LOC104591...    166   2e-45   Nelumbo nucifera [Indian lotus]
gb|KCW83031.1|  hypothetical protein EUGRSUZ_C04410                     158   1e-44   Eucalyptus grandis [rose gum]
gb|KEH31820.1|  embryo defective 2759 protein, putative                 164   2e-44   Medicago truncatula
ref|XP_007155447.1|  hypothetical protein PHAVU_003G202200g             163   3e-44   Phaseolus vulgaris [French bean]
gb|EYU17699.1|  hypothetical protein MIMGU_mgv1a009574mg                163   4e-44   Erythranthe guttata [common monkey flower]
gb|KCW81778.1|  hypothetical protein EUGRSUZ_C03135                     157   4e-44   Eucalyptus grandis [rose gum]
ref|XP_009150435.1|  PREDICTED: uncharacterized protein LOC103873787    163   4e-44   Brassica rapa
emb|CDY00350.1|  BnaA06g22510D                                          162   5e-44   
emb|CDX84380.1|  BnaC03g51200D                                          161   2e-43   
gb|KHN30931.1|  hypothetical protein glysoja_017468                     158   1e-42   Glycine soja [wild soybean]
ref|XP_010942418.1|  PREDICTED: uncharacterized protein LOC105060428    159   2e-42   Elaeis guineensis
ref|XP_004508882.1|  PREDICTED: uncharacterized protein LOC101499...    158   3e-42   Cicer arietinum [garbanzo]
ref|XP_004508881.1|  PREDICTED: uncharacterized protein LOC101499...    158   5e-42   Cicer arietinum [garbanzo]
emb|CDP12656.1|  unnamed protein product                                157   1e-41   Coffea canephora [robusta coffee]
ref|NP_001242677.1|  uncharacterized protein LOC100798149               156   2e-41   
dbj|BAB82451.1|  PBng110                                                151   5e-41   Vigna radiata [mung bean]
ref|XP_009399545.1|  PREDICTED: uncharacterized protein LOC103983918    152   6e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010670202.1|  PREDICTED: uncharacterized protein LOC104887288    152   8e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008782690.1|  PREDICTED: uncharacterized protein LOC103702154    151   2e-39   Phoenix dactylifera
gb|KHN19278.1|  hypothetical protein glysoja_012198                     150   2e-39   Glycine soja [wild soybean]
ref|XP_007138040.1|  hypothetical protein PHAVU_009G176100g             150   2e-39   Phaseolus vulgaris [French bean]
ref|XP_003527009.1|  PREDICTED: uncharacterized protein LOC100802...    149   7e-39   Glycine max [soybeans]
ref|XP_006581918.1|  PREDICTED: uncharacterized protein LOC100802...    149   1e-38   Glycine max [soybeans]
ref|XP_011101307.1|  PREDICTED: uncharacterized protein LOC105179393    148   1e-38   Sesamum indicum [beniseed]
ref|XP_006476824.1|  PREDICTED: uncharacterized protein LOC102631...    144   9e-37   Citrus sinensis [apfelsine]
ref|XP_006439862.1|  hypothetical protein CICLE_v10021009mg             143   1e-36   
ref|XP_006439864.1|  hypothetical protein CICLE_v10021009mg             143   2e-36   
ref|XP_008464548.1|  PREDICTED: uncharacterized protein LOC103502...    143   2e-36   Cucumis melo [Oriental melon]
ref|XP_008787333.1|  PREDICTED: uncharacterized protein LOC103705...    142   2e-36   
ref|XP_010923746.1|  PREDICTED: uncharacterized protein LOC105046751    142   3e-36   Elaeis guineensis
ref|XP_004501900.1|  PREDICTED: uncharacterized protein LOC101490180    135   4e-35   
gb|KJB08225.1|  hypothetical protein B456_001G071700                    137   2e-34   Gossypium raimondii
ref|XP_003601234.1|  hypothetical protein MTR_3g077490                  137   3e-34   Medicago truncatula
ref|XP_004501898.1|  PREDICTED: uncharacterized protein LOC101489...    135   7e-34   Cicer arietinum [garbanzo]
emb|CDX72055.1|  BnaC08g28190D                                          114   5e-26   
ref|XP_004157782.1|  PREDICTED: uncharacterized protein LOC101229897    112   2e-25   
ref|XP_004152483.1|  PREDICTED: uncharacterized protein LOC101204576    110   9e-25   Cucumis sativus [cucumbers]
gb|KDO69572.1|  hypothetical protein CISIN_1g020410mg                   100   3e-21   Citrus sinensis [apfelsine]
gb|KDO69567.1|  hypothetical protein CISIN_1g020410mg                   100   3e-21   Citrus sinensis [apfelsine]



>ref|XP_006344428.1| PREDICTED: uncharacterized protein LOC102597060 [Solanum tuberosum]
Length=338

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWILGP +VALY+KML+GICALYVF FKQTV VVKN PTY +LA +YIV+G
Sbjct  214  AEVSKELTPLWILGPLIVALYVKMLRGICALYVFSFKQTVNVVKNLPTYSLLAYDYIVRG  273

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+IR R LQP +DIKN+DYKE AK + +D+KV L EKYLD  ESIWPYYCR IR LK
Sbjct  274  KLKEDIRMRLLQPFIDIKNLDYKEAAKRKAKDIKVYLVEKYLDFVESIWPYYCRTIRFLK  333

Query  396  RANLI  382
            RANLI
Sbjct  334  RANLI  338



>ref|XP_004236230.1| PREDICTED: uncharacterized protein LOC101257648 [Solanum lycopersicum]
Length=337

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWILGP +VALY+KML+GICALYVF FKQTV VVKN PTY +LA +YIV+G
Sbjct  213  AEVSKELTPLWILGPLIVALYVKMLRGICALYVFSFKQTVNVVKNLPTYSLLAYDYIVRG  272

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE IR R LQP +DIKN+DYKE AK + +D++V L EKYLD  ESIWPYYCR IR LK
Sbjct  273  KLKEYIRMRLLQPFIDIKNLDYKEAAKRKAKDIEVFLVEKYLDFVESIWPYYCRTIRFLK  332

Query  396  RANLI  382
            RANLI
Sbjct  333  RANLI  337



>ref|XP_009595596.1| PREDICTED: uncharacterized protein LOC104091859 [Nicotiana tomentosiformis]
Length=340

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLW LGP +VALY+KML+GICALYVF FKQTV+VVKN PTY +L  +Y+ +GK
Sbjct  217  EVSKELTPLWTLGPLIVALYVKMLRGICALYVFSFKQTVKVVKNLPTYSLLTYDYVARGK  276

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
             KE+IRAR LQP++DIKN+DYKEVAK + +DL+V L EKYLD  ESIWPYYCR IR LKR
Sbjct  277  FKEDIRARLLQPLVDIKNLDYKEVAKRKAKDLEVYLVEKYLDYVESIWPYYCRTIRFLKR  336

Query  393  ANLI  382
            ANLI
Sbjct  337  ANLI  340



>ref|XP_007036303.1| Embryo defective 2759 isoform 2, partial [Theobroma cacao]
 gb|EOY20804.1| Embryo defective 2759 isoform 2, partial [Theobroma cacao]
Length=290

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+ GP +VALYIK+L+G+CALYVFCFKQTV++++N PTYY+LA  YI +G
Sbjct  166  AEVSKELTPLWVFGPLIVALYIKILRGLCALYVFCFKQTVQIIRNLPTYYLLAYNYIARG  225

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE++RARF QPV+D+KN+DYKE+++ +M+D +    EKYLD  ESIWPYYCR IR LK
Sbjct  226  KLKEDVRARFWQPVVDLKNLDYKELSRRKMKDFQEWAMEKYLDFVESIWPYYCRTIRFLK  285

Query  396  RANLI  382
            RANLI
Sbjct  286  RANLI  290



>ref|XP_009763845.1| PREDICTED: uncharacterized protein LOC104215685 [Nicotiana sylvestris]
Length=339

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLW LGP +VALY+KML+GICALYVF FKQTV+VV+N PTY +L  +Y+ +GK
Sbjct  216  EVSKELTPLWTLGPLIVALYVKMLRGICALYVFSFKQTVKVVRNLPTYSLLTYDYVARGK  275

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE+IRAR LQP++DIKN+DYKEVAK + +DL+V L EKYLD  ESIWPYYCR IR LKR
Sbjct  276  LKEDIRARLLQPLVDIKNLDYKEVAKRKAKDLEVYLVEKYLDYVESIWPYYCRTIRFLKR  335

Query  393  ANLI  382
            ANLI
Sbjct  336  ANLI  339



>ref|XP_007036302.1| Embryo defective 2759, putative isoform 1 [Theobroma cacao]
 gb|EOY20803.1| Embryo defective 2759, putative isoform 1 [Theobroma cacao]
Length=343

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+ GP +VALYIK+L+G+CALYVFCFKQTV++++N PTYY+LA  YI +G
Sbjct  219  AEVSKELTPLWVFGPLIVALYIKILRGLCALYVFCFKQTVQIIRNLPTYYLLAYNYIARG  278

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE++RARF QPV+D+KN+DYKE+++ +M+D +    EKYLD  ESIWPYYCR IR LK
Sbjct  279  KLKEDVRARFWQPVVDLKNLDYKELSRRKMKDFQEWAMEKYLDFVESIWPYYCRTIRFLK  338

Query  396  RANLI  382
            RANLI
Sbjct  339  RANLI  343



>ref|XP_007209326.1| hypothetical protein PRUPE_ppa008249mg [Prunus persica]
 gb|EMJ10525.1| hypothetical protein PRUPE_ppa008249mg [Prunus persica]
Length=339

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN PTYYM+A  YI QG
Sbjct  215  AEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVQVIKNLPTYYMVAYRYIAQG  274

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+IRARF QPVL+IKN+DYK++++ +++ L+ ++ EKYLD  ESIWPYYCR IR LK
Sbjct  275  KLKEDIRARFWQPVLNIKNLDYKKLSRRKLKGLQELIVEKYLDFIESIWPYYCRTIRFLK  334

Query  396  RANLI  382
            RANLI
Sbjct  335  RANLI  339



>ref|XP_002263464.1| PREDICTED: uncharacterized protein LOC100265372 [Vitis vinifera]
 emb|CBI14996.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLW+LGP +VALYIKML+GICALYVF FKQTV++VKN PTYY+LA  YI  GK
Sbjct  220  EVSKELAPLWVLGPLIVALYIKMLRGICALYVFSFKQTVKLVKNIPTYYLLAYTYIAHGK  279

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE+I+ARF QPV+DIKN+DY+E+++ +++DL+  L E+YLD  ESIWPYYCR IR LKR
Sbjct  280  LKEDIQARFWQPVVDIKNLDYRELSRRKLKDLQEWLLERYLDFVESIWPYYCRTIRFLKR  339

Query  393  ANLI  382
            ANLI
Sbjct  340  ANLI  343



>ref|XP_008351790.1| PREDICTED: uncharacterized protein LOC103415230 isoform X2 [Malus 
domestica]
Length=280

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A+VSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN PTYYM+A  YI  G
Sbjct  156  AKVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVKVIKNLPTYYMVAYTYIAHG  215

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KEEIRARF QP+L++KN+DYK++++ +++ L+ ++ EKYLD  ESIWPYYCR IR LK
Sbjct  216  KLKEEIRARFWQPLLNVKNLDYKKLSRRKLKALQGLIIEKYLDFVESIWPYYCRTIRFLK  275

Query  396  RANLI  382
            RANLI
Sbjct  276  RANLI  280



>emb|CAN66425.1| hypothetical protein VITISV_007985 [Vitis vinifera]
Length=307

 Score =   188 bits (477),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLW+ GP +VALYIKML+GICALYVF FKQTV++VKN PTYY+LA  YI  GK
Sbjct  184  EVSKELAPLWVXGPLIVALYIKMLRGICALYVFSFKQTVKLVKNIPTYYLLAYTYIAHGK  243

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE+I+ARF QPV+DIKN+DY+E+++ +++DL+  L E+YLD  ESIWPYYCR IR LKR
Sbjct  244  LKEDIQARFWQPVVDIKNLDYRELSRRKLKDLQEWLLERYLDFVESIWPYYCRTIRFLKR  303

Query  393  ANLI  382
            ANLI
Sbjct  304  ANLI  307



>ref|XP_008346735.1| PREDICTED: uncharacterized protein LOC103409711 isoform X2 [Malus 
domestica]
Length=279

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+LGPF+VALYIKMLQ +CALYVF FKQTV+V+KN P+Y+M+A  YI  G
Sbjct  155  AEVSKELTPLWVLGPFIVALYIKMLQXLCALYVFSFKQTVKVIKNLPSYFMVAYTYIAHG  214

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KEEIR RF QP+L+++N+DYK++++ +++ L+ ++ E+YLD  ESIWPYYCR IR LK
Sbjct  215  KLKEEIRTRFWQPLLNVRNLDYKKLSRRKLKALQELIVERYLDFVESIWPYYCRTIRFLK  274

Query  396  RANLI  382
            RANLI
Sbjct  275  RANLI  279



>ref|XP_008351789.1| PREDICTED: uncharacterized protein LOC103415230 isoform X1 [Malus 
domestica]
Length=339

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A+VSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN PTYYM+A  YI  G
Sbjct  215  AKVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVKVIKNLPTYYMVAYTYIAHG  274

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KEEIRARF QP+L++KN+DYK++++ +++ L+ ++ EKYLD  ESIWPYYCR IR LK
Sbjct  275  KLKEEIRARFWQPLLNVKNLDYKKLSRRKLKALQGLIIEKYLDFVESIWPYYCRTIRFLK  334

Query  396  RANLI  382
            RANLI
Sbjct  335  RANLI  339



>ref|XP_008346734.1| PREDICTED: uncharacterized protein LOC103409711 isoform X1 [Malus 
domestica]
Length=337

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+LGPF+VALYIKMLQ +CALYVF FKQTV+V+KN P+Y+M+A  YI  G
Sbjct  213  AEVSKELTPLWVLGPFIVALYIKMLQXLCALYVFSFKQTVKVIKNLPSYFMVAYTYIAHG  272

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KEEIR RF QP+L+++N+DYK++++ +++ L+ ++ E+YLD  ESIWPYYCR IR LK
Sbjct  273  KLKEEIRTRFWQPLLNVRNLDYKKLSRRKLKALQELIVERYLDFVESIWPYYCRTIRFLK  332

Query  396  RANLI  382
            RANLI
Sbjct  333  RANLI  337



>ref|XP_008245000.1| PREDICTED: uncharacterized protein LOC103343102 isoform X2 [Prunus 
mume]
Length=339

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN PTYYM+A  YI QG
Sbjct  215  AEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVQVIKNLPTYYMVAYRYIAQG  274

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+IRA F QPVL+IK++DYK++++ +++ L+ ++ EKYLD  ESIWPYYCR IR LK
Sbjct  275  KLKEDIRACFWQPVLNIKSLDYKKLSRRKLKGLQELIVEKYLDFIESIWPYYCRTIRFLK  334

Query  396  RANLI  382
            RANLI
Sbjct  335  RANLI  339



>ref|XP_008244999.1| PREDICTED: uncharacterized protein LOC103343102 isoform X1 [Prunus 
mume]
Length=343

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN PTYYM+A  YI QG
Sbjct  219  AEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVQVIKNLPTYYMVAYRYIAQG  278

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+IRA F QPVL+IK++DYK++++ +++ L+ ++ EKYLD  ESIWPYYCR IR LK
Sbjct  279  KLKEDIRACFWQPVLNIKSLDYKKLSRRKLKGLQELIVEKYLDFIESIWPYYCRTIRFLK  338

Query  396  RANLI  382
            RANLI
Sbjct  339  RANLI  343



>ref|XP_009362976.1| PREDICTED: uncharacterized protein LOC103952990 isoform X2 [Pyrus 
x bretschneideri]
Length=280

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN PTYYM+A  YI +G
Sbjct  156  AEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVKVIKNLPTYYMVAYTYIARG  215

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KEEI  RF QP+L+IKN+DYK++++ +++ L+ ++ E+YLD  ESIWPYYCR IR LK
Sbjct  216  KLKEEIWTRFWQPLLNIKNLDYKKLSRRKLKALQGLIIERYLDFVESIWPYYCRTIRFLK  275

Query  396  RANLI  382
            RANLI
Sbjct  276  RANLI  280



>ref|XP_009362975.1| PREDICTED: uncharacterized protein LOC103952990 isoform X1 [Pyrus 
x bretschneideri]
Length=339

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+LGP +VALYIKMLQ +CALYVF FKQTV+V+KN PTYYM+A  YI +G
Sbjct  215  AEVSKELTPLWVLGPLIVALYIKMLQWLCALYVFSFKQTVKVIKNLPTYYMVAYTYIARG  274

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KEEI  RF QP+L+IKN+DYK++++ +++ L+ ++ E+YLD  ESIWPYYCR IR LK
Sbjct  275  KLKEEIWTRFWQPLLNIKNLDYKKLSRRKLKALQGLIIERYLDFVESIWPYYCRTIRFLK  334

Query  396  RANLI  382
            RANLI
Sbjct  335  RANLI  339



>ref|XP_004298965.1| PREDICTED: uncharacterized protein LOC101308376 [Fragaria vesca 
subsp. vesca]
Length=339

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+LGPF+ ALYIKMLQ +CALY+F FKQTV+VV N PTYY+ A  YI  G
Sbjct  215  AEVSKELTPLWVLGPFIAALYIKMLQWLCALYIFSFKQTVKVVTNLPTYYLAAYRYIFHG  274

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K KE+I ARF QPV+DIKN+DYK++++ +++ L+ ++ EKYLD  ESIWPYYCRAIR LK
Sbjct  275  KFKEDIYARFWQPVVDIKNLDYKKLSRRKLKVLQELIVEKYLDFVESIWPYYCRAIRFLK  334

Query  396  RANLI  382
            RANLI
Sbjct  335  RANLI  339



>gb|KHG08396.1| Adenylosuccinate synthetase [Gossypium arboreum]
Length=354

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+ GP ++ALYIKML+G+CALYVFCF QTV++++N PTYY+LA  YI  G
Sbjct  230  AEVSKELTPLWVFGPLIIALYIKMLRGLCALYVFCFTQTVQLIRNLPTYYLLAYNYIAHG  289

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE++R    QPV+D+KN+DYKEV + +M+D +  + EKYLD  ESIWPYYCR IR LK
Sbjct  290  KLKEDVRVHVWQPVVDMKNLDYKEVCRKKMKDFQEWMMEKYLDYVESIWPYYCRTIRFLK  349

Query  396  RANLI  382
            RANLI
Sbjct  350  RANLI  354



>gb|KHG29598.1| recA [Gossypium arboreum]
Length=342

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+ GP +VALYI++L+G+CALYV C KQT+++V N PTYY++A  YI  G
Sbjct  218  AEVSKELTPLWVFGPLIVALYIRILRGLCALYVLCLKQTLQIVGNLPTYYVMAYNYIAHG  277

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KEE+RAR  QPV+DIKN+DYKE+++ +M+D +  + EKY+D+ ES+WPYYCR IR LK
Sbjct  278  KLKEEVRARVWQPVVDIKNLDYKELSRRKMKDFQEWMMEKYVDIVESVWPYYCRTIRFLK  337

Query  396  RANLI  382
            RAN+I
Sbjct  338  RANII  342



>gb|KJB53102.1| hypothetical protein B456_008G293700 [Gossypium raimondii]
 gb|KJB53103.1| hypothetical protein B456_008G293700 [Gossypium raimondii]
 gb|KJB53104.1| hypothetical protein B456_008G293700 [Gossypium raimondii]
Length=342

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+ GP ++ALYIKML+G+CALYVFCF QTV++++N PTYY+LA  YI  G
Sbjct  218  AEVSKELTPLWVFGPLIIALYIKMLRGLCALYVFCFTQTVQLIRNLPTYYLLAYNYIAHG  277

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE++R    QPV+D+KN+DYKEV   +M+D +  + EKYLD  ESIWPYYCR IR LK
Sbjct  278  KLKEDVRVHVWQPVVDMKNLDYKEVCIKKMKDFQEWMMEKYLDYVESIWPYYCRTIRFLK  337

Query  396  RANLI  382
            RANLI
Sbjct  338  RANLI  342



>gb|EYU22149.1| hypothetical protein MIMGU_mgv1a009494mg [Erythranthe guttata]
 gb|EYU22150.1| hypothetical protein MIMGU_mgv1a009494mg [Erythranthe guttata]
 gb|EYU22151.1| hypothetical protein MIMGU_mgv1a009494mg [Erythranthe guttata]
Length=340

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLWILGP +VALYIKM + IC LYVF FKQTV+VVKN PTY +L +EY+ +GK
Sbjct  217  EVSKELTPLWILGPLIVALYIKMFRAICGLYVFSFKQTVKVVKNLPTYCVLVHEYLFRGK  276

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE IRAR  QP+ DIKN+DYKE A+++M+ L+  L EKYLD  ESIWPYYCR IR LKR
Sbjct  277  LKEAIRARLWQPIADIKNMDYKEAARTKMKILQEWLVEKYLDYVESIWPYYCRIIRFLKR  336

Query  393  ANLI  382
            ANL+
Sbjct  337  ANLL  340



>gb|KJB08224.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
 gb|KJB08226.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
 gb|KJB08227.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
Length=342

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+ GP +VALYI++L+G+CALYV C KQT+++V N PTYY++A  YI  G
Sbjct  218  AEVSKELTPLWVFGPLIVALYIRILRGLCALYVLCLKQTLQIVGNLPTYYVVAYNYIAHG  277

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KEE+RAR  QPV++IKN+DYKE+++ +M+D +  + E Y+D+ ES+WPYYCR IR LK
Sbjct  278  KLKEEVRARVWQPVVNIKNLDYKELSRRKMKDFQEWMMENYVDIVESVWPYYCRTIRFLK  337

Query  396  RANLI  382
            RAN+I
Sbjct  338  RANII  342



>ref|XP_010550686.1| PREDICTED: uncharacterized protein LOC104821481 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010550687.1| PREDICTED: uncharacterized protein LOC104821481 isoform X1 [Tarenaya 
hassleriana]
Length=327

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKELMPLW++GP VVALY+KM QGICALY FCFKQT+ +++N P Y +LA  YI++G
Sbjct  203  AEVSKELMPLWVVGPLVVALYVKMFQGICALYAFCFKQTINIIRNLPAYAILAYNYIIRG  262

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+     L+PV+ IKN+DYKEVA++R++ L+  + EKYLD  ESIWPYYCR IR LK
Sbjct  263  KLKEDALGFVLRPVVAIKNMDYKEVARTRLKLLQKWVIEKYLDFVESIWPYYCRTIRFLK  322

Query  396  RANLI  382
            RANLI
Sbjct  323  RANLI  327



>ref|XP_010550688.1| PREDICTED: uncharacterized protein LOC104821481 isoform X2 [Tarenaya 
hassleriana]
Length=321

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKELMPLW++GP VVALY+KM QGICALY FCFKQT+ +++N P Y +LA  YI++G
Sbjct  197  AEVSKELMPLWVVGPLVVALYVKMFQGICALYAFCFKQTINIIRNLPAYAILAYNYIIRG  256

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+     L+PV+ IKN+DYKEVA++R++ L+  + EKYLD  ESIWPYYCR IR LK
Sbjct  257  KLKEDALGFVLRPVVAIKNMDYKEVARTRLKLLQKWVIEKYLDFVESIWPYYCRTIRFLK  316

Query  396  RANLI  382
            RANLI
Sbjct  317  RANLI  321



>gb|KCW51790.1| hypothetical protein EUGRSUZ_J01240, partial [Eucalyptus grandis]
Length=137

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN P YY+ A +Y+  G
Sbjct  13   SEVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLPVYYLTAYQYVANG  72

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE++R+R  QPV+D+KN+DYKE+++ ++++L+  L E YLD  ESIWPYYCR IR LK
Sbjct  73   KLKEDVRSRVWQPVVDVKNLDYKELSRRKLKELQEWLLEWYLDFIESIWPYYCRTIRFLK  132

Query  396  RANLI  382
            RAN I
Sbjct  133  RANFI  137



>ref|XP_011046159.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046160.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046161.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046162.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
 ref|XP_011046163.1| PREDICTED: uncharacterized protein LOC105140850 isoform X1 [Populus 
euphratica]
Length=343

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VSKEL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN PTYY++A+ YI QG
Sbjct  219  AGVSKELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVPTYYLVASGYIRQG  278

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I+AR LQP+   KN+D KE ++ +M +L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  279  KLKEDIQARVLQPLQSFKNLDRKEFSRKKMMELQEWLMEKYLDYVESIWPYYCRAIRFLK  338

Query  396  RANLI  382
            RANLI
Sbjct  339  RANLI  343



>ref|XP_011046164.1| PREDICTED: uncharacterized protein LOC105140850 isoform X2 [Populus 
euphratica]
Length=340

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VSKEL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN PTYY++A+ YI QG
Sbjct  216  AGVSKELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVPTYYLVASGYIRQG  275

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I+AR LQP+   KN+D KE ++ +M +L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  276  KLKEDIQARVLQPLQSFKNLDRKEFSRKKMMELQEWLMEKYLDYVESIWPYYCRAIRFLK  335

Query  396  RANLI  382
            RANLI
Sbjct  336  RANLI  340



>ref|XP_011071908.1| PREDICTED: uncharacterized protein LOC105157246 isoform X5 [Sesamum 
indicum]
 ref|XP_011071909.1| PREDICTED: uncharacterized protein LOC105157246 isoform X5 [Sesamum 
indicum]
Length=292

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P YY+L +EYI +G
Sbjct  168  SEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLPAYYLLLHEYIFRG  227

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E IWPYYCR IR LK
Sbjct  228  KLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIELIWPYYCRTIRFLK  287

Query  396  RANLI  382
            RANLI
Sbjct  288  RANLI  292



>ref|XP_011071907.1| PREDICTED: uncharacterized protein LOC105157246 isoform X4 [Sesamum 
indicum]
Length=306

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P YY+L +EYI +G
Sbjct  182  SEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLPAYYLLLHEYIFRG  241

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E IWPYYCR IR LK
Sbjct  242  KLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIELIWPYYCRTIRFLK  301

Query  396  RANLI  382
            RANLI
Sbjct  302  RANLI  306



>ref|XP_011071906.1| PREDICTED: uncharacterized protein LOC105157246 isoform X3 [Sesamum 
indicum]
Length=340

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P YY+L +EYI +G
Sbjct  216  SEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLPAYYLLLHEYIFRG  275

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E IWPYYCR IR LK
Sbjct  276  KLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIELIWPYYCRTIRFLK  335

Query  396  RANLI  382
            RANLI
Sbjct  336  RANLI  340



>ref|XP_011071905.1| PREDICTED: uncharacterized protein LOC105157246 isoform X2 [Sesamum 
indicum]
Length=355

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P YY+L +EYI +G
Sbjct  231  SEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLPAYYLLLHEYIFRG  290

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E IWPYYCR IR LK
Sbjct  291  KLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIELIWPYYCRTIRFLK  350

Query  396  RANLI  382
            RANLI
Sbjct  351  RANLI  355



>emb|CDY16747.1| BnaA09g06350D [Brassica napus]
Length=346

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL PLWI GP +VALY+KM QG+CALY FCFKQT +V++N P+YY++A  YI QG
Sbjct  222  AEVTKELSPLWIAGPLIVALYVKMFQGLCALYAFCFKQTAKVIRNLPSYYIIAYHYIAQG  281

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+++++R    +P++ +KN DYKE+  ++++ L+  L EKYLD  ESIWPYYCR IR LK
Sbjct  282  KLRDDVRGLVTRPMVAVKNADYKELTGAKLKQLREWLVEKYLDFVESIWPYYCRTIRFLK  341

Query  396  RANLI  382
            RANLI
Sbjct  342  RANLI  346



>emb|CDX87278.1| BnaC09g05930D [Brassica napus]
Length=346

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL PLWI GP +V+LY+KM QG+C LY FCFKQT +V++N P+YY++A  YI QG
Sbjct  222  AEVTKELSPLWIAGPLIVSLYVKMFQGLCTLYAFCFKQTAKVIRNLPSYYIIAYHYIAQG  281

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+++++R    +P++ +KN DYKE+  +R++ L+V + EKYLD  ESIWPYYCR IR LK
Sbjct  282  KLRDDVRGLVTRPMVAVKNADYKELTGARLKQLRVWIVEKYLDFVESIWPYYCRTIRFLK  341

Query  396  RANLI  382
            RANLI
Sbjct  342  RANLI  346



>ref|XP_010034353.1| PREDICTED: uncharacterized protein LOC104423587 [Eucalyptus grandis]
Length=223

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN P YY+ A +Y+  G
Sbjct  99   SEVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLPVYYLTAYQYVANG  158

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE++R+R  QPV+D+KN+DYKE+++ ++++L+  L E YLD  ESIWPYYCR IR LK
Sbjct  159  KLKEDVRSRVWQPVVDVKNLDYKELSRRKLKELQEWLLEWYLDFIESIWPYYCRTIRFLK  218

Query  396  RANLI  382
            RAN I
Sbjct  219  RANFI  223



>ref|XP_011071904.1| PREDICTED: uncharacterized protein LOC105157246 isoform X1 [Sesamum 
indicum]
Length=359

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILGP +V LYIKM + IC+LY+F FKQ+V+VVKN P YY+L +EYI +G
Sbjct  235  SEVSKELTPLWILGPLIVVLYIKMFRAICSLYIFSFKQSVKVVKNLPAYYLLLHEYIFRG  294

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE I+    QP+ D+KN+DYKE+ + +M+D +V L E+YLD  E IWPYYCR IR LK
Sbjct  295  KLKEAIQRHLWQPIADLKNMDYKELTRRKMKDFQVWLVERYLDFIELIWPYYCRTIRFLK  354

Query  396  RANLI  382
            RANLI
Sbjct  355  RANLI  359



>ref|XP_010102523.1| hypothetical protein L484_014579 [Morus notabilis]
 gb|EXB93587.1| hypothetical protein L484_014579 [Morus notabilis]
Length=327

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 103/125 (82%), Gaps = 4/125 (3%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW++GP +V LYIKML+ + ALYVF F+QTV+V+KN P YY     Y+VQG
Sbjct  207  AEVSKELTPLWVVGPVIVVLYIKMLRWLFALYVFSFRQTVKVIKNLPVYY----SYLVQG  262

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KEE R+RF QPV++IKN++YKE +K+++++L+V L E+YLD  ESIWPYYCR IR LK
Sbjct  263  KLKEEFRSRFWQPVVNIKNLNYKEFSKTKLKELQVWLVERYLDFVESIWPYYCRTIRFLK  322

Query  396  RANLI  382
            RANLI
Sbjct  323  RANLI  327



>ref|XP_002511367.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51969.1| conserved hypothetical protein [Ricinus communis]
Length=343

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLWILGP +VALYIKML+ + ALYVF F+QTV++VKN PTYY++A+ YI +G+
Sbjct  220  EVSKELTPLWILGPLIVALYIKMLRVLWALYVFSFRQTVKLVKNLPTYYLVASSYITRGR  279

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE++ AR +QPV++IKN+DYKE+++ ++++ +  L +KY D  ESIWPYYCR IR LKR
Sbjct  280  LKEDVHARVVQPVINIKNLDYKELSRKKLKEFEEWLLDKYFDYVESIWPYYCRTIRFLKR  339

Query  393  ANLI  382
            ANLI
Sbjct  340  ANLI  343



>gb|KDP31068.1| hypothetical protein JCGZ_11444 [Jatropha curcas]
Length=343

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            +VSKEL PLWILGP  VA YIKML+ + ALYVF FKQTV+V+KN PTYY +A+ YI QGK
Sbjct  220  QVSKELTPLWILGPLAVAFYIKMLRVLWALYVFSFKQTVKVLKNLPTYYAVASSYISQGK  279

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE+I+A   QP++D KN+DYKE++K +M++ +    +KYLD  ESIWPYYCR IR LKR
Sbjct  280  LKEDIQAHVFQPMIDFKNLDYKELSKKKMKEFEEWFVDKYLDFVESIWPYYCRTIRFLKR  339

Query  393  ANLI  382
            ANLI
Sbjct  340  ANLI  343



>ref|XP_009112054.1| PREDICTED: uncharacterized protein LOC103837445 [Brassica rapa]
Length=346

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL PLWI GP +VALY+KM QG+C LY FCFKQT +V++N P+YY++A  YI QG
Sbjct  222  AEVTKELSPLWIAGPLIVALYVKMFQGLCTLYAFCFKQTAKVIRNLPSYYIMAYHYIAQG  281

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+++++R    +P++ +KN DYKE+  ++++ L+  L EKYLD  ESIWPYYCR IR LK
Sbjct  282  KLRDDVRGLVTRPMVAVKNADYKEITGAKLKQLREWLVEKYLDFVESIWPYYCRTIRFLK  341

Query  396  RANLI  382
            RANLI
Sbjct  342  RANLI  346



>ref|XP_010027415.1| PREDICTED: uncharacterized protein LOC104417915 [Eucalyptus grandis]
 gb|KCW83317.1| hypothetical protein EUGRSUZ_B00249 [Eucalyptus grandis]
 gb|KCW83318.1| hypothetical protein EUGRSUZ_B00249 [Eucalyptus grandis]
 gb|KCW83319.1| hypothetical protein EUGRSUZ_B00249 [Eucalyptus grandis]
Length=336

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN P YY+ A +Y+V GK
Sbjct  213  EVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLPVYYLTAYQYVVNGK  272

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE+I +R  QPV+D+KN+DYKE+++ ++++L+  L E+YLD  ESIWPYYCR IR LKR
Sbjct  273  LKEDIHSRVWQPVVDVKNLDYKELSRRKLKELQEWLLERYLDFIESIWPYYCRTIRFLKR  332

Query  393  ANLI  382
            AN I
Sbjct  333  ANFI  336



>ref|XP_002322176.2| hypothetical protein POPTR_0015s09120g [Populus trichocarpa]
 gb|EEF06303.2| hypothetical protein POPTR_0015s09120g [Populus trichocarpa]
Length=343

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VSKEL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN PTYY++A  YI QG
Sbjct  219  AGVSKELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVPTYYLVAYGYIRQG  278

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I+AR LQP+   KN+D KE ++ +M +L+    EKYLD  ESIWPYYCRAIR LK
Sbjct  279  KLKEDIQARVLQPLQSFKNLDRKEFSRKKMMELQEWCMEKYLDYVESIWPYYCRAIRFLK  338

Query  396  RANLI  382
            RANLI
Sbjct  339  RANLI  343



>ref|XP_008438592.1| PREDICTED: uncharacterized protein LOC103483645 isoform X2 [Cucumis 
melo]
Length=338

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  765  SLXAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYI  586
            S  AEVS+EL PLWILGP + ALY+K+ Q ICALYVF FKQT +++ N P+YY   + YI
Sbjct  211  SYGAEVSRELTPLWILGPLLTALYVKLFQWICALYVFSFKQTAKLIMNSPSYYWTVHHYI  270

Query  585  VQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIR  406
            +QGK+KE+  ARF+QP+++IKN+DYKE++K ++ +L+    EKYLD  ESIWPYYCRAIR
Sbjct  271  IQGKLKEQFVARFVQPIINIKNLDYKELSKRKLIELRERAMEKYLDYVESIWPYYCRAIR  330

Query  405  TLKRANLI  382
             LKRANL+
Sbjct  331  FLKRANLL  338



>ref|XP_008438584.1| PREDICTED: uncharacterized protein LOC103483645 isoform X1 [Cucumis 
melo]
Length=340

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  765  SLXAEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYI  586
            S  AEVS+EL PLWILGP + ALY+K+ Q ICALYVF FKQT +++ N P+YY   + YI
Sbjct  213  SYGAEVSRELTPLWILGPLLTALYVKLFQWICALYVFSFKQTAKLIMNSPSYYWTVHHYI  272

Query  585  VQGKIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIR  406
            +QGK+KE+  ARF+QP+++IKN+DYKE++K ++ +L+    EKYLD  ESIWPYYCRAIR
Sbjct  273  IQGKLKEQFVARFVQPIINIKNLDYKELSKRKLIELRERAMEKYLDYVESIWPYYCRAIR  332

Query  405  TLKRANLI  382
             LKRANL+
Sbjct  333  FLKRANLL  340



>dbj|BAB10547.1| unnamed protein product [Arabidopsis thaliana]
Length=216

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL P+W++GP ++ALYIKM QG+C+LY FCF QT+++++N P+YY++A +YI  G
Sbjct  92   AEVTKELSPMWVVGPLIIALYIKMFQGLCSLYAFCFNQTIKMIRNLPSYYLVAYQYIADG  151

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES+WPYYCR IR LK
Sbjct  152  KLKDDVKALVFKPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLK  211

Query  396  RANLI  382
            RANLI
Sbjct  212  RANLI  216



>ref|XP_011046174.1| PREDICTED: uncharacterized protein LOC105140855 isoform X1 [Populus 
euphratica]
 ref|XP_011046175.1| PREDICTED: uncharacterized protein LOC105140855 isoform X1 [Populus 
euphratica]
 ref|XP_011046176.1| PREDICTED: uncharacterized protein LOC105140855 isoform X1 [Populus 
euphratica]
Length=343

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VS+EL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN PTYY++A+ YI QG
Sbjct  219  AGVSRELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVPTYYLVASGYIRQG  278

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I+A  LQP+   KN+D KE ++ +M +L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  279  KLKEDIQACVLQPLQSFKNLDRKEFSRKKMMELQEWLMEKYLDYVESIWPYYCRAIRFLK  338

Query  396  RANLI  382
            RANLI
Sbjct  339  RANLI  343



>ref|XP_011046177.1| PREDICTED: uncharacterized protein LOC105140855 isoform X2 [Populus 
euphratica]
Length=340

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VS+EL PLWILGP +VA YIK+LQG+ ALYVF F+QT++V+KN PTYY++A+ YI QG
Sbjct  216  AGVSRELTPLWILGPLIVAFYIKLLQGLWALYVFSFRQTIKVIKNVPTYYLVASGYIRQG  275

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I+A  LQP+   KN+D KE ++ +M +L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  276  KLKEDIQACVLQPLQSFKNLDRKEFSRKKMMELQEWLMEKYLDYVESIWPYYCRAIRFLK  335

Query  396  RANLI  382
            RANLI
Sbjct  336  RANLI  340



>ref|XP_010545998.1| PREDICTED: uncharacterized protein LOC104818212 [Tarenaya hassleriana]
Length=343

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A V+KEL+PLW++GP VVALYIKM QG+CALY FCF +TV +VKN P Y +LA  YI+QG
Sbjct  219  AGVTKELLPLWVIGPLVVALYIKMFQGLCALYAFCFSKTVNIVKNLPAYAILAYNYIIQG  278

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K++E++R   ++PV+ I+ +DY++VA++R++ L+  + EKYLD  ESIWPYYCR IR LK
Sbjct  279  KLREDVRGFVVRPVVAIRGMDYRKVARTRLKLLQDWIVEKYLDFVESIWPYYCRTIRFLK  338

Query  396  RANLI  382
            RANLI
Sbjct  339  RANLI  343



>ref|XP_011040480.1| PREDICTED: uncharacterized protein LOC105136723 isoform X4 [Populus 
euphratica]
Length=306

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P YY++A+ YI QG
Sbjct  182  AGVSKELTPLWILGPLIVAIYIKLFQGMWALYVFSFRQTVKLIKNVPAYYLVASGYIRQG  241

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  242  KLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVESIWPYYCRAIRFLK  301

Query  396  RANLI  382
            +ANLI
Sbjct  302  KANLI  306



>ref|XP_010444166.1| PREDICTED: uncharacterized protein LOC104726903 [Camelina sativa]
Length=345

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
             EV+KEL P+W+ GP +VALYIKMLQG+CALY FCF QT+++++N P+YY++A  YI  G
Sbjct  221  TEVTKELSPMWVAGPLIVALYIKMLQGLCALYAFCFNQTIKMIRNLPSYYLVAYHYIAHG  280

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++A   +PV+ IKN DYKE+  ++++  +  + EKYLD  ES+WPYYCR IR LK
Sbjct  281  KLKDDVKALLFRPVVAIKNTDYKELTGTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLK  340

Query  396  RANLI  382
            RANLI
Sbjct  341  RANLI  345



>ref|XP_002318084.2| hypothetical protein POPTR_0012s09050g [Populus trichocarpa]
 gb|EEE96304.2| hypothetical protein POPTR_0012s09050g [Populus trichocarpa]
Length=342

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P YY++A+ YI QG
Sbjct  218  AGVSKELTPLWILGPLIVAIYIKLFQGLWALYVFSFRQTVKLIKNVPAYYLVASGYIRQG  277

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  278  KLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVESIWPYYCRAIRFLK  337

Query  396  RANLI  382
            +ANLI
Sbjct  338  KANLI  342



>ref|XP_011040479.1| PREDICTED: uncharacterized protein LOC105136723 isoform X3 [Populus 
euphratica]
Length=310

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P YY++A+ YI QG
Sbjct  186  AGVSKELTPLWILGPLIVAIYIKLFQGMWALYVFSFRQTVKLIKNVPAYYLVASGYIRQG  245

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  246  KLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVESIWPYYCRAIRFLK  305

Query  396  RANLI  382
            +ANLI
Sbjct  306  KANLI  310



>gb|ABK96116.1| unknown [Populus trichocarpa]
Length=342

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P YY++A+ YI QG
Sbjct  218  AGVSKELTPLWILGPLIVAIYIKLFQGLWALYVFSFRQTVKLIKNVPAYYLVASGYIRQG  277

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  278  KLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVESIWPYYCRAIRFLK  337

Query  396  RANLI  382
            +ANLI
Sbjct  338  KANLI  342



>ref|XP_010278056.1| PREDICTED: uncharacterized protein LOC104612361 isoform X2 [Nelumbo 
nucifera]
Length=278

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLW+ GP V+ALYIKML+G+CALYVF FKQ V+V+KN PTYY     Y+ QGK
Sbjct  159  EVSKELTPLWVFGPLVMALYIKMLRGLCALYVFTFKQMVQVLKNLPTYY----NYVAQGK  214

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            + +++RA F QPV+DIKN+DYKE  + ++++ +  L +KYLD  ESIWPYYCR IR LKR
Sbjct  215  LNDDLRAYFWQPVVDIKNLDYKEAFRKKLKEFEAWLVDKYLDFVESIWPYYCRTIRFLKR  274

Query  393  ANLI  382
            A+LI
Sbjct  275  AHLI  278



>ref|XP_011040478.1| PREDICTED: uncharacterized protein LOC105136723 isoform X2 [Populus 
euphratica]
Length=339

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P YY++A+ YI QG
Sbjct  215  AGVSKELTPLWILGPLIVAIYIKLFQGMWALYVFSFRQTVKLIKNVPAYYLVASGYIRQG  274

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  275  KLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVESIWPYYCRAIRFLK  334

Query  396  RANLI  382
            +ANLI
Sbjct  335  KANLI  339



>ref|XP_011040476.1| PREDICTED: uncharacterized protein LOC105136723 isoform X1 [Populus 
euphratica]
 ref|XP_011040477.1| PREDICTED: uncharacterized protein LOC105136723 isoform X1 [Populus 
euphratica]
Length=342

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A VSKEL PLWILGP +VA+YIK+ QG+ ALYVF F+QTV+++KN P YY++A+ YI QG
Sbjct  218  AGVSKELTPLWILGPLIVAIYIKLFQGMWALYVFSFRQTVKLIKNVPAYYLVASGYIRQG  277

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++   LQPVL IKN+D KE ++ + ++L+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  278  KLKDDMQVHVLQPVLHIKNLDRKEFSRKKTKELQEWLTEKYLDYVESIWPYYCRAIRFLK  337

Query  396  RANLI  382
            +ANLI
Sbjct  338  KANLI  342



>ref|XP_002864832.1| EMB2759 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41091.1| EMB2759 [Arabidopsis lyrata subsp. lyrata]
Length=345

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL P+W++GP +VALYIKM QG+C+LY FCF QT+++++N P+YY++A  YI  G
Sbjct  221  AEVTKELSPMWVVGPLIVALYIKMFQGLCSLYAFCFNQTIKMIRNLPSYYLVAYHYIAHG  280

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++A   +PV+ IKN DYKE+ +++++  +  + E+YLD  ES+WPYYCR IR LK
Sbjct  281  KLKDDVKALVFRPVVAIKNTDYKELTRTKLKQFQEWIIERYLDFVESVWPYYCRTIRFLK  340

Query  396  RANLI  382
            RANLI
Sbjct  341  RANLI  345



>ref|NP_201110.2| protein EMBRYO DEFECTIVE 2759 [Arabidopsis thaliana]
 gb|AAR92269.1| At5g63050 [Arabidopsis thaliana]
 gb|AAS76255.1| At5g63050 [Arabidopsis thaliana]
 gb|AED97691.1| embryo defective 2759 protein [Arabidopsis thaliana]
Length=345

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL P+W++GP ++ALYIKM QG+C+LY FCF QT+++++N P+YY++A +YI  G
Sbjct  221  AEVTKELSPMWVVGPLIIALYIKMFQGLCSLYAFCFNQTIKMIRNLPSYYLVAYQYIADG  280

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES+WPYYCR IR LK
Sbjct  281  KLKDDVKALVFKPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLK  340

Query  396  RANLI  382
            RANLI
Sbjct  341  RANLI  345



>ref|NP_001190603.1| protein EMBRYO DEFECTIVE 2759 [Arabidopsis thaliana]
 gb|AED97692.1| embryo defective 2759 protein [Arabidopsis thaliana]
Length=339

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL P+W++GP ++ALYIKM QG+C+LY FCF QT+++++N P+YY++A +YI  G
Sbjct  215  AEVTKELSPMWVVGPLIIALYIKMFQGLCSLYAFCFNQTIKMIRNLPSYYLVAYQYIADG  274

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES+WPYYCR IR LK
Sbjct  275  KLKDDVKALVFKPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLK  334

Query  396  RANLI  382
            RANLI
Sbjct  335  RANLI  339



>ref|XP_010051327.1| PREDICTED: uncharacterized protein LOC104440036 [Eucalyptus grandis]
Length=216

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN   YY+ A +Y+  G
Sbjct  92   SEVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLLVYYLTAYQYVANG  151

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE++R+R  QPV+D+KN+DYKE+++ ++++L+  L E YLD  ESIWPYYCR IR +K
Sbjct  152  KLKEDVRSRVWQPVVDVKNLDYKELSRRKLKELQEWLLEWYLDFIESIWPYYCRTIRFVK  211

Query  396  RANLI  382
            RAN I
Sbjct  212  RANFI  216



>ref|XP_010484025.1| PREDICTED: uncharacterized protein LOC104762443 [Camelina sativa]
Length=345

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
             EV+KEL P+W+ GP +VALYIKM QG+CALY FCF QT+++++N P+YY++A  YI  G
Sbjct  221  TEVTKELSPMWVAGPLIVALYIKMFQGLCALYAFCFNQTIKMIRNLPSYYLVAYHYIAHG  280

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES+WPYYCR IR LK
Sbjct  281  KLKDDVKALVFRPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLK  340

Query  396  RANLI  382
            RANLI
Sbjct  341  RANLI  345



>ref|XP_006394322.1| hypothetical protein EUTSA_v10004512mg [Eutrema salsugineum]
 gb|ESQ31608.1| hypothetical protein EUTSA_v10004512mg [Eutrema salsugineum]
Length=344

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL PLW+ GP +VALYIKM QG+CALY FCF QT+++++N P+YY++A  YI  G
Sbjct  220  AEVTKELSPLWMAGPLIVALYIKMFQGLCALYAFCFNQTIKMIRNVPSYYLVAYHYISHG  279

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+++++RA   +PV  IKN DY+E+++++++  +  + EKYLD  ESIWPYYCR IR LK
Sbjct  280  KLRDDMRALVTRPVAAIKNTDYRELSRTKLKQFQEWIIEKYLDFVESIWPYYCRTIRFLK  339

Query  396  RANLI  382
            RANLI
Sbjct  340  RANLI  344



>ref|XP_010248566.1| PREDICTED: uncharacterized protein LOC104591437 isoform X3 [Nelumbo 
nucifera]
Length=273

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 101/124 (81%), Gaps = 4/124 (3%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            +VSKEL PLW+ GP +VALYIKML+G+CALY+F FKQTV+V+KN PTYY     Y+ +GK
Sbjct  154  KVSKELTPLWVFGPLIVALYIKMLRGLCALYIFSFKQTVQVLKNLPTYY----NYVARGK  209

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE++ A F QPV+DIKN+D+KE+ + ++++L+  L EKYLD  ESIWPYYCR IR LKR
Sbjct  210  LKEDLLAYFWQPVVDIKNMDHKELFRKKLKELEAWLVEKYLDFVESIWPYYCRTIRFLKR  269

Query  393  ANLI  382
            ++LI
Sbjct  270  SHLI  273



>gb|EPS63513.1| hypothetical protein M569_11269, partial [Genlisea aurea]
Length=259

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL+PLW LGP +VALY+K  Q I  LYVF F+QTV+V+KN P Y  +A +Y+V G
Sbjct  135  SEVSKELIPLWTLGPLIVALYVKTFQLIFNLYVFTFRQTVKVIKNLPVYSTVAYDYVVSG  194

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K  IR    QPV+D+KN+DYKE    ++ DL+  L EKYLD  ESIWPYYCRAIR LK
Sbjct  195  KLKAAIRKHLFQPVVDVKNMDYKEFTLKKLNDLREWLTEKYLDFVESIWPYYCRAIRFLK  254

Query  396  RANLI  382
            RANL+
Sbjct  255  RANLL  259



>ref|XP_010248564.1| PREDICTED: uncharacterized protein LOC104591437 isoform X2 [Nelumbo 
nucifera]
Length=305

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 101/124 (81%), Gaps = 4/124 (3%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            +VSKEL PLW+ GP +VALYIKML+G+CALY+F FKQTV+V+KN PTYY     Y+ +GK
Sbjct  186  KVSKELTPLWVFGPLIVALYIKMLRGLCALYIFSFKQTVQVLKNLPTYY----NYVARGK  241

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE++ A F QPV+DIKN+D+KE+ + ++++L+  L EKYLD  ESIWPYYCR IR LKR
Sbjct  242  LKEDLLAYFWQPVVDIKNMDHKELFRKKLKELEAWLVEKYLDFVESIWPYYCRTIRFLKR  301

Query  393  ANLI  382
            ++LI
Sbjct  302  SHLI  305



>ref|XP_010278054.1| PREDICTED: uncharacterized protein LOC104612361 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010278055.1| PREDICTED: uncharacterized protein LOC104612361 isoform X1 [Nelumbo 
nucifera]
Length=335

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLW+ GP V+ALYIKML+G+CALYVF FKQ V+V+KN PTYY     Y+ QGK
Sbjct  216  EVSKELTPLWVFGPLVMALYIKMLRGLCALYVFTFKQMVQVLKNLPTYY----NYVAQGK  271

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            + +++RA F QPV+DIKN+DYKE  + ++++ +  L +KYLD  ESIWPYYCR IR LKR
Sbjct  272  LNDDLRAYFWQPVVDIKNLDYKEAFRKKLKEFEAWLVDKYLDFVESIWPYYCRTIRFLKR  331

Query  393  ANLI  382
            A+LI
Sbjct  332  AHLI  335



>ref|XP_006280741.1| hypothetical protein CARUB_v10026710mg [Capsella rubella]
 gb|EOA13639.1| hypothetical protein CARUB_v10026710mg [Capsella rubella]
Length=345

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
             EV+KEL P+W+ GP +VALYIKM QG+CALY FCF QT+++++N P+YY++A  YI  G
Sbjct  221  TEVTKELSPMWVAGPLIVALYIKMFQGLCALYAFCFNQTIKMIRNLPSYYLVAYHYISHG  280

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K++++++A   +PV+ IKN DYKE+ +++++  +  + EKYLD  ES+WPYYCR IR LK
Sbjct  281  KLRDDVKALVFRPVVAIKNTDYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLK  340

Query  396  RANLI  382
            RANLI
Sbjct  341  RANLI  345



>ref|XP_010459745.1| PREDICTED: uncharacterized protein LOC104740753 [Camelina sativa]
Length=344

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
             EV+KEL P+W+ GP +VALYIKM QG+CALY FCF QT+++++N P+YY++A  YI  G
Sbjct  220  TEVTKELSPMWVAGPLIVALYIKMFQGLCALYAFCFNQTIKMIRNLPSYYLVAYHYIAHG  279

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K++++A   +PV  IKN DYKE+ +++++  +  + EKYLD  ES+WPYYCR IR LK
Sbjct  280  KLKDDVKALVYRPVAAIKNTDYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLK  339

Query  396  RANLI  382
            RANLI
Sbjct  340  RANLI  344



>ref|XP_010248562.1| PREDICTED: uncharacterized protein LOC104591437 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010248563.1| PREDICTED: uncharacterized protein LOC104591437 isoform X1 [Nelumbo 
nucifera]
Length=330

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 101/124 (81%), Gaps = 4/124 (3%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            +VSKEL PLW+ GP +VALYIKML+G+CALY+F FKQTV+V+KN PTYY     Y+ +GK
Sbjct  211  KVSKELTPLWVFGPLIVALYIKMLRGLCALYIFSFKQTVQVLKNLPTYY----NYVARGK  266

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +KE++ A F QPV+DIKN+D+KE+ + ++++L+  L EKYLD  ESIWPYYCR IR LKR
Sbjct  267  LKEDLLAYFWQPVVDIKNMDHKELFRKKLKELEAWLVEKYLDFVESIWPYYCRTIRFLKR  326

Query  393  ANLI  382
            ++LI
Sbjct  327  SHLI  330



>gb|KCW83031.1| hypothetical protein EUGRSUZ_C04410, partial [Eucalyptus grandis]
Length=137

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILG  +VALY K+ +G+ ALY+F FKQTV+VVKN   YY+ A +Y+  G
Sbjct  13   SEVSKELTPLWILGLPLVALYFKLFRGLWALYLFTFKQTVKVVKNLHVYYLTAYQYVANG  72

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE++R+   QPV+D+KN+DYKE+++ ++++L+  L + YLD  ESIWPYYCR IR LK
Sbjct  73   KLKEDVRSHVWQPVVDVKNLDYKELSRRKLKELQEWLLKWYLDFIESIWPYYCRTIRFLK  132

Query  396  RANLI  382
            RAN I
Sbjct  133  RANFI  137



>gb|KEH31820.1| embryo defective 2759 protein, putative [Medicago truncatula]
Length=352

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EVSKEL PLW++GPF+VALYIKM+Q +CALYV+ FKQTV+V+K+ P++  LA+ Y+  GK
Sbjct  229  EVSKELTPLWVMGPFIVALYIKMVQVLCALYVYSFKQTVKVIKSLPSFCKLAHNYVFDGK  288

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            IKE+I+   LQP+L+IKN DYK++    ++ L   + EKYLD  ESIWPYYCR IR LKR
Sbjct  289  IKEDIKVHILQPILNIKNADYKQLTIKLLKVLAEWIGEKYLDFVESIWPYYCRTIRFLKR  348

Query  393  ANLI  382
            +NLI
Sbjct  349  SNLI  352



>ref|XP_007155447.1| hypothetical protein PHAVU_003G202200g [Phaseolus vulgaris]
 gb|ESW27441.1| hypothetical protein PHAVU_003G202200g [Phaseolus vulgaris]
Length=334

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSK+L PLW+LGP +VAL+I M + +CALYVF FKQT++V+KN P+Y+MLA  Y+  G
Sbjct  210  AEVSKDLTPLWVLGPLIVALFIMMGRWLCALYVFSFKQTIKVIKNLPSYFMLAYSYVFCG  269

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K +  A  LQP L I N DYK++ + ++++L   + EKYLD  ESIWPYYCR IR LK
Sbjct  270  KLKGDFDAHILQPTLSITNTDYKQLGRKKLKELSEWIVEKYLDFVESIWPYYCRTIRFLK  329

Query  396  RANLI  382
            RANLI
Sbjct  330  RANLI  334



>gb|EYU17699.1| hypothetical protein MIMGU_mgv1a009574mg [Erythranthe guttata]
Length=337

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            ++VSKEL PLWILGP   ALY+KM + IC +Y F FKQT ++VKN P YY++ +++IV G
Sbjct  213  SKVSKELTPLWILGPLFAALYVKMFRAICKVYGFSFKQTAKLVKNLPVYYLVVHDHIVNG  272

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+ E  R    +P+  IKN DYKE+ K+RM+DL+    E+YLD  ESIWPYYCR IR LK
Sbjct  273  KLNEATRRHIFEPLAVIKNTDYKELTKNRMKDLQGWFVERYLDFVESIWPYYCRTIRFLK  332

Query  396  RANLI  382
            RANLI
Sbjct  333  RANLI  337



>gb|KCW81778.1| hypothetical protein EUGRSUZ_C03135, partial [Eucalyptus grandis]
Length=130

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            +EVSKEL PLWILGP +VALY+K+ +G+ ALY+F FKQTV+VVKN   YY+ A +Y+  G
Sbjct  13   SEVSKELTPLWILGPLLVALYVKLFRGLWALYLFTFKQTVKVVKNLLVYYLTAYQYVANG  72

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIR  406
            K+KE++R+R  QPV+D+KN+DYKE+++ ++++L+  L E YLD  ESIWPYYCR IR
Sbjct  73   KLKEDVRSRVWQPVVDVKNLDYKELSRRKLKELQEWLLEWYLDFIESIWPYYCRTIR  129



>ref|XP_009150435.1| PREDICTED: uncharacterized protein LOC103873787 [Brassica rapa]
Length=325

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL PLWI+GP +VALYIK  QGICALY FCF QT +V++N P+YY++A  YI  G
Sbjct  201  AEVTKELSPLWIVGPLIVALYIKTFQGICALYAFCFNQTTKVIRNLPSYYIIAYHYISHG  260

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K+++RA   +P++ IKN D +++ +++++ ++  + E+YLD  E IWPYYCR IR LK
Sbjct  261  KLKDDVRALVTRPIVAIKNTDNRQLTRTKLKQVQEWIIERYLDFVEFIWPYYCRTIRFLK  320

Query  396  RANLI  382
            RAN I
Sbjct  321  RANFI  325



>emb|CDY00350.1| BnaA06g22510D [Brassica napus]
Length=324

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL PLWI+GP +VALYIK  QGICALY FCF QT +V++N P+YY++A  YI  G
Sbjct  200  AEVTKELSPLWIVGPLIVALYIKTFQGICALYAFCFNQTTKVIRNLPSYYIIAYHYISHG  259

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K+++RA   +P++ IKN D +++ +++++ ++  + E+YLD  E IWPYYCR IR LK
Sbjct  260  KLKDDVRALVTRPIVAIKNTDNRQLTRTKLKQVQEWIIERYLDFDEFIWPYYCRTIRFLK  319

Query  396  RANLI  382
            RAN I
Sbjct  320  RANFI  324



>emb|CDX84380.1| BnaC03g51200D [Brassica napus]
Length=322

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 96/125 (77%), Gaps = 3/125 (2%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KEL PLWI+GP +VA YIK  QG+CALY FCF QT +V++N P+YY++A  YI  G
Sbjct  201  AEVTKELSPLWIVGPLIVAFYIKTFQGLCALYAFCFNQTTKVIRNLPSYYIIAYHYISHG  260

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+K+++RA   +P++   N DY+E+ +++++ ++  + E+YLD  ESIWPYYCR IR LK
Sbjct  261  KLKDDLRALVTRPIV---NTDYRELTRTKLKQVQEWIIERYLDFVESIWPYYCRTIRFLK  317

Query  396  RANLI  382
            RANLI
Sbjct  318  RANLI  322



>gb|KHN30931.1| hypothetical protein glysoja_017468 [Glycine soja]
Length=296

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWILGPF+VA  +  ++ +CALYVF FKQTV+++KN P+Y +LA+ Y+ +G
Sbjct  172  AEVSKELTPLWILGPFIVATQVLAIRWLCALYVFSFKQTVKLLKNSPSYCILAHSYVFRG  231

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I    LQP+L +KN DYK++ + ++++L+  + E YLD  ESIWPYYCR IR LK
Sbjct  232  KLKEDISTYVLQPILSVKNRDYKQLTRKKLKELQEWIVEMYLDYVESIWPYYCRTIRFLK  291

Query  396  RANLI  382
            RANLI
Sbjct  292  RANLI  296



>ref|XP_010942418.1| PREDICTED: uncharacterized protein LOC105060428 [Elaeis guineensis]
Length=340

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EV+KEL PLWILGP +VALYIK++QG+C+LY+F F Q VR+VKN PTY +L + YI +GK
Sbjct  217  EVTKELTPLWILGPLIVALYIKIIQGLCSLYLFVFMQAVRLVKNLPTYSLLVHNYIAEGK  276

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +K    A F +P++DIKN+DY+++ + + + L     EKYLD  ESIWPYYCR IR LK+
Sbjct  277  LKAVFWALFWKPIIDIKNLDYRDLFRQKAQQLGEWAGEKYLDFIESIWPYYCRTIRFLKK  336

Query  393  ANLI  382
            A+LI
Sbjct  337  AHLI  340



>ref|XP_004508882.1| PREDICTED: uncharacterized protein LOC101499621 isoform X2 [Cicer 
arietinum]
 ref|XP_004508883.1| PREDICTED: uncharacterized protein LOC101499621 isoform X3 [Cicer 
arietinum]
Length=338

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW++GP +VALYI M++ +CALYV+ FKQTV+V+K+ P+Y  LA  Y+  G
Sbjct  214  AEVSKELTPLWVMGPLIVALYIMMVRVLCALYVYSFKQTVKVIKSLPSYCNLAYSYVYDG  273

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I+A  LQP+L IKN DYK++ +  ++ L   + E+YLD  ESIWPYYCR IR LK
Sbjct  274  KLKEDIKAHILQPILSIKNADYKQLTRKMLKVLAEWIGERYLDFVESIWPYYCRTIRFLK  333

Query  396  RANLI  382
             +NLI
Sbjct  334  SSNLI  338



>ref|XP_004508881.1| PREDICTED: uncharacterized protein LOC101499621 isoform X1 [Cicer 
arietinum]
Length=347

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW++GP +VALYI M++ +CALYV+ FKQTV+V+K+ P+Y  LA  Y+  G
Sbjct  223  AEVSKELTPLWVMGPLIVALYIMMVRVLCALYVYSFKQTVKVIKSLPSYCNLAYSYVYDG  282

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I+A  LQP+L IKN DYK++ +  ++ L   + E+YLD  ESIWPYYCR IR LK
Sbjct  283  KLKEDIKAHILQPILSIKNADYKQLTRKMLKVLAEWIGERYLDFVESIWPYYCRTIRFLK  342

Query  396  RANLI  382
             +NLI
Sbjct  343  SSNLI  347



>emb|CDP12656.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVS+EL PLW+LGP + ALY+K+ +GI ALYVF FKQTV+++ + PT+Y++A++YI  G
Sbjct  232  AEVSRELTPLWVLGPLIAALYVKLWRGIGALYVFSFKQTVKLLISLPTWYLVAHDYIGNG  291

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+  ++     QP++D++N+DYK  +K ++++L++ + EKYLD  ESIWPYYCR IR LK
Sbjct  292  KL-NQVVGHLFQPLVDLRNMDYKGASKRKLKELEIFVVEKYLDFVESIWPYYCRTIRFLK  350

Query  396  RANLI  382
            RANLI
Sbjct  351  RANLI  355



>ref|NP_001242677.1| uncharacterized protein LOC100798149 [Glycine max]
 gb|ACU22822.1| unknown [Glycine max]
Length=332

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWILGPF+VA  +  ++ +CALYVF FKQTV+++KN P+Y +LA+ Y+ +G
Sbjct  208  AEVSKELTPLWILGPFIVATQVLAIRWLCALYVFSFKQTVKLLKNSPSYCILAHSYVFRG  267

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I     QP+L +KN DYK++ + ++++L+  + E YLD  ESIWPYYCR IR LK
Sbjct  268  KLKEDISTYVPQPILSVKNRDYKQLTRKKLKELQEWIVEMYLDYVESIWPYYCRTIRFLK  327

Query  396  RANLI  382
            RANLI
Sbjct  328  RANLI  332



>dbj|BAB82451.1| PBng110 [Vigna radiata]
Length=198

 Score =   151 bits (381),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWILGP +VA+ + +++ +CALY F FKQTV++ KN P+Y + A  YI +G
Sbjct  74   AEVSKELTPLWILGPLIVAMQVMIIRWLCALYAFSFKQTVKLFKNSPSYCISAYSYIFRG  133

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I    LQP+L  KN DY+++ + ++++L+  + E+YLD  ESIWPYYCR IR LK
Sbjct  134  KLKEDISTNVLQPILSAKNRDYRQLTRKKLKELQDWVLERYLDYVESIWPYYCRTIRFLK  193

Query  396  RANLI  382
            RANLI
Sbjct  194  RANLI  198



>ref|XP_009399545.1| PREDICTED: uncharacterized protein LOC103983918 [Musa acuminata 
subsp. malaccensis]
Length=338

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KELMPLWILGP + ALYIK++QG+C+LYVF F Q VR++KN P Y +L   +I +G
Sbjct  214  AEVTKELMPLWILGPLIFALYIKIIQGLCSLYVFVFMQAVRLIKNLPRYSLLVYNFIAEG  273

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K++  +   F++P++DIKN+DY   ++ + +       EKYLD  ESIWPYYCR IR LK
Sbjct  274  KLRAYLWDHFVKPIVDIKNMDYGAFSRRKYKQFVTWAVEKYLDYVESIWPYYCRTIRFLK  333

Query  396  RANLI  382
            +A+LI
Sbjct  334  KAHLI  338



>ref|XP_010670202.1| PREDICTED: uncharacterized protein LOC104887288 [Beta vulgaris 
subsp. vulgaris]
Length=338

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 98/125 (78%), Gaps = 4/125 (3%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
             +VS+EL PLWI+GP +VALY+K+L+GI ALYVF FKQ+V+VVKN PTYY +A  Y+ +G
Sbjct  218  GQVSRELTPLWIVGPLIVALYVKLLRGIFALYVFSFKQSVKVVKNLPTYYSIACNYLAEG  277

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K++    A+F QP +++K +D+KE++ S+ + ++  + EKYLD  ESIWP+YCR IR LK
Sbjct  278  KLQ----AQFWQPFINVKGMDHKELSTSKWKVVQEWMYEKYLDFVESIWPHYCRTIRFLK  333

Query  396  RANLI  382
            RANL+
Sbjct  334  RANLM  338



>ref|XP_008782690.1| PREDICTED: uncharacterized protein LOC103702154 [Phoenix dactylifera]
Length=340

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EV+KEL PLW+LGP +VALYIK+++G+C+LY+F F Q VR+VKN PTY +L + YI +GK
Sbjct  217  EVTKELTPLWVLGPLIVALYIKIIEGLCSLYLFLFMQAVRLVKNLPTYSLLVHNYINEGK  276

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +K  + A F +P+++IKN+DY+ + + +++ L+    EKYLD  ESIWPYYCR IR LK+
Sbjct  277  LKAFLWALFWKPLINIKNLDYRALFRGKVKQLEEWAVEKYLDYIESIWPYYCRTIRFLKK  336

Query  393  ANLI  382
            A+LI
Sbjct  337  AHLI  340



>gb|KHN19278.1| hypothetical protein glysoja_012198 [Glycine soja]
Length=340

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWILGP +VA  I  ++ +CALYVF FKQTV+++KN P Y +LA  Y+ +G
Sbjct  216  AEVSKELTPLWILGPLIVATQILAIRWLCALYVFSFKQTVKLLKNSPYYCILAYSYVFRG  275

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I    LQP+L +KN DYK++ + ++++L+  + E YLD  ESIWPYYCR IR LK
Sbjct  276  KLKEDISTYVLQPILRVKNRDYKQLIRKKLKELQEWIVEMYLDYVESIWPYYCRTIRFLK  335

Query  396  RANLI  382
            RANLI
Sbjct  336  RANLI  340



>ref|XP_007138040.1| hypothetical protein PHAVU_009G176100g [Phaseolus vulgaris]
 gb|ESW10034.1| hypothetical protein PHAVU_009G176100g [Phaseolus vulgaris]
Length=332

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWILGP +VA  + +++ +CALY F FKQTV + KN P++ +LA  YI +G
Sbjct  208  AEVSKELTPLWILGPLIVATQVMIMRWLCALYAFSFKQTVNLFKNSPSFCILAYSYIFRG  267

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I    LQP+L +KN DY+++ + ++++L+  + E YLD  ESIWP+YCR IR LK
Sbjct  268  KLKEDISTNVLQPILSVKNRDYRQLTRKKLKELQKWIMEMYLDYVESIWPFYCRTIRFLK  327

Query  396  RANLI  382
            RANLI
Sbjct  328  RANLI  332



>ref|XP_003527009.1| PREDICTED: uncharacterized protein LOC100802447 isoform X1 [Glycine 
max]
Length=332

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWILGP +VA  I  ++ +CALYVF F QTV+++KN P Y +LA  Y+ +G
Sbjct  208  AEVSKELTPLWILGPLIVATQILAIRWLCALYVFSFNQTVKLLKNSPYYCILAYSYVFRG  267

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I    LQP+L +KN DYK++ + ++++L+  + E YLD  ESIWPYYCR IR LK
Sbjct  268  KLKEDISTYVLQPILRVKNRDYKQLIRKKLKELQEWIVEMYLDYVESIWPYYCRTIRFLK  327

Query  396  RANLI  382
            RANLI
Sbjct  328  RANLI  332



>ref|XP_006581918.1| PREDICTED: uncharacterized protein LOC100802447 isoform X2 [Glycine 
max]
 ref|XP_006581919.1| PREDICTED: uncharacterized protein LOC100802447 isoform X3 [Glycine 
max]
Length=343

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWILGP +VA  I  ++ +CALYVF F QTV+++KN P Y +LA  Y+ +G
Sbjct  219  AEVSKELTPLWILGPLIVATQILAIRWLCALYVFSFNQTVKLLKNSPYYCILAYSYVFRG  278

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+I    LQP+L +KN DYK++ + ++++L+  + E YLD  ESIWPYYCR IR LK
Sbjct  279  KLKEDISTYVLQPILRVKNRDYKQLIRKKLKELQEWIVEMYLDYVESIWPYYCRTIRFLK  338

Query  396  RANLI  382
            RANLI
Sbjct  339  RANLI  343



>ref|XP_011101307.1| PREDICTED: uncharacterized protein LOC105179393 [Sesamum indicum]
Length=339

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            ++VSKEL PLWILGP V+ALYIK+ + IC LY F FKQT+++ K+ P Y++L ++YI  G
Sbjct  219  SKVSKELTPLWILGPLVIALYIKIFRAICVLYAFSFKQTIKIAKSLPAYHLLLHDYIFHG  278

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE ++   LQPV DIK++DY  V K    DL+  L E+YLD  E IWP+YCR +R LK
Sbjct  279  KLKEAMKKHILQPVEDIKSMDYILVIK----DLQRWLVERYLDFIELIWPFYCRTLRFLK  334

Query  396  RANLI  382
            RANLI
Sbjct  335  RANLI  339



>ref|XP_006476824.1| PREDICTED: uncharacterized protein LOC102631155 isoform X1 [Citrus 
sinensis]
 ref|XP_006476825.1| PREDICTED: uncharacterized protein LOC102631155 isoform X2 [Citrus 
sinensis]
 ref|XP_006476826.1| PREDICTED: uncharacterized protein LOC102631155 isoform X3 [Citrus 
sinensis]
Length=338

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P     A  Y+ QG
Sbjct  221  AEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLPA----ACRYVAQG  276

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+++ R   P   I N+D +++ +  +++ K  L E YLD  ESIWP+YCR IR LK
Sbjct  277  KLKEDVQVRVWDP---INNLDKEQLFRKTLKEFKEWLTESYLDFVESIWPHYCRTIRFLK  333

Query  396  RANLI  382
            RA+LI
Sbjct  334  RAHLI  338



>ref|XP_006439862.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 ref|XP_006439863.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 ref|XP_006439865.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 ref|XP_006439866.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53102.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53103.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53105.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53106.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
Length=338

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P     A  Y+ QG
Sbjct  221  AEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLPA----ACRYVAQG  276

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+++ R   P   I N+D +++ +  +++ K  L E YLD  ESIWP+YCR IR LK
Sbjct  277  KLKEDVQVRVWDP---INNLDKEQLFRKMLKEFKKWLTESYLDFVESIWPHYCRTIRFLK  333

Query  396  RANLI  382
            RA+LI
Sbjct  334  RAHLI  338



>ref|XP_006439864.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
 gb|ESR53104.1| hypothetical protein CICLE_v10021009mg [Citrus clementina]
Length=335

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 7/125 (6%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P     A  Y+ QG
Sbjct  218  AEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLPA----ACRYVAQG  273

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+KE+++ R   P   I N+D +++ +  +++ K  L E YLD  ESIWP+YCR IR LK
Sbjct  274  KLKEDVQVRVWDP---INNLDKEQLFRKMLKEFKKWLTESYLDFVESIWPHYCRTIRFLK  330

Query  396  RANLI  382
            RA+LI
Sbjct  331  RAHLI  335



>ref|XP_008464548.1| PREDICTED: uncharacterized protein LOC103502398 isoform X1 [Cucumis 
melo]
Length=333

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            A+VSKELMPLW+ GPF+VA YIKM   +C L +  FK+T  ++KNF  Y+ L   Y+  G
Sbjct  209  AQVSKELMPLWVFGPFIVAFYIKMFHWLCCLSILSFKRTAYLMKNFLCYFKLVCGYVSHG  268

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            ++KE +RAR  QP+++I+++ YKE+++ + + ++  + E+YLD  E +WPYYCR+IR LK
Sbjct  269  RLKEVVRARVWQPLVNIRSLHYKELSRRKFQFMQEWIMERYLDFLELVWPYYCRSIRFLK  328

Query  396  RANLI  382
            RANL+
Sbjct  329  RANLV  333



>ref|XP_008787333.1| PREDICTED: uncharacterized protein LOC103705411 isoform X1 [Phoenix 
dactylifera]
Length=340

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EV+KEL PLW+LGP +VA YIK++QG+C+LY F F Q V +VKN P Y  L   YI +GK
Sbjct  217  EVTKELTPLWVLGPLIVAFYIKIIQGLCSLYFFLFMQAVSLVKNLPIYSSLVYTYIAEGK  276

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +K  + A F +P++ IKN+DY+ + + + + L+    EKYLD  ESIWPYYCR IR LK+
Sbjct  277  LKAFLWALFWKPIIVIKNLDYRALFRQKFKQLEEWAVEKYLDYIESIWPYYCRTIRFLKK  336

Query  393  ANLI  382
            A+LI
Sbjct  337  AHLI  340



>ref|XP_010923746.1| PREDICTED: uncharacterized protein LOC105046751 [Elaeis guineensis]
 ref|XP_010923747.1| PREDICTED: uncharacterized protein LOC105046751 [Elaeis guineensis]
Length=340

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -3

Query  753  EVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQGK  574
            EV+KEL PLW+LGP +VA YIK++QG+C LY+F F Q  R++KN P Y  L   YI  GK
Sbjct  217  EVTKELTPLWVLGPLIVAFYIKIIQGLCLLYLFLFMQASRLIKNLPIYSSLVYTYIAPGK  276

Query  573  IKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLKR  394
            +K  I A F +P++DIKN+DYK + + + + L+    EKYLD  E IWPYYCR IR LK+
Sbjct  277  LKAFIWALFWKPIIDIKNLDYKALLRQKFKQLEEWALEKYLDFIELIWPYYCRTIRFLKK  336

Query  393  ANLI  382
            A+ I
Sbjct  337  AHFI  340



>ref|XP_004501900.1| PREDICTED: uncharacterized protein LOC101490180 [Cicer arietinum]
Length=197

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWI GP +VA++I +++G+CALY   F +TV+++   P++ +L N YI  G
Sbjct  73   AEVSKELTPLWIFGPLIVAIHIMIIRGLCALYALSFNRTVKILSKLPSFCILVNNYIFGG  132

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
             +KE I    L+P+L +K+IDY ++ +  ++ L+  L +KYLD  ESIWP+YCR +R LK
Sbjct  133  VLKEHIGVYLLRPILSLKDIDYIQLTRRILKVLQEWLVDKYLDYVESIWPHYCRTVRFLK  192

Query  396  RANLI  382
             +NLI
Sbjct  193  TSNLI  197



>gb|KJB08225.1| hypothetical protein B456_001G071700 [Gossypium raimondii]
Length=307

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = -3

Query  672  CALYVFCFKQTVRVVKNFPTYYMLANEYIVQGKIKEEIRARFLQPVLDIKNIDYKEVAKS  493
            CALYV C KQT+++V N PTYY++A  YI  GK+KEE+RAR  QPV++IKN+DYKE+++ 
Sbjct  211  CALYVLCLKQTLQIVGNLPTYYVVAYNYIAHGKLKEEVRARVWQPVVNIKNLDYKELSRR  270

Query  492  RMEDLKVILAEKYLDLAESIWPYYCRAIRTLKRANLI  382
            +M+D +  + E Y+D+ ES+WPYYCR IR LKRAN+I
Sbjct  271  KMKDFQEWMMENYVDIVESVWPYYCRTIRFLKRANII  307



>ref|XP_003601234.1| hypothetical protein MTR_3g077490 [Medicago truncatula]
 gb|AES71485.1| embryo defective 2759 protein [Medicago truncatula]
Length=332

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLW+ GP +VAL+I +++G+CALY   F +TV +++  P++ +LAN YI  G
Sbjct  208  AEVSKELTPLWVFGPLIVALHIIIIRGLCALYASSFNRTVEILRKVPSWCILANYYIFGG  267

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
             +KE+I    L+P+  +K+IDY ++ +  ++ L+  L +KYLD  ESIWPYYCRAIR LK
Sbjct  268  GLKEQIAVYLLRPISSLKHIDYIQLTRRILKVLQEWLMDKYLDYVESIWPYYCRAIRFLK  327

Query  396  RANLI  382
             +NLI
Sbjct  328  TSNLI  332



>ref|XP_004501898.1| PREDICTED: uncharacterized protein LOC101489640 isoform X1 [Cicer 
arietinum]
 ref|XP_004501899.1| PREDICTED: uncharacterized protein LOC101489640 isoform X2 [Cicer 
arietinum]
Length=331

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL PLWI GP +VA++I +++G+CALY   F +TV+++   P++ +L N YI  G
Sbjct  207  AEVSKELTPLWIFGPLIVAIHIMIIRGLCALYALSFNRTVKILSKLPSFCILVNNYIFGG  266

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
             +KE I    L+P+L +K+IDY ++ +  ++ L+  L +KYLD  ESIWP+YCR +R LK
Sbjct  267  VLKEHIGVYLLRPILSLKDIDYIQLTRRILKVLQEWLVDKYLDYVESIWPHYCRTVRFLK  326

Query  396  RANLI  382
             +NLI
Sbjct  327  TSNLI  331



>emb|CDX72055.1| BnaC08g28190D [Brassica napus]
Length=294

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEV+KE  PLWI+GP +VA YIK  QG+CALY FCF QT +V++N P+YY++A  YI  G
Sbjct  201  AEVTKESSPLWIVGPLIVAFYIKTFQGLCALYAFCFNQTTKVIRNLPSYYIIAYHYISHG  260

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRME  484
            K+K+++RA   +P++   N DY+E+ +++++
Sbjct  261  KLKDDLRALVTRPIV---NTDYRELTRTKLK  288



>ref|XP_004157782.1| PREDICTED: uncharacterized protein LOC101229897 [Cucumis sativus]
Length=331

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVS+EL PLWILGP V A YIK+   +CAL +F F Q V+++ N PTY+ +   YI++G
Sbjct  214  AEVSRELTPLWILGPLVTAFYIKICHWMCALCIFSFMQAVKLILNSPTYFWIVYHYIIRG  273

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+ E    RF+Q ++    ID K + K ++ +L+    EKYLD  ES W  Y R IR LK
Sbjct  274  KLVE----RFMQSII---KIDLKALPKRKLMELRGWAIEKYLDYVESNWQRYFRTIRFLK  326

Query  396  RANLI  382
            RA+LI
Sbjct  327  RAHLI  331



>ref|XP_004152483.1| PREDICTED: uncharacterized protein LOC101204576 [Cucumis sativus]
 gb|KGN64325.1| hypothetical protein Csa_1G046220 [Cucumis sativus]
Length=331

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 80/125 (64%), Gaps = 7/125 (6%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVS+EL PLWILGP V A YIK+   +CAL +F F Q V+++ N PTY  +   YI++G
Sbjct  214  AEVSRELTPLWILGPLVTAFYIKICHWMCALCIFSFMQAVKLILNSPTYLWIVYHYIIRG  273

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDLAESIWPYYCRAIRTLK  397
            K+ E    RF+Q ++    ID K + K ++ +L+    EKYLD  ES W  Y R IR LK
Sbjct  274  KLVE----RFMQSII---KIDLKALPKRKLMELRGWAIEKYLDYVESNWQRYFRTIRFLK  326

Query  396  RANLI  382
            RA+LI
Sbjct  327  RAHLI  331



>gb|KDO69572.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69573.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
Length=290

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P     A  Y+ QG
Sbjct  185  AEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLPA----ACRYVAQG  240

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDL  445
            K+KE+++ R   P   I N+D +++ +  +++ K +   + L  
Sbjct  241  KLKEDVQVRVWDP---INNLDKEQLFRKMLKEFKRVANRELLGF  281



>gb|KDO69567.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69568.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69569.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69570.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
 gb|KDO69571.1| hypothetical protein CISIN_1g020410mg [Citrus sinensis]
Length=326

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = -3

Query  756  AEVSKELMPLWILGPFVVALYIKMLQGICALYVFCFKQTVRVVKNFPTYYMLANEYIVQG  577
            AEVSKEL+PLWI GP +VALYIKM Q +CALYVF FKQTV+V+KN P     A  Y+ QG
Sbjct  221  AEVSKELIPLWIFGPLIVALYIKMFQWLCALYVFSFKQTVKVIKNLPA----ACRYVAQG  276

Query  576  KIKEEIRARFLQPVLDIKNIDYKEVAKSRMEDLKVILAEKYLDL  445
            K+KE+++ R   P   I N+D +++ +  +++ K +   + L  
Sbjct  277  KLKEDVQVRVWDP---INNLDKEQLFRKMLKEFKRVANRELLGF  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553719916385