BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020C05

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU44770.1|  hypothetical protein MIMGU_mgv1a007476mg                318   3e-103   Erythranthe guttata [common monkey flower]
gb|KDP31079.1|  hypothetical protein JCGZ_11455                         309   1e-99    Jatropha curcas
ref|XP_002282228.1|  PREDICTED: anthranilate phosphoribosyltransf...    306   1e-98    Vitis vinifera
ref|XP_006364000.1|  PREDICTED: anthranilate phosphoribosyltransf...    305   2e-98    Solanum tuberosum [potatoes]
gb|KJB53199.1|  hypothetical protein B456_008G296400                    303   2e-97    Gossypium raimondii
ref|XP_006347447.1|  PREDICTED: anthranilate phosphoribosyltransf...    301   6e-97    Solanum tuberosum [potatoes]
ref|XP_004241508.1|  PREDICTED: anthranilate phosphoribosyltransf...    301   7e-97    Solanum lycopersicum
ref|XP_011098449.1|  PREDICTED: anthranilate phosphoribosyltransf...    298   1e-95    Sesamum indicum [beniseed]
ref|XP_006347448.1|  PREDICTED: anthranilate phosphoribosyltransf...    296   7e-95    
ref|XP_004241509.1|  PREDICTED: anthranilate phosphoribosyltransf...    296   7e-95    
ref|XP_002273812.1|  PREDICTED: anthranilate phosphoribosyltransf...    296   9e-95    Vitis vinifera
ref|XP_010027548.1|  PREDICTED: anthranilate phosphoribosyltransf...    296   1e-94    Eucalyptus grandis [rose gum]
ref|XP_011098450.1|  PREDICTED: anthranilate phosphoribosyltransf...    295   2e-94    Sesamum indicum [beniseed]
ref|XP_010248533.1|  PREDICTED: anthranilate phosphoribosyltransf...    295   3e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010248535.1|  PREDICTED: anthranilate phosphoribosyltransf...    295   3e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010678793.1|  PREDICTED: anthranilate phosphoribosyltransf...    294   4e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010248534.1|  PREDICTED: anthranilate phosphoribosyltransf...    293   2e-93    Nelumbo nucifera [Indian lotus]
ref|XP_010110365.1|  Anthranilate phosphoribosyltransferase             292   2e-93    
ref|XP_008245012.1|  PREDICTED: anthranilate phosphoribosyltransf...    292   4e-93    Prunus mume [ume]
emb|CDP16914.1|  unnamed protein product                                291   1e-92    Coffea canephora [robusta coffee]
ref|XP_009362988.1|  PREDICTED: anthranilate phosphoribosyltransf...    290   1e-92    Pyrus x bretschneideri [bai li]
ref|XP_007211039.1|  hypothetical protein PRUPE_ppa019367mg             290   2e-92    
ref|XP_008374423.1|  PREDICTED: anthranilate phosphoribosyltransf...    289   4e-92    Malus domestica [apple tree]
gb|KJB53198.1|  hypothetical protein B456_008G296400                    286   2e-91    Gossypium raimondii
gb|KJB53197.1|  hypothetical protein B456_008G296400                    286   4e-91    Gossypium raimondii
ref|XP_008351797.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    285   2e-90    
ref|XP_008367540.1|  PREDICTED: anthranilate phosphoribosyltransf...    281   6e-90    
ref|XP_006840664.1|  hypothetical protein AMTR_s00096p00025660          284   9e-90    Amborella trichopoda
ref|XP_003601245.1|  Anthranilate phosphoribosyltransferase             282   1e-89    Medicago truncatula
ref|XP_007036259.1|  Tryptophan biosynthesis 1                          283   2e-89    
ref|XP_009768650.1|  PREDICTED: anthranilate phosphoribosyltransf...    281   4e-89    Nicotiana sylvestris
gb|KHG01059.1|  Anthranilate phosphoribosyltransferase, chloropla...    281   5e-89    Gossypium arboreum [tree cotton]
gb|EYU22141.1|  hypothetical protein MIMGU_mgv1a007249mg                281   5e-89    Erythranthe guttata [common monkey flower]
ref|XP_004252211.1|  PREDICTED: anthranilate phosphoribosyltransf...    279   2e-88    Solanum lycopersicum
emb|CDP02090.1|  unnamed protein product                                280   5e-88    Coffea canephora [robusta coffee]
ref|XP_010251181.1|  PREDICTED: anthranilate phosphoribosyltransf...    278   9e-88    Nelumbo nucifera [Indian lotus]
ref|XP_009597049.1|  PREDICTED: anthranilate phosphoribosyltransf...    278   2e-87    Nicotiana tomentosiformis
ref|XP_009768649.1|  PREDICTED: anthranilate phosphoribosyltransf...    277   2e-87    Nicotiana sylvestris
ref|XP_009787826.1|  PREDICTED: anthranilate phosphoribosyltransf...    276   3e-87    Nicotiana sylvestris
ref|XP_010549687.1|  PREDICTED: anthranilate phosphoribosyltransf...    277   4e-87    Tarenaya hassleriana [spider flower]
gb|AFW89747.1|  hypothetical protein ZEAMMB73_227948                    268   5e-87    
ref|XP_011071889.1|  PREDICTED: anthranilate phosphoribosyltransf...    276   5e-87    Sesamum indicum [beniseed]
gb|ACL53714.1|  unknown                                                 268   1e-86    Zea mays [maize]
ref|XP_009762501.1|  PREDICTED: anthranilate phosphoribosyltransf...    274   3e-86    Nicotiana sylvestris
ref|XP_006650997.1|  PREDICTED: anthranilate phosphoribosyltransf...    271   4e-86    Oryza brachyantha
ref|NP_001130955.1|  blue fluorescent1                                  269   7e-86    
ref|XP_008812170.1|  PREDICTED: anthranilate phosphoribosyltransf...    273   8e-86    Phoenix dactylifera
gb|AAO72571.1|  putative phosphoribosylanthranilate transferase         270   1e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009597051.1|  PREDICTED: anthranilate phosphoribosyltransf...    273   3e-85    
ref|XP_002318059.2|  hypothetical protein POPTR_0012s08440g             271   7e-85    
gb|ABF93754.1|  Anthranilate phosphoribosyltransferase, chloropla...    270   7e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003558920.1|  PREDICTED: anthranilate phosphoribosyltransf...    270   9e-85    Brachypodium distachyon [annual false brome]
dbj|BAJ87749.1|  predicted protein                                      270   1e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011001513.1|  PREDICTED: anthranilate phosphoribosyltransf...    271   1e-84    Populus euphratica
ref|XP_006287763.1|  hypothetical protein CARUB_v10000975mg             271   1e-84    Capsella rubella
ref|XP_009762500.1|  PREDICTED: anthranilate phosphoribosyltransf...    270   1e-84    Nicotiana sylvestris
ref|NP_001048822.1|  Os03g0126000                                       270   1e-84    
ref|XP_002511378.1|  anthranilate phosphoribosyltransferase, puta...    270   1e-84    Ricinus communis
ref|XP_008658036.1|  PREDICTED: blue fluorescent1 isoform X1            269   2e-84    
gb|AAM19104.1|AC104427_2  Putative phosphoribosylanthranilate tra...    269   2e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88350.1|  hypothetical protein OsI_09808                          269   3e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_010940166.1|  PREDICTED: anthranilate phosphoribosyltransf...    268   6e-84    Elaeis guineensis
ref|XP_010421683.1|  PREDICTED: anthranilate phosphoribosyltransf...    268   6e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010940167.1|  PREDICTED: anthranilate phosphoribosyltransf...    268   6e-84    Elaeis guineensis
ref|XP_010454020.1|  PREDICTED: anthranilate phosphoribosyltransf...    269   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010454019.1|  PREDICTED: anthranilate phosphoribosyltransf...    269   1e-83    Camelina sativa [gold-of-pleasure]
ref|NP_197300.1|  anthranilate phosphoribosyltransferase                269   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421681.1|  PREDICTED: anthranilate phosphoribosyltransf...    268   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010492792.1|  PREDICTED: anthranilate phosphoribosyltransf...    268   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_010492791.1|  PREDICTED: anthranilate phosphoribosyltransf...    268   2e-83    Camelina sativa [gold-of-pleasure]
gb|AAB02913.1|  phosphoribosylanthranilate transferase                  267   3e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871793.1|  hypothetical protein ARALYDRAFT_909800             267   3e-83    Arabidopsis lyrata subsp. lyrata
ref|XP_008438562.1|  PREDICTED: anthranilate phosphoribosyltransf...    266   5e-83    Cucumis melo [Oriental melon]
ref|XP_011001516.1|  PREDICTED: anthranilate phosphoribosyltransf...    266   6e-83    Populus euphratica
ref|XP_009121033.1|  PREDICTED: anthranilate phosphoribosyltransf...    266   7e-83    Brassica rapa
emb|CDY38473.1|  BnaA10g16850D                                          266   8e-83    Brassica napus [oilseed rape]
ref|XP_011001514.1|  PREDICTED: anthranilate phosphoribosyltransf...    266   9e-83    Populus euphratica
ref|XP_007138060.1|  hypothetical protein PHAVU_009G177200g             265   9e-83    Phaseolus vulgaris [French bean]
ref|XP_004985893.1|  PREDICTED: anthranilate phosphoribosyltransf...    265   1e-82    Setaria italica
emb|CDY25471.1|  BnaC09g39860D                                          265   4e-82    Brassica napus [oilseed rape]
ref|XP_006400342.1|  hypothetical protein EUTSA_v10013530mg             265   4e-82    Eutrema salsugineum [saltwater cress]
gb|AFK40049.1|  unknown                                                 263   6e-82    Lotus japonicus
ref|XP_002465954.1|  hypothetical protein SORBIDRAFT_01g048790          262   8e-82    
ref|XP_010420535.1|  PREDICTED: anthranilate phosphoribosyltransf...    263   1e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010420534.1|  PREDICTED: anthranilate phosphoribosyltransf...    263   1e-81    Camelina sativa [gold-of-pleasure]
gb|KDO69598.1|  hypothetical protein CISIN_1g023127mg                   254   2e-81    Citrus sinensis [apfelsine]
ref|XP_004501915.1|  PREDICTED: anthranilate phosphoribosyltransf...    262   4e-81    Cicer arietinum [garbanzo]
gb|ADZ24712.1|  anthranilate phosphoribosyltransferase                  259   5e-81    Solanum pennellii
ref|XP_009126226.1|  PREDICTED: anthranilate phosphoribosyltransf...    261   6e-81    Brassica rapa
gb|KDO69600.1|  hypothetical protein CISIN_1g023127mg                   256   8e-81    Citrus sinensis [apfelsine]
emb|CDY02664.1|  BnaC02g07710D                                          261   9e-81    
emb|CDX85428.1|  BnaA02g03850D                                          261   9e-81    
gb|KDO69595.1|  hypothetical protein CISIN_1g023127mg                   255   1e-80    Citrus sinensis [apfelsine]
ref|XP_004298957.1|  PREDICTED: anthranilate phosphoribosyltransf...    259   1e-80    Fragaria vesca subsp. vesca
gb|KDO69597.1|  hypothetical protein CISIN_1g023127mg                   255   1e-80    Citrus sinensis [apfelsine]
ref|XP_004152482.1|  PREDICTED: anthranilate phosphoribosyltransf...    259   1e-80    Cucumis sativus [cucumbers]
gb|EMS54550.1|  Anthranilate phosphoribosyltransferase, chloropla...    258   2e-80    Triticum urartu
gb|KDO69596.1|  hypothetical protein CISIN_1g023127mg                   255   2e-80    Citrus sinensis [apfelsine]
ref|XP_003523084.1|  PREDICTED: anthranilate phosphoribosyltransf...    258   5e-80    Glycine max [soybeans]
ref|XP_004501916.1|  PREDICTED: anthranilate phosphoribosyltransf...    259   6e-80    Cicer arietinum [garbanzo]
ref|XP_011028718.1|  PREDICTED: anthranilate phosphoribosyltransf...    254   9e-80    Populus euphratica
ref|XP_010660887.1|  PREDICTED: anthranilate phosphoribosyltransf...    257   1e-79    Vitis vinifera
gb|KFK26024.1|  hypothetical protein AALP_AA8G193700                    257   2e-79    Arabis alpina [alpine rockcress]
ref|XP_006476804.1|  PREDICTED: anthranilate phosphoribosyltransf...    256   5e-79    Citrus sinensis [apfelsine]
ref|XP_006439846.1|  hypothetical protein CICLE_v10020016mg             255   5e-78    
ref|XP_006439849.1|  hypothetical protein CICLE_v10020016mg             254   6e-78    
ref|XP_006439847.1|  hypothetical protein CICLE_v10020016mg             254   6e-78    
ref|XP_009383611.1|  PREDICTED: anthranilate phosphoribosyltransf...    248   3e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008813580.1|  PREDICTED: anthranilate phosphoribosyltransf...    248   3e-76    Phoenix dactylifera
emb|CAN74291.1|  hypothetical protein VITISV_015980                     255   3e-75    Vitis vinifera
gb|KJB53200.1|  hypothetical protein B456_008G296400                    243   1e-74    Gossypium raimondii
ref|XP_009597052.1|  PREDICTED: anthranilate phosphoribosyltransf...    241   3e-73    
ref|XP_001774234.1|  predicted protein                                  238   4e-72    
gb|KDO69601.1|  hypothetical protein CISIN_1g023127mg                   228   2e-70    Citrus sinensis [apfelsine]
ref|XP_011464025.1|  PREDICTED: anthranilate phosphoribosyltransf...    231   1e-69    Fragaria vesca subsp. vesca
ref|XP_009787827.1|  PREDICTED: anthranilate phosphoribosyltransf...    228   9e-69    Nicotiana sylvestris
ref|XP_009776444.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    225   1e-68    Nicotiana sylvestris
ref|XP_006439848.1|  hypothetical protein CICLE_v10020016mg             228   5e-68    
gb|KEH35038.1|  anthranilate phosphoribosyltransferase                  222   2e-66    Medicago truncatula
ref|XP_002986483.1|  hypothetical protein SELMODRAFT_425447             219   3e-65    
ref|XP_002964901.1|  hypothetical protein SELMODRAFT_230552             218   1e-64    
ref|XP_008813581.1|  PREDICTED: anthranilate phosphoribosyltransf...    207   8e-61    
emb|CEF98313.1|  Glycosyl transferase, family 3                         198   3e-57    Ostreococcus tauri
gb|AFW89746.1|  hypothetical protein ZEAMMB73_227948                    194   5e-56    
ref|XP_003079802.1|  phosphoribosylanthranilate transferase (ISS)       190   3e-54    
ref|XP_001418201.1|  predicted protein                                  190   4e-54    Ostreococcus lucimarinus CCE9901
gb|EPS69209.1|  hypothetical protein M569_05556                         178   2e-52    Genlisea aurea
ref|XP_011400011.1|  Anthranilate phosphoribosyltransferase, chlo...    182   9e-52    Auxenochlorella protothecoides
ref|XP_007513285.1|  anthranilate phosphoribosyltransferase             181   1e-50    Bathycoccus prasinos
ref|XP_005704575.1|  anthranilate phosphoribosyltransferase             183   3e-50    Galdieria sulphuraria
ref|XP_005715714.1|  unnamed protein product                            177   4e-49    Chondrus crispus [carageen]
ref|XP_002500831.1|  predicted protein                                  171   7e-49    Micromonas commoda
ref|XP_005650910.1|  anthranilate phosphoribosyltransferase             174   2e-48    Coccomyxa subellipsoidea C-169
ref|XP_005844184.1|  hypothetical protein CHLNCDRAFT_27114              174   4e-48    Chlorella variabilis
ref|XP_001702699.1|  anthranilate phosphoribosyltransferase             171   1e-46    Chlamydomonas reinhardtii
gb|KDO69602.1|  hypothetical protein CISIN_1g023127mg                   165   4e-46    Citrus sinensis [apfelsine]
gb|KDD75826.1|  glycosyl transferase                                    166   2e-45    Helicosporidium sp. ATCC 50920
gb|KDO25949.1|  anthranilate phosphoribosyltransferase                  163   4e-44    Saprolegnia parasitica CBS 223.65
ref|XP_008614909.1|  anthranilate phosphoribosyltransferase             163   5e-44    Saprolegnia diclina VS20
ref|WP_027089668.1|  anthranilate phosphoribosyltransferase [           162   5e-44    [Clostridium] saccharogumia
ref|WP_024722206.1|  anthranilate phosphoribosyltransferase             162   5e-44    Clostridiales bacterium VE202-01
ref|WP_013943362.1|  anthranilate phosphoribosyltransferase             161   1e-43    
ref|XP_002182062.1|  predicted protein                                  161   2e-43    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_006400341.1|  hypothetical protein EUTSA_v10013530mg             160   5e-43    
ref|XP_008867255.1|  anthranilate phosphoribosyltransferase, vari...    159   1e-42    Aphanomyces invadans
ref|WP_011457991.1|  anthranilate phosphoribosyltransferase             156   1e-41    Chlamydia felis
ref|XP_009828138.1|  anthranilate phosphoribosyltransferase             154   1e-40    Aphanomyces astaci
ref|WP_013798972.1|  anthranilate phosphoribosyltransferase             152   3e-40    
ref|WP_033166158.1|  anthranilate phosphoribosyltransferase             152   3e-40    Clostridium sp. KNHs205
ref|WP_003536516.1|  MULTISPECIES: anthranilate phosphoribosyltra...    152   3e-40    Erysipelotrichaceae
ref|WP_008791409.1|  anthranilate phosphoribosyltransferase             152   4e-40    Erysipelotrichaceae
ref|XP_005853457.1|  anthranilate phosphoribosyltransferase             152   6e-40    Nannochloropsis gaditana CCMP526
ref|WP_026492110.1|  MULTISPECIES: anthranilate phosphoribosyltra...    152   7e-40    Butyrivibrio
gb|KJF17241.1|  anthranilate phosphoribosyltransferase                  151   1e-39    Acidithrix ferrooxidans
ref|WP_009005354.1|  anthranilate phosphoribosyltransferase             151   1e-39    Clostridium sp. D5
gb|AHF09860.1|  anthranilate phosphoribosyltransferase                  150   1e-39    Dehalobacter restrictus DSM 9455
ref|WP_038603201.1|  anthranilate phosphoribosyltransferase             150   1e-39    Dehalobacter restrictus
ref|WP_015359669.1|  MULTISPECIES: anthranilate phosphoribosyltra...    150   2e-39    Thermoclostridium stercorarium
ref|WP_026657597.1|  anthranilate phosphoribosyltransferase             150   2e-39    Butyrivibrio sp. AC2005
ref|WP_026496455.1|  anthranilate phosphoribosyltransferase             150   2e-39    Butyrivibrio sp. WCD3002
ref|WP_027434225.1|  anthranilate phosphoribosyltransferase             150   3e-39    Lachnospiraceae bacterium MD2004
ref|WP_019225527.1|  anthranilate phosphoribosyltransferase             150   3e-39    Dehalobacter sp. E1
ref|WP_026670938.1|  anthranilate phosphoribosyltransferase             150   3e-39    Butyrivibrio sp. AE3006
ref|WP_011639806.1|  anthranilate phosphoribosyltransferase             150   4e-39    Syntrophomonas wolfei
ref|WP_014587514.1|  anthranilate phosphoribosyltransferase             150   4e-39    Methanosaeta harundinacea
ref|WP_025657700.1|  anthranilate phosphoribosyltransferase             150   4e-39    Hungatella hathewayi
ref|WP_006715793.1|  anthranilate phosphoribosyltransferase             150   4e-39    Desulfitobacterium metallireducens
gb|EWM24949.1|  anthranilate phosphoribosyltransferase                  152   4e-39    Nannochloropsis gaditana
ref|WP_018591472.1|  hypothetical protein                               149   5e-39    Terrisporobacter glycolicus
ref|WP_020491591.1|  anthranilate phosphoribosyltransferase             149   5e-39    Dehalobacter sp. FTH1
ref|WP_022777376.1|  anthranilate phosphoribosyltransferase             149   5e-39    Butyrivibrio sp. AE3009
ref|WP_022856711.1|  anthranilate phosphoribosyltransferase             149   7e-39    Alloscardovia omnicolens
ref|WP_028246671.1|  anthranilate phosphoribosyltransferase             149   7e-39    Pseudobutyrivibrio
gb|EJK51401.1|  hypothetical protein THAOC_29427                        149   9e-39    Thalassiosira oceanica
ref|WP_007044222.1|  anthranilate phosphoribosyltransferase             149   9e-39    
ref|WP_022449488.1|  anthranilate phosphoribosyltransferase             149   1e-38    
ref|WP_026517738.1|  anthranilate phosphoribosyltransferase             149   1e-38    Butyrivibrio sp. MC2021
ref|WP_015042598.1|  MULTISPECIES: anthranilate phosphoribosyltra...    148   1e-38    Dehalobacter
ref|WP_026525919.1|  anthranilate phosphoribosyltransferase             148   1e-38    Butyrivibrio sp. MB2005
ref|WP_014867406.1|  anthranilate phosphoribosyltransferase             148   2e-38    Methanoculleus bourgensis
ref|WP_004593546.1|  anthranilate phosphoribosyltransferase             148   2e-38    Methanocaldococcus villosus
ref|XP_005535316.1|  anthranilate phosphoribosyltransferase             150   2e-38    Cyanidioschyzon merolae strain 10D
ref|WP_028077075.1|  anthranilate phosphoribosyltransferase             147   4e-38    Solirubrobacterales bacterium URHD0059
ref|XP_008867256.1|  anthranilate phosphoribosyltransferase, vari...    147   4e-38    Aphanomyces invadans
ref|WP_011006520.1|  anthranilate phosphoribosyltransferase             147   4e-38    Chlamydia caviae
ref|WP_009145722.1|  anthranilate phosphoribosyltransferase             147   5e-38    Phascolarctobacterium succinatutens
ref|WP_015791010.1|  anthranilate phosphoribosyltransferase             146   8e-38    
ref|WP_016279538.1|  anthranilate phosphoribosyltransferase             146   9e-38    Lachnospiraceae bacterium A4
ref|WP_015733750.1|  anthranilate phosphoribosyltransferase             146   1e-37    Methanocaldococcus vulcanius
ref|WP_021719556.1|  anthranilate phosphoribosyltransferase             146   1e-37    
ref|XP_005780664.1|  hypothetical protein EMIHUDRAFT_442980             146   1e-37    Emiliania huxleyi CCMP1516
ref|XP_005792526.1|  hypothetical protein EMIHUDRAFT_439707             146   1e-37    Emiliania huxleyi CCMP1516
ref|WP_041668704.1|  anthranilate phosphoribosyltransferase             145   1e-37    Acetobacterium woodii
gb|AFA48816.1|  anthranilate phosphoribosyltransferase TrpD             145   1e-37    Acetobacterium woodii DSM 1030
emb|CCZ23595.1|  anthranilate phosphoribosyltransferase                 145   1e-37    Coprobacillus sp. CAG:235
gb|AHG04416.1|  anthranilate phosphoribosyltransferase                  145   1e-37    Halobacterium sp. DL1
ref|WP_026652928.1|  anthranilate phosphoribosyltransferase             145   1e-37    Butyrivibrio proteoclasticus
ref|WP_014424144.1|  anthranilate phosphoribosyltransferase             145   1e-37    Selenomonas ruminantium
ref|WP_013719039.1|  anthranilate phosphoribosyltransferase             145   2e-37    Methanothrix soehngenii
gb|AIJ06409.1|  anthranilate phosphoribosyltransferase                  145   2e-37    Methanocaldococcus bathoardescens
ref|WP_012981387.1|  anthranilate phosphoribosyltransferase             145   2e-37    
gb|KDE55247.1|  anthranilate phosphoribosyltransferase                  145   3e-37    Methanoculleus sp. MH98A
ref|WP_029506616.1|  MULTISPECIES: anthranilate phosphoribosyltra...    144   4e-37    unclassified Lachnospiraceae
ref|WP_018133252.1|  hypothetical protein                               144   4e-37    Effusibacillus pohliae
ref|WP_031389016.1|  anthranilate phosphoribosyltransferase             144   4e-37    Kineothrix alysoides
ref|WP_022299939.1|  anthranilate phosphoribosyltransferase 1           144   5e-37    
ref|WP_040196665.1|  anthranilate phosphoribosyltransferase             144   5e-37    Candidatus Soleaferrea massiliensis
ref|WP_013778687.1|  anthranilate phosphoribosyltransferase             144   5e-37    Tepidanaerobacter acetatoxydans
ref|WP_013485217.1|  anthranilate phosphoribosyltransferase             144   6e-37    Ethanoligenens harbinense
ref|WP_040598214.1|  anthranilate phosphoribosyltransferase             144   7e-37    
ref|WP_027438851.1|  anthranilate phosphoribosyltransferase             144   7e-37    Lachnospira multipara
ref|WP_035599936.1|  anthranilate phosphoribosyltransferase             144   7e-37    Hyphomonas polymorpha
ref|WP_031558137.1|  anthranilate phosphoribosyltransferase             144   7e-37    Lachnospira multipara
ref|WP_010253936.1|  anthranilate phosphoribosyltransferase             144   7e-37    Treponema primitia
ref|WP_022203837.1|  anthranilate phosphoribosyltransferase             144   8e-37    
ref|WP_011842929.1|  anthranilate phosphoribosyltransferase             144   8e-37    Methanoculleus marisnigri
ref|WP_026510516.1|  anthranilate phosphoribosyltransferase             143   9e-37    Butyrivibrio
ref|WP_008789151.1|  MULTISPECIES: anthranilate phosphoribosyltra...    143   1e-36    Coprobacillus cateniformis
gb|EHN12339.1|  Anthranilate phosphoribosyltransferase                  144   1e-36    Patulibacter medicamentivorans
ref|WP_022067441.1|  anthranilate phosphoribosyltransferase             143   1e-36    
ref|WP_010869732.1|  anthranilate phosphoribosyltransferase             142   2e-36    
ref|WP_027439836.1|  anthranilate phosphoribosyltransferase             142   2e-36    Lachnospiraceae bacterium AC2031
ref|WP_007391016.1|  anthranilate phosphoribosyltransferase             142   2e-36    Megasphaera sp. UPII 199-6
ref|WP_016369788.1|  anthranilate phosphoribosyltransferase             139   2e-36    
ref|WP_042688679.1|  anthranilate phosphoribosyltransferase             142   2e-36    
ref|WP_022004562.1|  anthranilate phosphoribosyltransferase             142   2e-36    
ref|XP_009040395.1|  hypothetical protein AURANDRAFT_31792              143   2e-36    Aureococcus anophagefferens
ref|WP_035453620.1|  anthranilate phosphoribosyltransferase             142   2e-36    Lactobacillus composti
ref|WP_022085658.1|  anthranilate phosphoribosyltransferase             142   2e-36    
ref|WP_004618449.1|  anthranilate phosphoribosyltransferase [           142   2e-36    Ruminiclostridium papyrosolvens
ref|WP_009256452.1|  MULTISPECIES: anthranilate phosphoribosyltra...    142   2e-36    Eisenbergiella tayi
ref|WP_031516208.1|  anthranilate phosphoribosyltransferase             142   2e-36    Desulfohalotomaculum alkaliphilum
gb|KGA10287.1|  anthranilate phosphoribosyltransferase                  142   2e-36    actinobacterium acAcidi
ref|WP_035166652.1|  anthranilate phosphoribosyltransferase             142   3e-36    Lactobacillus curieae
ref|WP_029413160.1|  anthranilate phosphoribosyltransferase             142   3e-36    
ref|WP_015516023.1|  anthranilate phosphoribosyltransferase             142   3e-36    [Eubacterium] rectale
ref|WP_038286365.1|  anthranilate phosphoribosyltransferase             142   3e-36    
ref|WP_032787364.1|  anthranilate phosphoribosyltransferase             139   3e-36    
ref|WP_034613118.1|  anthranilate phosphoribosyltransferase             140   3e-36    
ref|WP_028044471.1|  anthranilate phosphoribosyltransferase             142   3e-36    Candidatus Stoquefichus massiliensis
ref|WP_014315336.1|  anthranilate phosphoribosyltransferase             142   3e-36    Clostridium sp. BNL1100
ref|WP_022010738.1|  anthranilate phosphoribosyltransferase             142   3e-36    
ref|WP_003604072.1|  anthranilate phosphoribosyltransferase             142   3e-36    Lactobacillus paracasei
ref|WP_003577290.1|  MULTISPECIES: anthranilate phosphoribosyltra...    142   3e-36    Lactobacillus
ref|WP_028244049.1|  anthranilate phosphoribosyltransferase             142   3e-36    Pseudobutyrivibrio ruminis
ref|WP_009540248.1|  Anthranilate phosphoribosyltransferase             142   3e-36    Caenispirillum salinarum
ref|WP_015534413.1|  MULTISPECIES: anthranilate phosphoribosyltra...    142   3e-36    Coprococcus
ref|WP_016371724.1|  anthranilate phosphoribosyltransferase             142   3e-36    
ref|WP_021960818.1|  anthranilate phosphoribosyltransferase             142   4e-36    
ref|WP_016385052.1|  Anthranilate phosphoribosyltransferase             142   4e-36    Lactobacillus paracasei
ref|WP_007277249.1|  anthranilate phosphoribosyltransferase             141   5e-36    Lentisphaera araneosa
ref|WP_014795491.1|  MULTISPECIES: anthranilate phosphoribosyltra...    141   5e-36    Desulfitobacterium
ref|WP_011460914.1|  anthranilate phosphoribosyltransferase             141   5e-36    Desulfitobacterium hafniense
ref|WP_022262858.1|  anthranilate phosphoribosyltransferase             141   5e-36    
ref|WP_025746945.1|  anthranilate phosphoribosyltransferase             141   5e-36    Caldicoprobacter
ref|WP_032090620.1|  anthranilate phosphoribosyltransferase             141   5e-36    bacterium LF-3
ref|WP_022292977.1|  anthranilate phosphoribosyltransferase             141   5e-36    
ref|WP_022587344.1|  anthranilate phosphoribosyltransferase             141   5e-36    Caldanaerobacter subterraneus
ref|WP_004852788.1|  anthranilate phosphoribosyltransferase             141   5e-36    
ref|WP_012546835.1|  MULTISPECIES: anthranilate phosphoribosyltra...    141   5e-36    Thermodesulfovibrio
ref|WP_042687519.1|  anthranilate phosphoribosyltransferase             141   6e-36    Methermicoccus shengliensis
ref|WP_005604762.1|  anthranilate phosphoribosyltransferase             141   6e-36    Butyrivibrio crossotus
ref|WP_019266771.1|  anthranilate phosphoribosyltransferase             141   6e-36    Methanobrevibacter smithii
gb|KGP70395.1|  anthranilate phosphoribosyltransferase                  141   7e-36    
ref|WP_019267965.1|  anthranilate phosphoribosyltransferase             140   8e-36    Methanobrevibacter smithii
ref|WP_026497886.1|  anthranilate phosphoribosyltransferase             141   8e-36    Butyrivibrio sp. WCD2001
ref|WP_007781094.1|  anthranilate phosphoribosyltransferase             140   9e-36    Desulfosporosinus youngiae
ref|WP_022760689.1|  anthranilate phosphoribosyltransferase             140   9e-36    Butyrivibrio sp. AD3002
gb|EKQ25599.1|  anthranilate phosphoribosyltransferase                  138   1e-35    Lactobacillus paracasei
ref|WP_012743733.1|  anthranilate phosphoribosyltransferase             140   1e-35    [Eubacterium] rectale
ref|WP_031472958.1|  anthranilate phosphoribosyltransferase [           140   1e-35    [Clostridium] aminophilum
ref|WP_022927841.1|  anthranilate phosphoribosyltransferase             140   1e-35    Patulibacter americanus
ref|WP_015827536.1|  anthranilate phosphoribosyltransferase             140   1e-35    Hirschia baltica
ref|WP_029320541.1|  anthranilate phosphoribosyltransferase             140   2e-35    Butyrivibrio sp. AE3004
ref|WP_018305612.1|  anthranilate phosphoribosyltransferase             140   2e-35    Desulfitobacterium hafniense
ref|WP_009219285.1|  anthranilate phosphoribosyltransferase             140   2e-35    Lachnospiraceae bacterium oral taxon 500
ref|WP_003582892.1|  MULTISPECIES: anthranilate phosphoribosyltra...    140   2e-35    Lactobacillus casei group
ref|WP_029086870.1|  anthranilate phosphoribosyltransferase             140   2e-35    
ref|WP_005816888.1|  anthranilate phosphoribosyltransferase             140   2e-35    Desulfitobacterium hafniense
ref|WP_034214057.1|  anthranilate phosphoribosyltransferase             140   2e-35    
ref|WP_023463264.1|  anthranilate phosphoribosyltransferase             140   2e-35    
ref|WP_013379971.1|  anthranilate phosphoribosyltransferase             140   2e-35    
ref|WP_012470532.1|  anthranilate phosphoribosyltransferase             140   2e-35    
ref|WP_016250980.1|  anthranilate phosphoribosyltransferase             140   2e-35    
ref|WP_003783010.1|  anthranilate phosphoribosyltransferase             140   2e-35    
ref|WP_011646792.1|  MULTISPECIES: anthranilate phosphoribosyltra...    139   2e-35    
ref|WP_021906743.1|  anthranilate phosphoribosyltransferase             139   3e-35    
ref|WP_022398686.1|  anthranilate phosphoribosyltransferase             139   3e-35    
gb|AIZ55956.1|  anthranilate phosphoribosyltransferase                  139   3e-35    
ref|WP_042188710.1|  anthranilate phosphoribosyltransferase             139   3e-35    
gb|AEF85333.1|  anthranilate phosphoribosyltransferase                  139   3e-35    
ref|WP_011025818.1|  anthranilate phosphoribosyltransferase             139   3e-35    
ref|WP_021983099.1|  anthranilate phosphoribosyltransferase             139   3e-35    
ref|WP_016372759.1|  anthranilate phosphoribosyltransferase             139   3e-35    
ref|WP_028130051.1|  anthranilate phosphoribosyltransferase             139   3e-35    
ref|WP_022171591.1|  anthranilate phosphoribosyltransferase             139   4e-35    
ref|WP_021607371.1|  anthranilate phosphoribosyltransferase             140   4e-35    
gb|EPC70321.1|  anthranilate phosphoribosyltransferase                  139   4e-35    
ref|WP_003562641.1|  MULTISPECIES: anthranilate phosphoribosyltra...    139   4e-35    
ref|WP_003600736.1|  MULTISPECIES: anthranilate phosphoribosyltra...    139   4e-35    
ref|WP_008213768.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_026668179.1|  MULTISPECIES: anthranilate phosphoribosyltra...    139   5e-35    
gb|EEB76231.1|  anthranilate phosphoribosyltransferase                  138   5e-35    
ref|WP_012490786.1|  MULTISPECIES: anthranilate phosphoribosyltra...    139   5e-35    
ref|WP_041611824.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_009233544.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_013728973.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_026654134.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_011673966.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_003572950.1|  MULTISPECIES: anthranilate phosphoribosyltra...    139   5e-35    
ref|WP_026527271.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_021609624.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_019262637.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_012112104.1|  anthranilate phosphoribosyltransferase             139   5e-35    
ref|WP_020815105.1|  anthranilate phosphoribosyltransferase [           139   6e-35    
ref|WP_020058561.1|  hypothetical protein                               139   6e-35    
gb|EJY55027.1|  anthranilate phosphoribosyltransferase                  139   6e-35    
emb|CCK21027.1|  Anthranilate phosphoribosyltransferase                 139   6e-35    
gb|EFD94538.1|  putative anthranilate phosphoribosyltransferase         134   6e-35    
ref|WP_015926563.1|  anthranilate phosphoribosyltransferase [           138   7e-35    
ref|WP_040290216.1|  anthranilate phosphoribosyltransferase             139   7e-35    
ref|WP_008039210.1|  anthranilate phosphoribosyltransferase             138   7e-35    
emb|CCY34142.1|  anthranilate phosphoribosyltransferase                 138   7e-35    
ref|WP_026771942.1|  anthranilate phosphoribosyltransferase             138   7e-35    
ref|WP_009244063.1|  anthranilate phosphoribosyltransferase [           138   7e-35    
ref|WP_019265032.1|  anthranilate phosphoribosyltransferase             138   7e-35    
ref|WP_038353889.1|  anthranilate phosphoribosyltransferase             138   7e-35    
ref|WP_041343127.1|  anthranilate phosphoribosyltransferase             138   7e-35    
ref|WP_010018567.1|  anthranilate phosphoribosyltransferase             138   7e-35    
ref|WP_014902393.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_014940729.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_021938403.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_043883896.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_018212409.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_022225664.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_035046725.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_031407235.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_034989812.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_034421949.1|  anthranilate phosphoribosyltransferase             138   8e-35    
ref|WP_041331373.1|  anthranilate phosphoribosyltransferase             138   9e-35    
ref|WP_009452488.1|  anthranilate phosphoribosyltransferase             138   9e-35    
ref|WP_012522313.1|  anthranilate phosphoribosyltransferase             138   1e-34    
ref|WP_007595231.1|  anthranilate phosphoribosyltransferase             138   1e-34    
dbj|BAQ35181.1|  anthranilate phosphoribosyltransferase                 138   1e-34    
ref|WP_036978028.1|  anthranilate phosphoribosyltransferase             138   1e-34    
ref|WP_034543487.1|  anthranilate phosphoribosyltransferase             138   1e-34    
ref|WP_013703066.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_011696690.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_035624367.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_029231417.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_024832450.1|  anthranilate phosphoribosyltransferase [           137   1e-34    
ref|WP_023652759.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_004842043.1|  anthranilate phosphoribosyltransferase [           137   1e-34    
ref|WP_021871457.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_034230885.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_022075773.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_021899561.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_021420739.1|  anthranilate phosphoribosyltransferase             137   1e-34    
ref|WP_009270573.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_008816672.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_022046186.1|  anthranilate phosphoribosyltransferase             135   2e-34    
ref|WP_026507853.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_015549379.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_014120164.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_004032794.1|  MULTISPECIES: anthranilate phosphoribosyltra...    137   2e-34    
ref|WP_011954313.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_035767713.1|  anthranilate phosphoribosyltransferase             137   2e-34    
gb|KCZ71890.1|  anthranilate phosphoribosyltransferase                  137   2e-34    
ref|WP_010880074.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_008857487.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_006303751.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_034161228.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_009663198.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_026761201.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_035096722.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_015409033.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_019961839.1|  hypothetical protein                               137   2e-34    
ref|WP_022036941.1|  anthranilate phosphoribosyltransferase             137   2e-34    
ref|WP_014269562.1|  anthranilate phosphoribosyltransferase             137   3e-34    
ref|WP_022014196.1|  anthranilate phosphoribosyltransferase             137   3e-34    
ref|WP_005347784.1|  anthranilate phosphoribosyltransferase [           137   3e-34    
ref|WP_023844859.1|  anthranilate phosphoribosyltransferase             137   3e-34    
ref|WP_028052657.1|  anthranilate phosphoribosyltransferase             137   3e-34    
ref|WP_021770588.1|  anthranilate phosphoribosyltransferase             136   3e-34    
ref|WP_027109328.1|  anthranilate phosphoribosyltransferase             136   3e-34    
ref|WP_011580976.1|  anthranilate phosphoribosyltransferase             136   3e-34    
ref|WP_027868796.1|  anthranilate phosphoribosyltransferase             136   3e-34    
ref|WP_004613992.1|  MULTISPECIES: anthranilate phosphoribosyltra...    136   4e-34    
ref|WP_035444139.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_023777415.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_014183940.1|  anthranilate phosphoribosyltransferase             136   4e-34    
gb|EEI72679.1|  anthranilate phosphoribosyltransferase                  136   4e-34    
ref|WP_020073612.1|  anthranilate phosphoribosyltransferase [           136   4e-34    
ref|WP_037500343.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_013976631.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_007703753.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_022169329.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_042702408.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_035553995.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_019905087.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_043958001.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_027356811.1|  anthranilate phosphoribosyltransferase             136   4e-34    
ref|WP_042395446.1|  anthranilate phosphoribosyltransferase             136   4e-34    
emb|CBE68477.1|  anthranilate phosphoribosyltransferase                 137   5e-34    
gb|KCZ59115.1|  hypothetical protein HY36_07495                         136   5e-34    
ref|WP_027630300.1|  anthranilate phosphoribosyltransferase [           136   5e-34    
ref|WP_013480325.1|  anthranilate phosphoribosyltransferase             136   5e-34    
ref|WP_022866662.1|  anthranilate phosphoribosyltransferase             136   5e-34    
ref|WP_044595814.1|  anthranilate phosphoribosyltransferase             136   5e-34    
ref|WP_024010558.1|  anthranilate phosphoribosyltransferase             136   5e-34    
ref|WP_021986359.1|  anthranilate phosphoribosyltransferase             136   5e-34    
ref|WP_042736210.1|  anthranilate phosphoribosyltransferase             136   5e-34    
ref|WP_014051590.1|  anthranilate phosphoribosyltransferase             136   5e-34    
gb|EEI21166.1|  anthranilate phosphoribosyltransferase                  136   5e-34    
ref|WP_035462112.1|  MULTISPECIES: anthranilate phosphoribosyltra...    136   5e-34    
ref|WP_024607179.1|  anthranilate phosphoribosyltransferase             134   5e-34    
ref|XP_005972061.1|  PREDICTED: anthranilate phosphoribosyltransf...    135   5e-34    
ref|WP_007673167.1|  anthranilate phosphoribosyltransferase             136   6e-34    
ref|WP_006520490.1|  anthranilate phosphoribosyltransferase             136   6e-34    
ref|WP_034443295.1|  anthranilate phosphoribosyltransferase             135   6e-34    
ref|WP_014966882.1|  anthranilate phosphoribosyltransferase             136   6e-34    
ref|WP_022519460.1|  anthranilate phosphoribosyltransferase             135   6e-34    
ref|WP_025031096.1|  anthranilate phosphoribosyltransferase             136   6e-34    
ref|WP_021955594.1|  anthranilate phosphoribosyltransferase             135   6e-34    
ref|WP_005424253.1|  anthranilate phosphoribosyltransferase [           135   6e-34    
emb|CCC56906.1|  Anthranilate phosphoribosyltransferase                 135   6e-34    
ref|WP_013713078.1|  anthranilate phosphoribosyltransferase             135   7e-34    
ref|WP_004625897.1|  anthranilate phosphoribosyltransferase [           135   7e-34    
ref|WP_016215917.1|  anthranilate phosphoribosyltransferase             135   7e-34    
ref|WP_042429942.1|  anthranilate phosphoribosyltransferase             135   7e-34    
gb|KIR03025.1|  Anthranilate phosphoribosyltransferase                  135   8e-34    
ref|WP_024010956.1|  anthranilate phosphoribosyltransferase             135   8e-34    
ref|WP_007006693.1|  anthranilate phosphoribosyltransferase             135   8e-34    
ref|WP_025579712.1|  anthranilate phosphoribosyltransferase             135   8e-34    
ref|WP_022269976.1|  anthranilate phosphoribosyltransferase             135   8e-34    
ref|WP_008597515.1|  anthranilate phosphoribosyltransferase             135   8e-34    
ref|WP_023927736.1|  anthranilate phosphoribosyltransferase             135   8e-34    
ref|WP_044505399.1|  anthranilate phosphoribosyltransferase             135   8e-34    
ref|WP_008707337.1|  anthranilate phosphoribosyltransferase             135   8e-34    
ref|WP_022342832.1|  anthranilate phosphoribosyltransferase             135   9e-34    
ref|WP_028471997.1|  anthranilate phosphoribosyltransferase             135   9e-34    
ref|WP_005841656.1|  anthranilate phosphoribosyltransferase             135   9e-34    
ref|WP_026648322.1|  anthranilate phosphoribosyltransferase             135   9e-34    
ref|WP_026487250.1|  anthranilate phosphoribosyltransferase             135   9e-34    
ref|WP_026505475.1|  anthranilate phosphoribosyltransferase             135   9e-34    
ref|WP_006168198.1|  anthranilate phosphoribosyltransferase             135   9e-34    
ref|WP_021757897.1|  anthranilate phosphoribosyltransferase             135   9e-34    
ref|WP_036480368.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_002605842.1|  anthranilate phosphoribosyltransferase [           135   1e-33    
ref|WP_021147630.1|  Anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_021757430.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_014494983.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_026568700.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_024603092.1|  anthranilate phosphoribosyltransferase             132   1e-33    
ref|WP_036726294.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_019858172.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_012875196.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_018257609.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_031588219.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_021652159.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_038646849.1|  anthranilate phosphoribosyltransferase             135   1e-33    
gb|ETJ15351.1|  Anthranilate phosphoribosyltransferase                  133   1e-33    
ref|WP_022206834.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_044664512.1|  anthranilate phosphoribosyltransferase             131   1e-33    
ref|WP_004615230.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_013099705.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_029545612.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_015762727.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_023764944.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_027118322.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_021637217.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_004066869.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_011622242.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_013895392.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_026514974.1|  anthranilate phosphoribosyltransferase             135   1e-33    
ref|WP_022654488.1|  anthranilate phosphoribosyltransferase             135   2e-33    
ref|WP_013655737.1|  anthranilate phosphoribosyltransferase             135   2e-33    
ref|WP_006862978.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_012882499.1|  anthranilate phosphoribosyltransferase             135   2e-33    
ref|WP_019403646.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|XP_009534164.1|  hypothetical protein PHYSODRAFT_519060             135   2e-33    
ref|WP_027426362.1|  anthranilate phosphoribosyltransferase             134   2e-33    
gb|ETI33374.1|  anthranilate phosphoribosyltransferase                  135   2e-33    
ref|WP_027206603.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_040971660.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_035028678.1|  MULTISPECIES: anthranilate phosphoribosyltra...    134   2e-33    
ref|WP_004267056.1|  anthranilate phosphoribosyltransferase             134   2e-33    
dbj|BAA83386.1|  phosphoribosylanthranilate transferase                 134   2e-33    
ref|WP_038933108.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_008603168.1|  MULTISPECIES: anthranilate phosphoribosyltra...    134   2e-33    
ref|WP_027172407.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_006067691.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_009066288.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_004591605.1|  anthranilate phosphoribosyltransferase             134   2e-33    
gb|ETJ15054.1|  Anthranilate phosphoribosyltransferase                  134   2e-33    
ref|WP_011344489.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_027204710.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_012034194.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_022183672.1|  anthranilate phosphoribosyltransferase             134   2e-33    
ref|WP_026393284.1|  anthranilate phosphoribosyltransferase             134   2e-33    



>gb|EYU44770.1| hypothetical protein MIMGU_mgv1a007476mg [Erythranthe guttata]
Length=406

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAM+  APVRRKLR+KT+FN LG MLNPARVPF+VVGVY E++VSKMAKALQRYG
Sbjct  212  SPNYHPAMRTFAPVRRKLRVKTVFNILGPMLNPARVPFSVVGVYKEDMVSKMAKALQRYG  271

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLDITPEKIEKF+FDPL+FGIPRCTL+DL+G GPEYNA
Sbjct  272  MKRALVVHSEGLDEMSPLGPGVVLDITPEKIEKFSFDPLDFGIPRCTLEDLKGGGPEYNA  331

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVL+GE G IADA +LNAGAAL VSGHV  LA+GI +AR THRSGKAL TL  WI 
Sbjct  332  EVLRRVLAGEKGAIADALVLNAGAALFVSGHVSNLAEGIAVARSTHRSGKALDTLDRWIT  391

Query  222  VSNNVKEP  199
            VSNNV  P
Sbjct  392  VSNNVSAP  399



>gb|KDP31079.1| hypothetical protein JCGZ_11455 [Jatropha curcas]
Length=417

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV+PVR+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKALQR+G
Sbjct  224  SPKYHPAMKIVSPVRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVYKMAKALQRFG  283

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLDI+PEKIEKF FDPL+FGIPRCTL  L+G GPEYNA
Sbjct  284  MKRALVVHSEGLDEMSPLGPGLVLDISPEKIEKFLFDPLDFGIPRCTLDSLRGGGPEYNA  343

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++LKRVLSGE GPIADAFILNA AALLVSG V TLA GI LAR    SGKA+ TL  WI 
Sbjct  344  EMLKRVLSGEKGPIADAFILNAAAALLVSGLVNTLADGIALAREAQSSGKAIETLDLWIK  403

Query  222  VSNNVKE  202
            VSN VKE
Sbjct  404  VSNKVKE  410



>ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Vitis vinifera]
 emb|CBI15006.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV PVR+KL++KT+FN LG MLNPARVPFAVVGV+ E++V KMAKALQR+G
Sbjct  203  APIYHPAMKIVGPVRKKLKVKTVFNILGPMLNPARVPFAVVGVFTEDLVLKMAKALQRFG  262

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGIPRCTL DL+G GP+YNA
Sbjct  263  MKRALVVHSEGLDEMSPLGPGLVLDVTPEKIEKFSFDPLEFGIPRCTLDDLRGGGPDYNA  322

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VLKRVLSGE G IADAF+LNA AALLVSG V TLA G+ LAR T  SGKA+ TL  WI+
Sbjct  323  EVLKRVLSGEKGSIADAFVLNAAAALLVSGRVNTLADGVSLARETQESGKAIKTLDLWIE  382

Query  222  VSNNVK  205
            +SN  K
Sbjct  383  ISNKAK  388



>ref|XP_006364000.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Solanum tuberosum]
Length=384

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 164/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SPYYHPAM+IV PVRRKLR+KTIFN LG ++NPA VPFAVVGVY +++VSKMAKALQ YG
Sbjct  196  SPYYHPAMRIVTPVRRKLRVKTIFNILGPLINPAWVPFAVVGVYKQDIVSKMAKALQSYG  255

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPL+FGIPRCTL++L+G GPEYNA
Sbjct  256  MKRALVVHSEGLDEMSPLGPGVVLDVTPEKIEKFSFDPLDFGIPRCTLRNLKGGGPEYNA  315

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE GPIADA ILNA AALLVSG V  LA+G+ +AR TH SGKAL+TL  WI 
Sbjct  316  EVLRRVLSGERGPIADALILNASAALLVSGRVGNLAEGVAVARMTHESGKALNTLNHWIG  375

Query  222  VSNNV  208
            VS ++
Sbjct  376  VSTDI  380



>gb|KJB53199.1| hypothetical protein B456_008G296400 [Gossypium raimondii]
Length=408

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 166/187 (89%), Gaps = 2/187 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV+ VR+KL+IKT+FN LG MLNPARVPFAVVGVY+E++V KMAKALQR+G
Sbjct  219  APKYHPAMKIVSGVRKKLKIKTVFNVLGPMLNPARVPFAVVGVYHEDLVFKMAKALQRFG  278

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGIPRCTL DL+G G  YNA
Sbjct  279  MKRALVVHSEGLDEMSPLGPGRVLDVTPEKIEKFSFDPLEFGIPRCTLDDLRGGGKNYNA  338

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVLKR+LSGE+GPIA+  ILNA AALLVSGHVK+L++G+ LAR T  SGKAL+TL  WID
Sbjct  339  DVLKRILSGESGPIAE--ILNAAAALLVSGHVKSLSEGVALARETQLSGKALNTLNSWID  396

Query  222  VSNNVKE  202
            +SN V E
Sbjct  397  ISNKVNE  403



>ref|XP_006347447.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=401

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKALQR+G
Sbjct  210  SPIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKALQRFG  269

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TP+ IEKF+FDPL+FGIPRCTL+ L+G GPEYNA
Sbjct  270  MKRALVVHSEGLDEMSPLGPGLVLDVTPDNIEKFSFDPLDFGIPRCTLESLRGGGPEYNA  329

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++L+RVLSGE G IADAF LNA AALLVSG V  LA+G+ELAR T  SGKA+ TL  WI+
Sbjct  330  EILRRVLSGEKGSIADAFALNASAALLVSGRVDNLAEGVELARETLLSGKAVKTLDLWIE  389

Query  222  VSNNVKE  202
            VSN VKE
Sbjct  390  VSNKVKE  396



>ref|XP_004241508.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=401

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKALQR+G
Sbjct  210  SPIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKALQRFG  269

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TP+ IEKF+FDPL+FGIPRCTL+ L+G GPEYNA
Sbjct  270  MKRALVVHSEGLDEMSPLGPGLVLDVTPDNIEKFSFDPLDFGIPRCTLESLRGGGPEYNA  329

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++L+RVLSGE G IADAF LNA AALLVSG V  LA+G+ELAR T  SGKA+ TL  WI+
Sbjct  330  EMLRRVLSGEKGSIADAFALNASAALLVSGRVDNLAEGVELARETLLSGKAVKTLDLWIE  389

Query  222  VSNNVKE  202
            VSN VKE
Sbjct  390  VSNTVKE  396



>ref|XP_011098449.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=403

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMK  APVRRKL +KT+FN LG MLNPARVPF+VVGVY E++VSKMAKALQRYG
Sbjct  211  SPNYHPAMKTFAPVRRKLGVKTVFNILGPMLNPARVPFSVVGVYKEDMVSKMAKALQRYG  270

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M+RALVVHSEGLDEMSPLGPG VLDITPEKIEKF FDPL+FGIPRCTL DLQG  P+YNA
Sbjct  271  MERALVVHSEGLDEMSPLGPGVVLDITPEKIEKFFFDPLDFGIPRCTLGDLQGGDPKYNA  330

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+ VLSG+ G +ADAF+LNA AAL VSGHV   A+GI LAR T RSGKAL TL  WI 
Sbjct  331  DVLRFVLSGKKGAVADAFVLNAAAALFVSGHVGNFAEGIALARETQRSGKALDTLDCWIR  390

Query  222  VSNNVK  205
            VSN VK
Sbjct  391  VSNKVK  396



>ref|XP_006347448.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=398

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKALQR+G
Sbjct  210  SPIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKALQRFG  269

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TP+ IEKF+FDPL+FGIPRCTL+ L+G GPEYNA
Sbjct  270  MKRALVVHSEGLDEMSPLGPGLVLDVTPDNIEKFSFDPLDFGIPRCTLESLRGGGPEYNA  329

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++L+RVLSGE G IADAF LNA AALLVSG V  LA+G+ELAR T  SGKA+ TL  WI+
Sbjct  330  EILRRVLSGEKGSIADAFALNASAALLVSGRVDNLAEGVELARETLLSGKAVKTLDLWIE  389

Query  222  VSN  214
            VSN
Sbjct  390  VSN  392



>ref|XP_004241509.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=398

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKALQR+G
Sbjct  210  SPIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKALQRFG  269

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TP+ IEKF+FDPL+FGIPRCTL+ L+G GPEYNA
Sbjct  270  MKRALVVHSEGLDEMSPLGPGLVLDVTPDNIEKFSFDPLDFGIPRCTLESLRGGGPEYNA  329

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++L+RVLSGE G IADAF LNA AALLVSG V  LA+G+ELAR T  SGKA+ TL  WI+
Sbjct  330  EMLRRVLSGEKGSIADAFALNASAALLVSGRVDNLAEGVELARETLLSGKAVKTLDLWIE  389

Query  222  VSN  214
            VSN
Sbjct  390  VSN  392



>ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI34893.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   296 bits (759),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YH AMKI APVR+KL +KT+FN LG MLNPARVPFAVVGVY +++V+KM KALQRYG
Sbjct  212  SPKYHGAMKIFAPVRKKLGVKTVFNILGPMLNPARVPFAVVGVYEDSMVTKMGKALQRYG  271

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TP K+EKF+FDP  FGIPRCTL+DL+G  PEYNA
Sbjct  272  MKRALVVHSEGLDEMSPLGPGVVLDVTPGKVEKFSFDPENFGIPRCTLEDLRGGDPEYNA  331

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+RVLSGE GPIADAF+LNA AALLVSGHV TL  G+ +AR TH SGKAL TL+ W +
Sbjct  332  KVLRRVLSGERGPIADAFVLNAAAALLVSGHVSTLGDGVAVARTTHLSGKALRTLQCWTE  391

Query  222  VSNNVKE  202
            +S+ VKE
Sbjct  392  ISSKVKE  398



>ref|XP_010027548.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Eucalyptus grandis]
 gb|KCW83358.1| hypothetical protein EUGRSUZ_B00293 [Eucalyptus grandis]
Length=403

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV+PVR+KL++KT+FN LG MLNPARVPFAVVGVY +++V KMAKALQR+G
Sbjct  215  APKYHPAMKIVSPVRKKLKVKTVFNVLGPMLNPARVPFAVVGVYKDDLVLKMAKALQRFG  274

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDE+SPLG G VLD+TPEKI++F+FDPL+FGIPRCTL+DL+G  P YNA
Sbjct  275  MKRALVVHSEGLDEISPLGAGVVLDVTPEKIDRFSFDPLDFGIPRCTLEDLRGGDPAYNA  334

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            + LK VLSGE GPIADAFILNA AALLV G V+TLA G+ LAR T +SG+AL TL  WI+
Sbjct  335  EALKHVLSGEKGPIADAFILNAAAALLVVGQVRTLADGVNLARETQQSGRALQTLSKWIN  394

Query  222  VSNNVKE  202
            +SN +KE
Sbjct  395  ISNKLKE  401



>ref|XP_011098450.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=402

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMK  APVRRKL +KT+FN LG MLNPARVPF+VVGVY E++VSKMAKALQRYG
Sbjct  211  SPNYHPAMKTFAPVRRKLGVKTVFNILGPMLNPARVPFSVVGVYKEDMVSKMAKALQRYG  270

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M+RALVVHSEGLDEMSPLGPG VLDITPEKIEKF FDPL+FGIPRCTL DLQG  P+YNA
Sbjct  271  MERALVVHSEGLDEMSPLGPGVVLDITPEKIEKFFFDPLDFGIPRCTLGDLQGGDPKYNA  330

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+ VLSG+ G +ADAF+LNA AAL VSGHV   A+GI LAR T RSGKAL TL  WI 
Sbjct  331  DVLRFVLSGKKGAVADAFVLNAAAALFVSGHVGNFAEGIALARETQRSGKALDTLDCWIR  390

Query  222  VSN  214
            VSN
Sbjct  391  VSN  393



>ref|XP_010248533.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=413

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIVAP+R+ L++KT+FN LG MLNPARVPFAVVGVYNE++V KMAKALQ++G
Sbjct  219  APRYHPAMKIVAPIRKTLKVKTVFNILGPMLNPARVPFAVVGVYNEDLVIKMAKALQKFG  278

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M RALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGI RC +++L+G  PEYNA
Sbjct  279  MXRALVVHSEGLDEMSPLGPGLVLDVTPEKIEKFSFDPLEFGIQRCKIENLRGGNPEYNA  338

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++L+RVLSGE G IADAF+LNA AALLVSG V +LA+G+ LA  T RSGKAL TL+ W+ 
Sbjct  339  EILRRVLSGEQGSIADAFVLNAAAALLVSGKVSSLAEGVTLASETQRSGKALKTLESWMR  398

Query  222  VSNNVKEP*TNGRID  178
            +SN VK+  T  R +
Sbjct  399  ISNKVKKEETMVRCN  413



>ref|XP_010248535.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X3 [Nelumbo nucifera]
Length=409

 Score =   295 bits (754),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIVAP+R+ L++KT+FN LG MLNPARVPFAVVGVYNE++V KMAKALQ++G
Sbjct  215  APRYHPAMKIVAPIRKTLKVKTVFNILGPMLNPARVPFAVVGVYNEDLVIKMAKALQKFG  274

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M RALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGI RC +++L+G  PEYNA
Sbjct  275  MXRALVVHSEGLDEMSPLGPGLVLDVTPEKIEKFSFDPLEFGIQRCKIENLRGGNPEYNA  334

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++L+RVLSGE G IADAF+LNA AALLVSG V +LA+G+ LA  T RSGKAL TL+ W+ 
Sbjct  335  EILRRVLSGEQGSIADAFVLNAAAALLVSGKVSSLAEGVTLASETQRSGKALKTLESWMR  394

Query  222  VSNNVKEP*TNGRID  178
            +SN VK+  T  R +
Sbjct  395  ISNKVKKEETMVRCN  409



>ref|XP_010678793.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=409

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMK+V P+R+KL++KT+FN LG MLNPARVP+ VVGVY+E++V+KMAKALQ +G
Sbjct  217  APTYHPAMKVVRPIRKKLKVKTVFNILGPMLNPARVPYKVVGVYSEDIVAKMAKALQSFG  276

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSP+GPG +LD+TP++IEKF+F+PL+FGIPRCT+KDL+G GPEYNA
Sbjct  277  MKRALVVHSEGLDEMSPMGPGMILDVTPDRIEKFSFEPLDFGIPRCTVKDLRGGGPEYNA  336

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VLKRVL GETG IADAF+LNA A+LLV G V  L  G+ LAR T +SGKAL  L+ WID
Sbjct  337  EVLKRVLGGETGSIADAFVLNAAASLLVCGLVSNLGDGVALARKTQQSGKALKKLESWID  396

Query  222  VSNNVKE  202
            VSN  KE
Sbjct  397  VSNKAKE  403



>ref|XP_010248534.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=412

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIVAP+R+ L++KT+FN LG MLNPARVPFAVVGVYNE++V KMAKALQ++G
Sbjct  219  APRYHPAMKIVAPIRKTLKVKTVFNILGPMLNPARVPFAVVGVYNEDLVIKMAKALQKFG  278

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M RALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGI RC +++L+G  PEYNA
Sbjct  279  MXRALVVHSEGLDEMSPLGPGLVLDVTPEKIEKFSFDPLEFGIQRCKIENLRGGNPEYNA  338

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++L+RVLSGE G IADAF+LNA AALLVSG V +LA+G+ LA  T RSGKAL TL+ W+ 
Sbjct  339  EILRRVLSGEQGSIADAFVLNAAAALLVSGKVSSLAEGVTLASETQRSGKALKTLESWMR  398

Query  222  VSNNVKE  202
            +SN  KE
Sbjct  399  ISNVKKE  405



>ref|XP_010110365.1| Anthranilate phosphoribosyltransferase [Morus notabilis]
 gb|EXC26103.1| Anthranilate phosphoribosyltransferase [Morus notabilis]
Length=401

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV PVR+KL++KT+FN LG +LNPARVP+AVVGVY E++V KMA+ALQR+G
Sbjct  214  APIYHPAMKIVRPVRKKLKVKTVFNVLGPLLNPARVPYAVVGVYAEDLVLKMAEALQRFG  273

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+TPEKIEKF+FDPL+FGIPRCTL +L+G GPEYNA
Sbjct  274  MKRALVVHSEGLDEMSPLGPGLILDVTPEKIEKFSFDPLDFGIPRCTLDNLRGGGPEYNA  333

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VLKRVLSGE   IADAFILNA AALLVS  V +LA+GI LAR T  SGKA+ TL  WI+
Sbjct  334  EVLKRVLSGEKSSIADAFILNAAAALLVSSRVNSLAEGIALARETQTSGKAIKTLDRWIE  393

Query  222  VSN  214
            +SN
Sbjct  394  ISN  396



>ref|XP_008245012.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Prunus mume]
Length=405

 Score =   292 bits (747),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM +V PVR+KL++KT+FN LG +LNPARVPFAVVGVY + +V KMAKALQ +G
Sbjct  214  APKYHPAMNVVRPVRKKLKVKTVFNILGPLLNPARVPFAVVGVYKDELVLKMAKALQSFG  273

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDEMSPLGPG +LD+TP KIE+F+FDPL+FGIPRCTL DL+G GPEYNA
Sbjct  274  MKRALVVHSQGLDEMSPLGPGHILDVTPNKIEEFSFDPLDFGIPRCTLDDLRGGGPEYNA  333

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            + LKRVLSGE G IADAFILNA AAL VSG V TLA+G+ LAR T  SGKA+ TL  W+D
Sbjct  334  EALKRVLSGEKGSIADAFILNAAAALFVSGQVNTLAEGVSLARETQISGKAIRTLDQWVD  393

Query  222  VSNNVKE  202
            +SN +K+
Sbjct  394  ISNTMKK  400



>emb|CDP16914.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV P+R+KL++KT+FN LG MLNPARVP+AVVGVY E++V KMA ALQR+G
Sbjct  216  SPIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPYAVVGVYAEDLVHKMANALQRFG  275

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+  +KIEKF+FDPL+FGIPRCTL  L+G  PEYNA
Sbjct  276  MKRALVVHSEGLDEMSPLGPGVVLDVKADKIEKFSFDPLDFGIPRCTLDALRGGEPEYNA  335

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADAF+LNA AA+LVSGHVK L++G+ LAR T  SGKAL TL  W +
Sbjct  336  EVLRRVLSGEQGAIADAFVLNAAAAILVSGHVKDLSEGVTLARQTLLSGKALKTLHSWKE  395

Query  222  VSNNVKE  202
            VSN  KE
Sbjct  396  VSNKAKE  402



>ref|XP_009362988.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Pyrus x bretschneideri]
Length=408

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM IV PVR+KL++KT+FN LG MLNPARVPFAVVGVY +++V KMAKALQ +G
Sbjct  217  APKYHPAMHIVHPVRKKLKVKTVFNVLGPMLNPARVPFAVVGVYKDDLVLKMAKALQSFG  276

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+TP KIE+F+FDPL+FGIPRCTL DL+G GPEYNA
Sbjct  277  MKRALVVHSEGLDEMSPLGPGHILDVTPNKIEEFSFDPLDFGIPRCTLDDLRGGGPEYNA  336

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D LKRVLSGE GP+ADAFIL A AALLVSG V TLA+GI LAR T  SGKA+  L  W+ 
Sbjct  337  DALKRVLSGEKGPVADAFILTAAAALLVSGRVNTLAEGISLARETQMSGKAIRILDQWVA  396

Query  222  VSNNV  208
            +SN +
Sbjct  397  ISNTM  401



>ref|XP_007211039.1| hypothetical protein PRUPE_ppa019367mg, partial [Prunus persica]
 gb|EMJ12238.1| hypothetical protein PRUPE_ppa019367mg, partial [Prunus persica]
Length=396

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM +V PVR+KL++KT+FN LG +LNPARVPFAVVGVY + +V KMAKALQ +G
Sbjct  214  APKYHPAMNVVRPVRKKLKVKTVFNILGPLLNPARVPFAVVGVYKDELVLKMAKALQSFG  273

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+TP KIE+F+FDPL+FGIPRCTL DL+G GPEYNA
Sbjct  274  MKRALVVHSEGLDEMSPLGPGHILDVTPNKIEEFSFDPLDFGIPRCTLDDLRGGGPEYNA  333

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            + LKRVLSGE G IADAFILNA AAL VSG V TLA+G+ LAR T  SGKA+ TL  W+D
Sbjct  334  EALKRVLSGEKGSIADAFILNAAAALFVSGRVNTLAEGVSLARETQISGKAIRTLDQWVD  393

Query  222  VSN  214
            +SN
Sbjct  394  ISN  396



>ref|XP_008374423.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Malus domestica]
Length=405

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM I+ PVR+KL++KT+FN LG MLNPARVPFAVVGVY +++V KMA ALQ +G
Sbjct  214  APKYHPAMHIIRPVRKKLKVKTVFNILGPMLNPARVPFAVVGVYKDDLVLKMANALQSFG  273

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+TP KIE+F+FDPL+FGIPRCTL DL+G GPEYNA
Sbjct  274  MKRALVVHSEGLDEMSPLGPGHILDVTPNKIEEFSFDPLDFGIPRCTLDDLRGGGPEYNA  333

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D LKRVLSGE G IADAFILNA AALLVSG V TLA+GI LAR T  SGKA+  L  W+ 
Sbjct  334  DALKRVLSGEKGAIADAFILNAAAALLVSGRVNTLAEGISLARETQLSGKAIRILDQWVA  393

Query  222  VSNNV  208
            +SN +
Sbjct  394  LSNTM  398



>gb|KJB53198.1| hypothetical protein B456_008G296400 [Gossypium raimondii]
Length=362

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV+ VR+KL+IKT+FN LG MLNPARVPFAVVGVY+E++V KMAKALQR+G
Sbjct  171  APKYHPAMKIVSGVRKKLKIKTVFNVLGPMLNPARVPFAVVGVYHEDLVFKMAKALQRFG  230

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGIPRCTL DL+G G  YNA
Sbjct  231  MKRALVVHSEGLDEMSPLGPGRVLDVTPEKIEKFSFDPLEFGIPRCTLDDLRGGGKNYNA  290

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVLKR+LSGE+GPIA+A ILNA AALLVSGHVK+L++G+ LAR T  SGKAL+TL  WID
Sbjct  291  DVLKRILSGESGPIAEALILNAAAALLVSGHVKSLSEGVALARETQLSGKALNTLNSWID  350

Query  222  VSNNVKE  202
            +SN V E
Sbjct  351  ISNKVNE  357



>gb|KJB53197.1| hypothetical protein B456_008G296400 [Gossypium raimondii]
Length=410

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV+ VR+KL+IKT+FN LG MLNPARVPFAVVGVY+E++V KMAKALQR+G
Sbjct  219  APKYHPAMKIVSGVRKKLKIKTVFNVLGPMLNPARVPFAVVGVYHEDLVFKMAKALQRFG  278

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGIPRCTL DL+G G  YNA
Sbjct  279  MKRALVVHSEGLDEMSPLGPGRVLDVTPEKIEKFSFDPLEFGIPRCTLDDLRGGGKNYNA  338

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVLKR+LSGE+GPIA+A ILNA AALLVSGHVK+L++G+ LAR T  SGKAL+TL  WID
Sbjct  339  DVLKRILSGESGPIAEALILNAAAALLVSGHVKSLSEGVALARETQLSGKALNTLNSWID  398

Query  222  VSNNVKE  202
            +SN V E
Sbjct  399  ISNKVNE  405



>ref|XP_008351797.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate phosphoribosyltransferase, 
chloroplastic-like [Malus domestica]
Length=408

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM IV PVR+KL++KT+FN LG +LNPARVPFAVVGVY +++V KMAKALQ +G
Sbjct  217  APKYHPAMHIVHPVRKKLKVKTVFNILGPLLNPARVPFAVVGVYKDDLVLKMAKALQSFG  276

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+TP KIE+F+FDPL+FGIPRCTL DL+G  PEYNA
Sbjct  277  MKRALVVHSEGLDEMSPLGPGHILDVTPNKIEEFSFDPLDFGIPRCTLDDLRGGXPEYNA  336

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D  KRVLSGE G +ADAFIL A AALLVSG V TLA+GI LAR T  SGKA+  L  W+ 
Sbjct  337  DAJKRVLSGEKGSVADAFILTAAAALLVSGRVNTLAEGISLARETQMSGKAIRILDQWVA  396

Query  222  VSNNV  208
            +SN +
Sbjct  397  ISNTM  401



>ref|XP_008367540.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Malus domestica]
Length=333

 Score =   281 bits (719),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM IV PVR+KL++KT+FN LG +LNPARVPFAVVGVY +++V KMAKALQ +G
Sbjct  142  APKYHPAMHIVHPVRKKLKVKTVFNILGPLLNPARVPFAVVGVYKDDLVLKMAKALQSFG  201

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+TP KIE+F+FDPL+FGIPRCTL DL+G  PEYNA
Sbjct  202  MKRALVVHSEGLDEMSPLGPGHILDVTPNKIEEFSFDPLDFGIPRCTLDDLRGGXPEYNA  261

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D  KRVLSGE G +ADAFIL A AALLVSG V TLA+GI LAR T  SGKA+  L  W+ 
Sbjct  262  DAJKRVLSGEKGSVADAFILTAAAALLVSGRVNTLAEGISLARETQMSGKAIRILDQWVA  321

Query  222  VSNNV  208
            +SN +
Sbjct  322  ISNTM  326



>ref|XP_006840664.1| hypothetical protein AMTR_s00096p00025660 [Amborella trichopoda]
 gb|ERN02339.1| hypothetical protein AMTR_s00096p00025660 [Amborella trichopoda]
Length=423

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK+V PVR+ L++KT+FN LG MLNPARVPFAVVGVY+ ++V KMAKALQ +G
Sbjct  231  APKFHPAMKVVGPVRKNLKVKTVFNILGPMLNPARVPFAVVGVYDVDIVGKMAKALQSFG  290

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M+RALVVHSEGLDEMSPLGPG +LD+TP KIEKF+FDPL+FGI RCTL+ L+G GPE+N+
Sbjct  291  MQRALVVHSEGLDEMSPLGPGMILDVTPGKIEKFSFDPLDFGIQRCTLESLKGGGPEFNS  350

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VLSGE G IADAF+LNA AALLVSGHV+TL++G+ +AR T  SGKA+ TL  W+ 
Sbjct  351  KVLRDVLSGERGAIADAFVLNAAAALLVSGHVQTLSEGVSMARETQESGKAIKTLDSWVS  410

Query  222  VSNNVKE  202
            +S  +KE
Sbjct  411  LSKRLKE  417



>ref|XP_003601245.1| Anthranilate phosphoribosyltransferase [Medicago truncatula]
 gb|AES71496.1| anthranilate phosphoribosyltransferase [Medicago truncatula]
 gb|AFK40968.1| unknown [Medicago truncatula]
Length=394

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+++T+FN LG MLNPA+ P+AVVGVY E++V KMAKAL ++G
Sbjct  204  SPKYHPAMKIVRPVRKKLKVRTVFNILGPMLNPAQAPYAVVGVYTEDLVFKMAKALNKFG  263

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDE+SPLGPG VLD+TP  I+KF+FDPL+FGIPRC L+ L+G  P YNA
Sbjct  264  MKRALVVHSEGLDEISPLGPGLVLDVTPGGIDKFSFDPLDFGIPRCNLESLKGGDPRYNA  323

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VLKR+L GE GPIADAF+LNA AAL+VSG V+ LA+G+ LAR T +SGKAL TL  W D
Sbjct  324  EVLKRILGGERGPIADAFVLNAAAALMVSGFVRNLAEGVSLARETQQSGKALKTLNLWKD  383

Query  222  VSNNVKE  202
            +SN +K+
Sbjct  384  ISNKIKD  390



>ref|XP_007036259.1| Tryptophan biosynthesis 1 [Theobroma cacao]
 gb|EOY20760.1| Tryptophan biosynthesis 1 [Theobroma cacao]
Length=424

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV+PVR+KL+IKT+FN LG MLNPARVP+AVVGVYNE++V KMA ALQR+G
Sbjct  226  SPKYHPAMKIVSPVRKKLKIKTVFNILGPMLNPARVPYAVVGVYNEDLVLKMANALQRFG  285

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGI RCTL DL+G  PEYNA
Sbjct  286  MKRALVVHSEGLDEMSPLGPGQVLDVTPEKIEKFSFDPLEFGIYRCTLDDLRGGSPEYNA  345

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVLKR+L+GE G IADA ILNA AALLVSG VK+LA+G+ LAR T  SGKAL+TL  WID
Sbjct  346  DVLKRILAGERGHIADALILNAAAALLVSGCVKSLAEGVSLARETQLSGKALNTLSSWID  405

Query  222  VSNNVK  205
            +SNN++
Sbjct  406  ISNNMQ  411



>ref|XP_009768650.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=409

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SPYYHPAMKIV PVRRKLR+KTIFN LG +LNPA VPFAVVGVY E++VSKMAKALQ YG
Sbjct  208  SPYYHPAMKIVTPVRRKLRVKTIFNILGPLLNPAWVPFAVVGVYKEDIVSKMAKALQSYG  267

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPL+FGIPRCTL DL+G GP +NA
Sbjct  268  MKRALVVHSEGLDEMSPLGPGVVLDVTPEKIEKFSFDPLDFGIPRCTLGDLRGGGPRHNA  327

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGETGP+ADA ILNA AALLVS  V  LA+G+ +AR  H+SGKAL TL  WID
Sbjct  328  EVLRRVLSGETGPMADALILNAAAALLVSRRVGNLAEGVAVARIAHQSGKALDTLNHWID  387

Query  222  VSNNVKE  202
            V + VKE
Sbjct  388  VLSRVKE  394



>gb|KHG01059.1| Anthranilate phosphoribosyltransferase, chloroplastic -like protein 
[Gossypium arboreum]
Length=410

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV+ VR+KL+IKT+FN LG MLNPARVPFAVVGVY+E++V KMAKALQR+G
Sbjct  219  APKYHPAMKIVSGVRKKLKIKTVFNVLGPMLNPARVPFAVVGVYHEDLVFKMAKALQRFG  278

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGI RCTL DL+G G +YNA
Sbjct  279  MKRALVVHSEGLDEMSPLGPGRVLDVTPEKIEKFSFDPLEFGIARCTLDDLRGGGKDYNA  338

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVLKR LSGE+GPIADA ILNA AALLVSGHVK+L++G+ LAR T  SGKAL+TL  WID
Sbjct  339  DVLKRTLSGESGPIADALILNAAAALLVSGHVKSLSEGVALARETQLSGKALNTLNSWID  398

Query  222  VSNNV  208
            +SN V
Sbjct  399  ISNKV  403



>gb|EYU22141.1| hypothetical protein MIMGU_mgv1a007249mg [Erythranthe guttata]
Length=413

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM+IV PVR+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKALQR+G
Sbjct  217  APIYHPAMQIVRPVRKKLKVKTVFNILGPMLNPARVPFAVVGVYTEDLVHKMAKALQRFG  276

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRAL+VHSEGLDEMSPLGPG VLD+TP+KIEKF+FDPLEFGIPRCT+ DL+G  P+YNA
Sbjct  277  MKRALIVHSEGLDEMSPLGPGLVLDVTPDKIEKFSFDPLEFGIPRCTIDDLRGGDPKYNA  336

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IADA +LNA AALLVSG+V +LA+G+ELAR  HRSGKA+ TL  WI 
Sbjct  337  DVLRRVLSGEKGSIADALVLNAAAALLVSGNVNSLAEGVELARVAHRSGKAIKTLDLWIQ  396

Query  222  VSNNVKE  202
             SN VKE
Sbjct  397  TSNKVKE  403



>ref|XP_004252211.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Solanum lycopersicum]
Length=386

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SPYYHPAM+IV PVRRKLR+KTIFN LG +LNPA VPFAVVGVY +++VSKMAKALQ YG
Sbjct  198  SPYYHPAMRIVTPVRRKLRVKTIFNILGPLLNPAWVPFAVVGVYKQDIVSKMAKALQSYG  257

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M RALVVHSEGLDEMSPLGPG VLD+TP+KIEKF+FDPL+FGIPRCTL++L+G GPEYNA
Sbjct  258  MMRALVVHSEGLDEMSPLGPGVVLDVTPQKIEKFSFDPLDFGIPRCTLRNLKGGGPEYNA  317

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE GPIADA ILNA AALLVSG V  LA+G+ +AR TH SGKAL+TL  WI 
Sbjct  318  EVLRRVLSGERGPIADALILNAAAALLVSGRVGNLAEGVAVARMTHESGKALNTLNHWIA  377

Query  222  VSNNV  208
            VS ++
Sbjct  378  VSKDI  382



>emb|CDP02090.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIVAPVR+KL++KT+FN LG +LNPA++PFAVVGVY E++V KMA ALQRYG
Sbjct  218  SPNYHPAMKIVAPVRKKLKVKTVFNTLGPLLNPAQLPFAVVGVYKEDMVKKMANALQRYG  277

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG + D+T EKIEKF+FDPLEFGIPRCT+++L+G  P+YNA
Sbjct  278  LKRALVVHSEGLDEMSPLGPGLMYDVTHEKIEKFSFDPLEFGIPRCTVENLRGGSPQYNA  337

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+RVLSGE GP+ADAF+LNA AALLV GHV     G+ LAR  H SG+AL TL  WI+
Sbjct  338  TVLRRVLSGEAGPVADAFVLNAAAALLVIGHVSNFGDGVALARKKHHSGEALCTLNRWIN  397

Query  222  VS  217
            +S
Sbjct  398  LS  399



>ref|XP_010251181.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Nelumbo nucifera]
Length=413

 Score =   278 bits (712),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIVAPVR+ L +KT+FN LG MLNPARVPFAVVGVYNE++V KMAKALQR+G
Sbjct  214  SPKYHPAMKIVAPVRKNLEVKTVFNILGPMLNPARVPFAVVGVYNEDLVIKMAKALQRFG  273

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M+RALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGI RCT++ L+G GPEYNA
Sbjct  274  MRRALVVHSEGLDEMSPLGPGLVLDVTPEKIEKFSFDPLEFGIRRCTVESLRGGGPEYNA  333

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++L+RVLSGE G IADA +LNA AALLVSG V++LA+G+ LA  T RSG+AL TL+FWI+
Sbjct  334  EILRRVLSGEKGSIADALVLNAAAALLVSGKVRSLAEGVALASETQRSGEALKTLEFWIN  393

Query  222  VSNNVK  205
            +SN  K
Sbjct  394  ISNKAK  399



>ref|XP_009597049.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=459

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKA+QR+G
Sbjct  267  APIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKAVQRFG  326

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRAL+VHSEGLDEMSPLGPG VLD+TP+ IEKF+FDPL+FGIPRCTL+ L+G GP+YNA
Sbjct  327  MKRALIVHSEGLDEMSPLGPGLVLDVTPDNIEKFSFDPLDFGIPRCTLESLRGGGPDYNA  386

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++LKRVLSGE GPIADAF LNA AALLVSGHVK LA G+ LAR T  SGKAL TL  W++
Sbjct  387  EMLKRVLSGEKGPIADAFALNAAAALLVSGHVKNLADGVALARETLVSGKALKTLDLWVE  446

Query  222  VSNNVKE  202
            VSN VKE
Sbjct  447  VSNEVKE  453



>ref|XP_009768649.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=412

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 164/188 (87%), Gaps = 1/188 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SPYYHPAMKIV PVRRKLR+KTIFN LG +LNPA VPFAVVGVY E++VSKMAKALQ YG
Sbjct  208  SPYYHPAMKIVTPVRRKLRVKTIFNILGPLLNPAWVPFAVVGVYKEDIVSKMAKALQSYG  267

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPL+FGIPRCTL DL+G GP +NA
Sbjct  268  MKRALVVHSEGLDEMSPLGPGVVLDVTPEKIEKFSFDPLDFGIPRCTLGDLRGGGPRHNA  327

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGETGP+ADA ILNA AALLVS  V  LA+G+ +AR  H+SGKAL TL  WID
Sbjct  328  EVLRRVLSGETGPMADALILNAAAALLVSRRVGNLAEGVAVARIAHQSGKALDTLNHWID  387

Query  222  VSNNVKEP  199
            V  +++EP
Sbjct  388  VL-SIQEP  394



>ref|XP_009787826.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=400

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV P+R+KL++KT+FN LG MLNPAR PFAVVGVY E++V KMAKA+QR+G
Sbjct  208  APIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARAPFAVVGVYKEDLVHKMAKAVQRFG  267

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TP+ IEKF+FDPL+F IPRCTL+ L+G GP+YNA
Sbjct  268  MKRALVVHSEGLDEMSPLGPGLVLDVTPDNIEKFSFDPLDFAIPRCTLESLRGGGPDYNA  327

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++LKRVLSGE GPIADAF LNA AALLVSGHVK LA+G+ LAR T  SGKAL TL  W++
Sbjct  328  EMLKRVLSGEKGPIADAFALNAAAALLVSGHVKNLAEGVALARKTLVSGKALKTLDLWVE  387

Query  222  VSNNVKE  202
            VSN VKE
Sbjct  388  VSNEVKE  394



>ref|XP_010549687.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Tarenaya hassleriana]
Length=427

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -3

Query  759  PYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGM  580
            P YHPAMKIV PVR+KL+IKT+FN LG MLNPAR  +AVVGV++EN+V KMAKALQR+G 
Sbjct  240  PKYHPAMKIVGPVRKKLKIKTVFNILGPMLNPARASYAVVGVFHENLVLKMAKALQRFGK  299

Query  579  KRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNAD  400
            KR LVVHS+GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GPEYNAD
Sbjct  300  KRCLVVHSDGLDEMSPLGGGLVYDVTPEKIEQFSFDPLDFGIPRCTLEDLRGGGPEYNAD  359

Query  399  VLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
            VL+RVLSG  G IADA ILNA A+L+V   VKTLA+G+ LAR    SG+A+ TL  WI  
Sbjct  360  VLRRVLSGGKGAIADALILNAAASLMVCNRVKTLAEGVALAREVQSSGRAIKTLDSWIQT  419

Query  219  SNNV  208
            SN+V
Sbjct  420  SNSV  423



>gb|AFW89747.1| hypothetical protein ZEAMMB73_227948 [Zea mays]
Length=189

 Score =   268 bits (686),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP AV+GVY+EN+V+KMAKA Q++G
Sbjct  3    SANYHPAMKIVRPVRKKLKIKTVFNILGPLLNPARVPHAVIGVYHENIVTKMAKAAQKFG  62

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TPEKIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  63   MKRALVVHSKGLDEISPLGPGYILDVTPEKIEKMFFDPLDFGIPRCTLEDLKGGDPAFNA  122

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG VK L  G+ LA+ T RSGKA++TL+ WI 
Sbjct  123  KVLQDVLAGQRGAIADALVLNAAASLLVSGKVKNLHDGVALAQETQRSGKAINTLESWIK  182

Query  222  VSNNVKE  202
             SN+ ++
Sbjct  183  KSNSSRD  189



>ref|XP_011071889.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Sesamum indicum]
Length=409

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM+IV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E +V KMA ALQR+G
Sbjct  214  APIYHPAMQIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEELVHKMANALQRFG  273

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRAL+VHSEGLDEMSPLGPG VLD+TP+KIEKF+FDPL+FGIPRCTL DL+G  P+YNA
Sbjct  274  MKRALIVHSEGLDEMSPLGPGLVLDVTPDKIEKFSFDPLDFGIPRCTLDDLRGGNPDYNA  333

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D+L+RVL+GE G IADA +LNA AALLVSG V +LA+G++LAR TH SGKAL TL  WID
Sbjct  334  DILRRVLAGEKGSIADALVLNAAAALLVSGSVNSLAEGVDLARETHVSGKALKTLDLWID  393

Query  222  VSNNVKE  202
             SN VKE
Sbjct  394  TSNKVKE  400



>gb|ACL53714.1| unknown [Zea mays]
Length=189

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP AV+GVY+EN+V+KMAKA Q++G
Sbjct  3    SANYHPAMKIVRPVRKKLKIKTVFNILGPLLNPARVPHAVIGVYHENIVTKMAKAAQKFG  62

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TPEKIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  63   MKRALVVHSKGLDEISPLGPGYILDVTPEKIEKMFFDPLDFGIPRCTLEDLKGGDPAFNA  122

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG VK L  G+ LA+ T RSGKA++TL+ WI 
Sbjct  123  KVLQDVLAGQRGAIADALVLNAAASLLVSGKVKNLHDGVVLAQETQRSGKAINTLESWIK  182

Query  222  VSNNVKE  202
             SN+ ++
Sbjct  183  KSNSSRD  189



>ref|XP_009762501.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=400

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKA+QR+G
Sbjct  208  APVYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKAVQRFG  267

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+T + IEKF+FDPL+FGIPRCTL+ L+G GP+YNA
Sbjct  268  MKRALVVHSEGLDEMSPLGPGLVLDVTLDNIEKFSFDPLDFGIPRCTLESLRGGGPDYNA  327

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D+LKRVLSGE GPIADAF LNA AALLVSG VK LA+G+ LAR T  SGKAL TL  W++
Sbjct  328  DMLKRVLSGEKGPIADAFALNAAAALLVSGLVKNLAEGVALARETLVSGKALKTLDLWVE  387

Query  222  VSNNVKE  202
            VSN VKE
Sbjct  388  VSNEVKE  394



>ref|XP_006650997.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like, 
partial [Oryza brachyantha]
Length=324

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP+AV+GVY+EN+V+KMAKA Q++G
Sbjct  137  SANYHPAMKIVKPVRKKLKIKTVFNILGPLLNPARVPYAVIGVYHENIVTKMAKAAQKFG  196

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  197  MKRALVVHSKGLDEISPLGPGYILDVTPRKIEKMLFDPLDFGIPRCTLEDLKGGDPAFNA  256

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG V +L  G+ LA+ T RSGKA++TL+ WI 
Sbjct  257  KVLQDVLAGQRGSIADALVLNAAASLLVSGKVSSLHDGVALAQETQRSGKAINTLESWIK  316

Query  222  VSNN  211
            VSN+
Sbjct  317  VSND  320



>ref|NP_001130955.1| blue fluorescent1 [Zea mays]
 gb|ACF79358.1| unknown [Zea mays]
 gb|ACG35471.1| hypothetical protein [Zea mays]
 gb|ACN34575.1| unknown [Zea mays]
Length=277

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP AV+GVY+EN+V+KMAKA Q++G
Sbjct  91   SANYHPAMKIVRPVRKKLKIKTVFNILGPLLNPARVPHAVIGVYHENIVTKMAKAAQKFG  150

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TPEKIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  151  MKRALVVHSKGLDEISPLGPGYILDVTPEKIEKMFFDPLDFGIPRCTLEDLKGGDPAFNA  210

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG VK L  G+ LA+ T RSGKA++TL+ WI 
Sbjct  211  KVLQDVLAGQRGAIADALVLNAAASLLVSGKVKNLHDGVALAQETQRSGKAINTLESWIK  270

Query  222  VSNNVKE  202
             SN+ ++
Sbjct  271  KSNSSRD  277



>ref|XP_008812170.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Phoenix dactylifera]
Length=402

 Score =   273 bits (697),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV+ VR++L++KT+FN LG MLNPARVPFAVVGVYNE++V KMAK LQR+G
Sbjct  216  APNYHPAMKIVSLVRKRLKVKTVFNILGPMLNPARVPFAVVGVYNEDIVMKMAKVLQRFG  275

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDE+SPLGPG  LD+TPEKI K  FDPLEFGIPRCT++ L+G   E+NA
Sbjct  276  MKRALVVHSEGLDEISPLGPGYFLDVTPEKIRKLHFDPLEFGIPRCTIESLKGGDAEFNA  335

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VLSG+ G IADAF+LNA AAL VSG V TL +G+ LA+ TH SGKA+ TL+ WI 
Sbjct  336  KVLRDVLSGQKGSIADAFVLNAAAALWVSGRVSTLGEGVALAQETHLSGKAIDTLELWIR  395

Query  222  VSNNVK  205
            +SN ++
Sbjct  396  LSNKLR  401



>gb|AAO72571.1| putative phosphoribosylanthranilate transferase [Oryza sativa 
Japonica Group]
Length=320

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP+AV+GVY+EN+V+KMAKA Q++G
Sbjct  132  SANYHPAMKIVKPVRKKLKIKTVFNILGPLLNPARVPYAVIGVYHENIVTKMAKAAQKFG  191

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  192  MKRALVVHSKGLDEISPLGPGYILDVTPRKIEKMLFDPLDFGIPRCTLEDLKGGDPAFNA  251

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG V TL  G+ LA+ T RSG+A++TL+ WI 
Sbjct  252  KVLQDVLAGQRGSIADALVLNAAASLLVSGKVNTLHDGVALAQETQRSGEAINTLESWIK  311

Query  222  VSN  214
            +SN
Sbjct  312  ISN  314



>ref|XP_009597051.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=455

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKA+QR+G
Sbjct  267  APIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKAVQRFG  326

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRAL+VHSEGLDEMSPLGPG VLD+TP+ IEKF+FDPL+FGIPRCTL+ L+G GP+YNA
Sbjct  327  MKRALIVHSEGLDEMSPLGPGLVLDVTPDNIEKFSFDPLDFGIPRCTLESLRGGGPDYNA  386

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++LKRVLSGE GPIADAF LNA AALLVSGHVK LA G+ LAR T  SGKAL TL  W++
Sbjct  387  EMLKRVLSGEKGPIADAFALNAAAALLVSGHVKNLADGVALARETLVSGKALKTLDLWVE  446

Query  222  VSN  214
            VSN
Sbjct  447  VSN  449



>ref|XP_002318059.2| hypothetical protein POPTR_0012s08440g [Populus trichocarpa]
 gb|EEE96279.2| hypothetical protein POPTR_0012s08440g [Populus trichocarpa]
Length=420

 Score =   271 bits (693),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV+PVR+KL+IKTIFN LG MLNPA VPFAVVGV++E++V KMAKALQR+G
Sbjct  227  SPKYHPAMKIVSPVRKKLKIKTIFNILGPMLNPASVPFAVVGVFHEDLVLKMAKALQRFG  286

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSP+GPG V ++ PEKI KF+FDPL+FGIPRCTL DLQG GP+YNA
Sbjct  287  MKRALVVHSEGLDEMSPIGPGVVFEVNPEKISKFSFDPLDFGIPRCTLFDLQGGGPDYNA  346

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D L+RVLSGE G IADA ILNA AAL VSG   +LA+G+ LAR T  SGKAL+TL  WI+
Sbjct  347  DALRRVLSGEKGAIADAIILNAAAALFVSGRSSSLAEGVVLARETQLSGKALNTLNLWIE  406

Query  222  VSNNVKE  202
            +SN VKE
Sbjct  407  MSNKVKE  413



>gb|ABF93754.1| Anthranilate phosphoribosyltransferase, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=385

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP+AV+GVY+EN+V+KMAKA Q++G
Sbjct  197  SANYHPAMKIVKPVRKKLKIKTVFNILGPLLNPARVPYAVIGVYHENIVTKMAKAAQKFG  256

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  257  MKRALVVHSKGLDEISPLGPGYILDVTPRKIEKMLFDPLDFGIPRCTLEDLKGGDPAFNA  316

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG V TL  G+ LA+ T RSG+A++TL+ WI 
Sbjct  317  KVLQDVLAGQRGSIADALVLNAAASLLVSGKVNTLHDGVALAQETQRSGEAINTLESWIK  376

Query  222  VSN  214
            +SN
Sbjct  377  ISN  379



>ref|XP_003558920.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Brachypodium distachyon]
Length=400

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP+AV+GVY+EN+V+KMA+A QR+G
Sbjct  216  SANYHPAMKIVKPVRKKLKIKTVFNILGPLLNPARVPYAVIGVYHENIVTKMARAAQRFG  275

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M+RAL+VHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL DL+G  P +NA
Sbjct  276  MQRALIVHSKGLDEISPLGPGYILDVTPGKIEKMLFDPLDFGIPRCTLPDLKGGDPAFNA  335

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG VKTL  G+ LA+ T RSGKA++TL+ WI 
Sbjct  336  KVLQDVLAGQRGAIADALVLNAAASLLVSGKVKTLHDGVALAQETQRSGKAINTLESWIK  395

Query  222  VSNN  211
            VSN+
Sbjct  396  VSNS  399



>dbj|BAJ87749.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96150.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92390.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP+AV+GVY+EN+VSKMAKA Q++G
Sbjct  212  SANYHPAMKIVKPVRKKLKIKTVFNILGPLLNPARVPYAVIGVYHENIVSKMAKAAQKFG  271

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            M+RALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL DL+G  P +NA
Sbjct  272  MQRALVVHSKGLDEISPLGPGYILDVTPGKIEKMLFDPLDFGIPRCTLLDLKGGDPAFNA  331

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG VKTL +G+ LA+ T RSG A++TL+ W+ 
Sbjct  332  KVLQDVLAGQRGSIADALVLNAAASLLVSGKVKTLQEGVALAQETQRSGVAINTLELWVK  391

Query  222  VSNN  211
            VSN+
Sbjct  392  VSNS  395



>ref|XP_011001513.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=421

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV+PVR+KL+IKTIFN LG MLNPA VPFAVVGV++E++V KMAKALQR+G
Sbjct  231  SPKYHPAMKIVSPVRKKLKIKTIFNILGPMLNPASVPFAVVGVFHEDLVLKMAKALQRFG  290

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSP+GPG VL++ PEKI KF+FDPL+FGIPRCTL DLQG GP YNA
Sbjct  291  MKRALVVHSEGLDEMSPIGPGVVLEVNPEKISKFSFDPLDFGIPRCTLLDLQGGGPYYNA  350

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D L+RVLSGE G IADA ILNA AAL VSG   +LA+G+ +AR T  SGKAL+TL  WI+
Sbjct  351  DALRRVLSGEKGAIADAIILNAAAALFVSGCSSSLAEGVVMARETQLSGKALNTLNLWIE  410

Query  222  VSNNVKE  202
            +SN VKE
Sbjct  411  MSNKVKE  417



>ref|XP_006287763.1| hypothetical protein CARUB_v10000975mg [Capsella rubella]
 gb|EOA20661.1| hypothetical protein CARUB_v10000975mg [Capsella rubella]
Length=441

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  253  SPMYHPAMKIVGPVRKKLKIKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  312

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPLEFGIPRCTL+DL+G GP+YNA
Sbjct  313  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLEFGIPRCTLEDLRGGGPDYNA  372

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI+
Sbjct  373  DVLRRVLSGECGAIADSLILNAAAALLVSNRVQTLAEGVTLAREVQLSGKAIKTLDSWIN  432

Query  222  VSNNVKE  202
            +SN  K+
Sbjct  433  ISNLAKK  439



>ref|XP_009762500.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=401

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 163/188 (87%), Gaps = 1/188 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKA+QR+G
Sbjct  208  APVYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKAVQRFG  267

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPL-EFGIPRCTLKDLQGAGPEYN  406
            MKRALVVHSEGLDEMSPLGPG VLD+T + IEKF+FDPL +FGIPRCTL+ L+G GP+YN
Sbjct  268  MKRALVVHSEGLDEMSPLGPGLVLDVTLDNIEKFSFDPLVDFGIPRCTLESLRGGGPDYN  327

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            AD+LKRVLSGE GPIADAF LNA AALLVSG VK LA+G+ LAR T  SGKAL TL  W+
Sbjct  328  ADMLKRVLSGEKGPIADAFALNAAAALLVSGLVKNLAEGVALARETLVSGKALKTLDLWV  387

Query  225  DVSNNVKE  202
            +VSN VKE
Sbjct  388  EVSNEVKE  395



>ref|NP_001048822.1| Os03g0126000 [Oryza sativa Japonica Group]
 gb|ABF93753.1| Anthranilate phosphoribosyltransferase, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10736.1| Os03g0126000 [Oryza sativa Japonica Group]
 dbj|BAH00606.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP+AV+GVY+EN+V+KMAKA Q++G
Sbjct  211  SANYHPAMKIVKPVRKKLKIKTVFNILGPLLNPARVPYAVIGVYHENIVTKMAKAAQKFG  270

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  271  MKRALVVHSKGLDEISPLGPGYILDVTPRKIEKMLFDPLDFGIPRCTLEDLKGGDPAFNA  330

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG V TL  G+ LA+ T RSG+A++TL+ WI 
Sbjct  331  KVLQDVLAGQRGSIADALVLNAAASLLVSGKVNTLHDGVALAQETQRSGEAINTLESWIK  390

Query  222  VSNN  211
            +SN+
Sbjct  391  ISNS  394



>ref|XP_002511378.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis]
 gb|EEF51980.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis]
Length=425

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV+ VR+KL++KT+FN LG MLNPARVPF VVGVY E++V KMAKALQR+G
Sbjct  235  SPKYHPAMKIVSAVRKKLKVKTVFNILGPMLNPARVPFGVVGVYKEDLVYKMAKALQRFG  294

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLDITPEKIEKF+FDPLEFGIPRCTL+ L+G GP+YNA
Sbjct  295  MKRALVVHSEGLDEMSPLGPGIVLDITPEKIEKFSFDPLEFGIPRCTLESLRGGGPDYNA  354

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +LKRVLSGE G IADA ILNA AALLVSG   TLA+G+ +AR T  SGKA+ T+  WI+
Sbjct  355  QILKRVLSGEKGSIADALILNAAAALLVSGCASTLAEGVGMARETQLSGKAMKTIDSWIN  414

Query  222  VSNNVK  205
            +SN +K
Sbjct  415  ISNKMK  420



>ref|XP_008658036.1| PREDICTED: blue fluorescent1 isoform X1 [Zea mays]
 gb|AFW89745.1| blue fluorescent1 [Zea mays]
Length=393

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP AV+GVY+EN+V+KMAKA Q++G
Sbjct  207  SANYHPAMKIVRPVRKKLKIKTVFNILGPLLNPARVPHAVIGVYHENIVTKMAKAAQKFG  266

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TPEKIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  267  MKRALVVHSKGLDEISPLGPGYILDVTPEKIEKMFFDPLDFGIPRCTLEDLKGGDPAFNA  326

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG VK L  G+ LA+ T RSGKA++TL+ WI 
Sbjct  327  KVLQDVLAGQRGAIADALVLNAAASLLVSGKVKNLHDGVALAQETQRSGKAINTLESWIK  386

Query  222  VSNNVKE  202
             SN+ ++
Sbjct  387  KSNSSRD  393



>gb|AAM19104.1|AC104427_2 Putative phosphoribosylanthranilate transferase [Oryza sativa 
Japonica Group]
 gb|EAZ25430.1| hypothetical protein OsJ_09246 [Oryza sativa Japonica Group]
Length=409

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP+AV+GVY+EN+V+KMAKA Q++G
Sbjct  211  SANYHPAMKIVKPVRKKLKIKTVFNILGPLLNPARVPYAVIGVYHENIVTKMAKAAQKFG  270

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  271  MKRALVVHSKGLDEISPLGPGYILDVTPRKIEKMLFDPLDFGIPRCTLEDLKGGDPAFNA  330

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G IADA +LNA A+LLVSG V TL  G+ LA+ T RSG+A++TL+ WI 
Sbjct  331  KVLQDVLAGQRGSIADALVLNAAASLLVSGKVNTLHDGVALAQETQRSGEAINTLESWIK  390

Query  222  VSN  214
            +SN
Sbjct  391  ISN  393



>gb|EAY88350.1| hypothetical protein OsI_09808 [Oryza sativa Indica Group]
Length=411

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP+AV+GVY+EN+V+KMAKA Q++G
Sbjct  211  SANYHPAMKIVKPVRKKLKIKTVFNILGPLLNPARVPYAVIGVYHENIVTKMAKAAQKFG  270

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  271  MKRALVVHSKGLDEISPLGPGYILDVTPRKIEKMLFDPLDFGIPRCTLEDLKGGDPAFNA  330

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+GE G IADA +LNA A+LLVSG V +L  G+ LA+ T RSG+A++TL+ WI 
Sbjct  331  KVLQDVLAGERGSIADALVLNAAASLLVSGKVNSLHDGVALAQETQRSGEAINTLESWIK  390

Query  222  VSN  214
            +SN
Sbjct  391  ISN  393



>ref|XP_010940166.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=398

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMK+V PVR++L++KT+FN LG MLNPARVPFAVVGVY+E++V KMAKALQ++G
Sbjct  212  APNYHPAMKVVRPVRKRLKVKTVFNILGPMLNPARVPFAVVGVYHEDIVMKMAKALQQFG  271

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDE+SPLGPG  LD+TPEKI K  FDPLEFGI RCT++ L+G   E+NA
Sbjct  272  MKRALVVHSVGLDEISPLGPGYFLDVTPEKIRKLHFDPLEFGIHRCTIESLKGGDAEFNA  331

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VLSG+ G IADAF+LNA AALLVSG V TL +G+ LA+ TH SGKA+ TL+ WI 
Sbjct  332  KVLRDVLSGQKGSIADAFVLNAAAALLVSGRVSTLGEGVALAQETHLSGKAIDTLELWIR  391

Query  222  VSNNVK  205
            +SN ++
Sbjct  392  LSNKLR  397



>ref|XP_010421683.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=418

 Score =   268 bits (686),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  231  SPMYHPAMKIVGPVRKKLKIKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  290

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  291  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  350

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI 
Sbjct  351  DVLRRVLSGERGAIADSLILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIH  410

Query  222  VSN  214
            +SN
Sbjct  411  ISN  413



>ref|XP_010940167.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=398

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMK+V PVR++L++KT+FN LG MLNPARVPFAVVGVY+E++V KMAKALQ++G
Sbjct  212  APNYHPAMKVVRPVRKRLKVKTVFNILGPMLNPARVPFAVVGVYHEDIVMKMAKALQQFG  271

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDE+SPLGPG  LD+TPEKI K  FDPLEFGI RCT++ L+G   E+NA
Sbjct  272  MKRALVVHSVGLDEISPLGPGYFLDVTPEKIRKLHFDPLEFGIHRCTIESLKGGDAEFNA  331

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VLSG+ G IADAF+LNA AALLVSG V TL +G+ LA+ TH SGKA+ TL+ WI 
Sbjct  332  KVLRDVLSGQKGSIADAFVLNAAAALLVSGRVNTLGEGVALAQETHLSGKAIDTLELWIR  391

Query  222  VSNNVK  205
            +SN ++
Sbjct  392  LSNKLR  397



>ref|XP_010454020.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Camelina sativa]
Length=441

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+ KT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  253  SPMYHPAMKIVGPVRKKLKTKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  312

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  313  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  372

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI+
Sbjct  373  DVLRRVLSGERGAIADSLILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIN  432

Query  222  VSN  214
            +SN
Sbjct  433  ISN  435



>ref|XP_010454019.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Camelina sativa]
Length=442

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+ KT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  254  SPMYHPAMKIVGPVRKKLKTKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  313

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  314  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  373

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI+
Sbjct  374  DVLRRVLSGERGAIADSLILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIN  433

Query  222  VSN  214
            +SN
Sbjct  434  ISN  436



>ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana]
 sp|Q02166.1|TRPD_ARATH RecName: Full=Anthranilate phosphoribosyltransferase, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA32835.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana]
 dbj|BAB08398.1| anthranilate phosphoribosyltransferase, chloroplast precursor 
[Arabidopsis thaliana]
 gb|AAK96697.1| anthranilate phosphoribosyltransferase, chloroplast precursor 
[Arabidopsis thaliana]
 gb|AAM13297.1| anthranilate phosphoribosyltransferase, chloroplast precursor 
[Arabidopsis thaliana]
 gb|AED92493.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana]
 prf||1909347A phosphoribosylanthranilate transferase
Length=444

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPARV +AVVGVY++++V KMAKALQR+G
Sbjct  256  SPMYHPAMKIVGPVRKKLKIKTVFNILGPMLNPARVSYAVVGVYHKDLVVKMAKALQRFG  315

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  316  MKRALVVHSCGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  375

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE+G IAD+ ILNA AALLVS  V+TLA+G+ +AR    SGKA+ TL  WI+
Sbjct  376  DVLRRVLSGESGAIADSLILNAAAALLVSNRVQTLAEGVTVAREVQSSGKAIKTLDSWIN  435

Query  222  VSN  214
            +SN
Sbjct  436  ISN  438



>ref|XP_010421681.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010421682.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=433

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  246  SPMYHPAMKIVGPVRKKLKIKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  305

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  306  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  365

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI 
Sbjct  366  DVLRRVLSGERGAIADSLILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIH  425

Query  222  VSN  214
            +SN
Sbjct  426  ISN  428



>ref|XP_010492792.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=442

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+ KT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  254  SPMYHPAMKIVGPVRKKLKTKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  313

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  314  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  373

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI+
Sbjct  374  DVLRRVLSGERGAIADSLILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIN  433

Query  222  VSN  214
            +SN
Sbjct  434  ISN  436



>ref|XP_010492791.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=443

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+ KT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  255  SPMYHPAMKIVGPVRKKLKTKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  314

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  315  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  374

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI+
Sbjct  375  DVLRRVLSGERGAIADSLILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIN  434

Query  222  VSN  214
            +SN
Sbjct  435  ISN  437



>gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana]
 gb|AAO42464.1| phosphorybosyl anthranilate transferase 1 [Arabidopsis thaliana]
Length=441

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPARV +AVVGVY++++V KMAKALQR+G
Sbjct  253  SPMYHPAMKIVGPVRKKLKIKTVFNILGPMLNPARVSYAVVGVYHKDLVVKMAKALQRFG  312

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  313  MKRALVVHSCGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  372

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE+G IAD+ ILNA AALLVS  V+TLA+G+ +AR    SGKA+ TL  WI+
Sbjct  373  DVLRRVLSGESGAIADSLILNAAAALLVSNRVQTLAEGVTVAREVQSSGKAIKTLDSWIN  432

Query  222  VSN  214
            +SN
Sbjct  433  ISN  435



>ref|XP_002871793.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48052.1| hypothetical protein ARALYDRAFT_909800 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  256  SPMYHPAMKIVGPVRKKLKIKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  315

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G  P+YNA
Sbjct  316  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGDPDYNA  375

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE+G IAD+ ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI+
Sbjct  376  DVLRRVLSGESGAIADSLILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIN  435

Query  222  VSN  214
            +SN
Sbjct  436  ISN  438



>ref|XP_008438562.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Cucumis melo]
Length=412

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMK+V+PVR+KL++KT FN LG MLNPARVPFAVVGVY+EN+VSKMA ALQ +G
Sbjct  228  APKYHPAMKVVSPVRKKLKVKTAFNVLGPMLNPARVPFAVVGVYSENLVSKMANALQLFG  287

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+ P KIEKF+FDPL+FGIPRCT+ DL+G  P+YNA
Sbjct  288  MKRALVVHSEGLDEMSPLGPGHILDVKPGKIEKFSFDPLDFGIPRCTIDDLRGGDPDYNA  347

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VLKRVLSGE G IA+A ILNA A+LLVS  V TLA+GIE+AR T +SGKA+ TL  WI 
Sbjct  348  EVLKRVLSGEKGHIANALILNAAASLLVSCKVNTLAEGIEVARETQQSGKAMKTLDLWIK  407

Query  222  VSNNV  208
            +SN +
Sbjct  408  LSNKL  412



>ref|XP_011001516.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=418

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 160/189 (85%), Gaps = 2/189 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV+PVR+KL+IKTIFN LG MLNPA VPFAVVGV++E++V KMAKALQR+G
Sbjct  226  SPKYHPAMKIVSPVRKKLKIKTIFNILGPMLNPASVPFAVVGVFHEDLVLKMAKALQRFG  285

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSP+GPG VL++ PEKI KF+FDPL+FGIPRCTL DLQG GP YNA
Sbjct  286  MKRALVVHSEGLDEMSPIGPGVVLEVNPEKISKFSFDPLDFGIPRCTLLDLQGGGPYYNA  345

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D L+RVLSGE G IADA ILNA AAL VSG   +LA+G+ +AR T  SGKAL+TL  WI+
Sbjct  346  DALRRVLSGEKGAIADAIILNAAAALFVSGCSSSLAEGVVMARETQLSGKALNTLNLWIE  405

Query  222  VSN--NVKE  202
            +SN   VKE
Sbjct  406  MSNLQKVKE  414



>ref|XP_009121033.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Brassica rapa]
Length=429

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPA V +AVVGVY++N+V KMAKALQR+G
Sbjct  241  SPMYHPAMKIVGPVRKKLKIKTVFNVLGPMLNPASVSYAVVGVYHKNLVLKMAKALQRFG  300

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  301  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  360

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGETG IAD+ ILNA AALLVS  VKTL +G+ LAR    SGKA+ TL  WI 
Sbjct  361  DVLRRVLSGETGSIADSLILNAAAALLVSNRVKTLGEGVALAREVQSSGKAIKTLDSWIH  420

Query  222  VSN  214
             SN
Sbjct  421  SSN  423



>emb|CDY38473.1| BnaA10g16850D [Brassica napus]
Length=429

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPA V +AVVGVY++N+V KMAKALQR+G
Sbjct  241  SPMYHPAMKIVGPVRKKLKIKTVFNVLGPMLNPASVSYAVVGVYHKNLVLKMAKALQRFG  300

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCT++DL+G GP+YNA
Sbjct  301  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTIEDLRGGGPDYNA  360

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGETG IAD+ ILNA AALLVS  VKTL +G++LAR    SGKA+ TL  WI 
Sbjct  361  DVLRRVLSGETGAIADSLILNAAAALLVSNRVKTLGEGVDLAREVQSSGKAIKTLDSWIH  420

Query  222  VSN  214
             SN
Sbjct  421  SSN  423



>ref|XP_011001514.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=423

 Score =   266 bits (679),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 160/189 (85%), Gaps = 2/189 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV+PVR+KL+IKTIFN LG MLNPA VPFAVVGV++E++V KMAKALQR+G
Sbjct  231  SPKYHPAMKIVSPVRKKLKIKTIFNILGPMLNPASVPFAVVGVFHEDLVLKMAKALQRFG  290

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSP+GPG VL++ PEKI KF+FDPL+FGIPRCTL DLQG GP YNA
Sbjct  291  MKRALVVHSEGLDEMSPIGPGVVLEVNPEKISKFSFDPLDFGIPRCTLLDLQGGGPYYNA  350

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            D L+RVLSGE G IADA ILNA AAL VSG   +LA+G+ +AR T  SGKAL+TL  WI+
Sbjct  351  DALRRVLSGEKGAIADAIILNAAAALFVSGCSSSLAEGVVMARETQLSGKALNTLNLWIE  410

Query  222  VSN--NVKE  202
            +SN   VKE
Sbjct  411  MSNLQKVKE  419



>ref|XP_007138060.1| hypothetical protein PHAVU_009G177200g [Phaseolus vulgaris]
 gb|ESW10054.1| hypothetical protein PHAVU_009G177200g [Phaseolus vulgaris]
Length=401

 Score =   265 bits (677),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHP+MKIV P+R+KL+IKT+FN LG MLNPA  PFAVVGVY E++VSKMAKAL R+G
Sbjct  209  SPKYHPSMKIVRPIRKKLKIKTVFNILGPMLNPAHAPFAVVGVYTEDLVSKMAKALNRFG  268

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+T ++++KF+FDPL+F IPRCT++DL+G GPEYNA
Sbjct  269  MKRALVVHSEGLDEMSPLGPGLVLDVTADRVDKFSFDPLDFDIPRCTIEDLKGGGPEYNA  328

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VLKRVL GE G IADA ILNA AALLVSGHV+ LA+G+ LAR T +SGKAL TL  + D
Sbjct  329  EVLKRVLGGEKGAIADALILNAAAALLVSGHVRNLAEGVALARETQQSGKALKTLNLFKD  388

Query  222  VSNNVKE  202
            VSN  K+
Sbjct  389  VSNKFKD  395



>ref|XP_004985893.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Setaria italica]
Length=394

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+ L+IKT+FN LG +LNPARVP AV+GVY+EN+V+KMAKA Q++G
Sbjct  209  SANYHPAMKIVRPVRKNLKIKTVFNILGPLLNPARVPHAVIGVYHENIVTKMAKAAQKFG  268

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  269  MKRALVVHSKGLDEISPLGPGYILDVTPGKIEKMLFDPLDFGIPRCTLEDLKGGDPAFNA  328

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL+G+ G +ADA +LNA A+LLV G VK L  G+ LA+ T RSGKA++TL+ WI 
Sbjct  329  KVLQDVLAGQKGSVADALVLNAAASLLVCGKVKNLHDGVALAQETQRSGKAINTLESWIK  388

Query  222  VSNNVK  205
            +SN+ K
Sbjct  389  ISNSSK  394



>emb|CDY25471.1| BnaC09g39860D [Brassica napus]
Length=433

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  245  SPMYHPAMKIVGPVRKKLKIKTVFNVLGPMLNPARVSYAVVGVYHKNLVLKMAKALQRFG  304

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCT++DL+G GP+YNA
Sbjct  305  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTIEDLRGGGPDYNA  364

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGETG IAD+ ILNA AALLVS  VKTL +G+ LAR    SGKA+ TL  WI 
Sbjct  365  DVLRRVLSGETGAIADSLILNAAAALLVSNRVKTLGEGVALAREVQSSGKAIKTLDSWIH  424

Query  222  VS  217
             S
Sbjct  425  SS  426



>ref|XP_006400342.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum]
 gb|ESQ41795.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum]
Length=448

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPA V +AVVGVY++N+V KMAKALQR+G
Sbjct  260  SPMYHPAMKIVGPVRKKLKIKTVFNILGPMLNPASVSYAVVGVYHKNLVLKMAKALQRFG  319

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TP KIE+F+FDPL+FGIPRCT++DL+G GPEYNA
Sbjct  320  MKRALVVHSYGLDEMSPLGGGLVYDVTPAKIEEFSFDPLDFGIPRCTIEDLRGGGPEYNA  379

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE+G IAD+ ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI 
Sbjct  380  DVLRRVLSGESGSIADSLILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIH  439

Query  222  VSNN  211
            +SN+
Sbjct  440  ISNS  443



>gb|AFK40049.1| unknown [Lotus japonicus]
Length=402

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV PVR+KL+I+T+FN LG MLNPA  PFAVVGVY E++V KMAKAL R+G
Sbjct  209  APKYHPAMKIVRPVRKKLKIRTVFNILGPMLNPAGAPFAVVGVYTEDLVIKMAKALHRFG  268

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDE+SPLGPG VLD+TPEKI++F+FDPL+FGIPRC L+ L+G  PEYNA
Sbjct  269  MKRALVVHSEGLDEISPLGPGLVLDVTPEKIDRFSFDPLDFGIPRCNLESLKGGDPEYNA  328

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +LKRVL GE GPIADA +LNA AALLVSG V  LA+G+ +AR T +SGKAL TL  W D
Sbjct  329  AILKRVLGGEIGPIADALVLNAAAALLVSGCVSNLAEGVSMARETQQSGKALKTLNLWKD  388

Query  222  VSNNVKE  202
            +SNN+K+
Sbjct  389  ISNNIKD  395



>ref|XP_002465954.1| hypothetical protein SORBIDRAFT_01g048790 [Sorghum bicolor]
 gb|EER92952.1| hypothetical protein SORBIDRAFT_01g048790 [Sorghum bicolor]
Length=399

 Score =   262 bits (670),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 157/196 (80%), Gaps = 9/196 (5%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP AV+GVY+EN+V+KMAKA Q++G
Sbjct  204  SANYHPAMKIVRPVRKKLKIKTVFNILGPLLNPARVPHAVIGVYHENIVTKMAKAAQKFG  263

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FGIPRCTL+DL+G  P +NA
Sbjct  264  MKRALVVHSKGLDEISPLGPGYILDVTPGKIEKMLFDPLDFGIPRCTLEDLKGGDPAFNA  323

Query  402  DVLKRVLSGETGPIADAF---------ILNAGAALLVSGHVKTLAKGIELARCTHRSGKA  250
             VL+ VL+G+ G IADA          ILNA A+LLVSG VK L  G+ LA+ T RSGKA
Sbjct  324  KVLQDVLAGQRGSIADALLRLIPILLHILNAAASLLVSGKVKNLHDGVALAQETQRSGKA  383

Query  249  LHTLKFWIDVSNNVKE  202
            ++TL+ WI VSN+ ++
Sbjct  384  INTLESWIKVSNSSRD  399



>ref|XP_010420535.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=441

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+ KT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  253  SPMYHPAMKIVGPVRKKLKTKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  312

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  313  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  372

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IADA ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI+
Sbjct  373  DVLRRVLSGERGAIADALILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIN  432

Query  222  VSN  214
            +SN
Sbjct  433  ISN  435



>ref|XP_010420534.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=442

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+ KT+FN LG MLNPARV +AVVGVY++N+V KMAKALQR+G
Sbjct  254  SPMYHPAMKIVGPVRKKLKTKTVFNILGPMLNPARVSYAVVGVYHKNLVVKMAKALQRFG  313

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  314  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  373

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IADA ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI+
Sbjct  374  DVLRRVLSGERGAIADALILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIN  433

Query  222  VSN  214
            +SN
Sbjct  434  ISN  436



>gb|KDO69598.1| hypothetical protein CISIN_1g023127mg [Citrus sinensis]
 gb|KDO69599.1| hypothetical protein CISIN_1g023127mg [Citrus sinensis]
Length=193

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  3    STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  62

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  63   LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  122

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADA ILNA AALLVS  V TLA+G+ LAR    SGKAL+TL  WI+
Sbjct  123  EVLRRVLSGERGAIADALILNAAAALLVSCKVNTLAEGVALAREIQLSGKALNTLDLWIE  182

Query  222  VS  217
            VS
Sbjct  183  VS  184



>ref|XP_004501915.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=441

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAM IV PVRRKL+++TIFN LG MLNPA+VPFAVVGVY E++V KMAK L R+G
Sbjct  243  SPMYHPAMNIVRPVRRKLKVRTIFNTLGPMLNPAQVPFAVVGVYTEDLVFKMAKTLHRFG  302

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDE+SPLGPG VLD+TPEKI+KF+FDPL+FGIPRC L+ L+G  PEYNA
Sbjct  303  IKRALVVHSEGLDEISPLGPGLVLDVTPEKIDKFSFDPLDFGIPRCNLESLRGGDPEYNA  362

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VLKRVL GE G IADA +LNA AAL+VSG V+ LA+G+ LAR T +SGKA+ TL  W D
Sbjct  363  EVLKRVLGGEKGHIADALVLNAAAALMVSGFVRNLAEGVSLARETQQSGKAIQTLNHWKD  422

Query  222  VSNNVKE  202
            +SN +K+
Sbjct  423  ISNKIKD  429



>gb|ADZ24712.1| anthranilate phosphoribosyltransferase [Solanum pennellii]
Length=365

 Score =   259 bits (662),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKALQR+G
Sbjct  210  SPIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKALQRFG  269

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TP+ I+KF+FDPL+FGIPRCTL+ L+G GPEYNA
Sbjct  270  MKRALVVHSEGLDEMSPLGPGLVLDVTPDNIKKFSFDPLDFGIPRCTLESLRGGGPEYNA  329

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLA  295
            ++L+RVLSGE G IADAF LNA AALLVSG V  LA
Sbjct  330  EMLRRVLSGEKGSIADAFALNASAALLVSGRVDNLA  365



>ref|XP_009126226.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Brassica rapa]
Length=432

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPA KIV+PVR+KL+IKT+FN LG MLNPARV +AVVGVY++N+V KMAKALQ +G
Sbjct  244  APMYHPATKIVSPVRKKLKIKTVFNVLGPMLNPARVSYAVVGVYHKNLVMKMAKALQLFG  303

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  304  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  363

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TL +G+ LAR  H SGKA+ TL  WI 
Sbjct  364  DVLRRVLSGEKGSIADSLILNAAAALLVSNRVQTLGEGVTLAREVHSSGKAIKTLDSWIH  423

Query  222  VSN  214
             SN
Sbjct  424  SSN  426



>gb|KDO69600.1| hypothetical protein CISIN_1g023127mg [Citrus sinensis]
Length=279

 Score =   256 bits (654),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  91   STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  150

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  151  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  210

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADA ILNA AALLVS  V TLA+G+ LAR    SGKAL+TL  WI+
Sbjct  211  EVLRRVLSGERGAIADALILNAAAALLVSCKVNTLAEGVALAREIQLSGKALNTLDLWIE  270

Query  222  VS  217
            VS
Sbjct  271  VS  272



>emb|CDY02664.1| BnaC02g07710D [Brassica napus]
Length=432

 Score =   261 bits (666),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPA KIV+PVR+KL+IKT+FN LG MLNPARV +AVVGVY++N+V KMAKALQ +G
Sbjct  244  APMYHPATKIVSPVRKKLKIKTVFNVLGPMLNPARVSYAVVGVYHKNLVMKMAKALQLFG  303

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  304  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  363

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TL +G+ LAR  H SGKA+ TL  WI 
Sbjct  364  DVLRRVLSGEKGSIADSLILNAAAALLVSNRVQTLGEGVTLAREVHSSGKAIKTLDSWIH  423

Query  222  VSN  214
             SN
Sbjct  424  SSN  426



>emb|CDX85428.1| BnaA02g03850D [Brassica napus]
Length=436

 Score =   261 bits (666),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPA KIV+PVR+KL+IKT+FN LG MLNPARV +AVVGVY++N+V KMAKALQ +G
Sbjct  248  APMYHPATKIVSPVRKKLKIKTVFNVLGPMLNPARVSYAVVGVYHKNLVLKMAKALQLFG  307

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPEKIE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  308  MKRALVVHSYGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  367

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE G IAD+ ILNA AALLVS  V+TL +G+ LAR  H SGKA+ TL  WI 
Sbjct  368  DVLRRVLSGEKGSIADSLILNAAAALLVSNRVQTLGEGVTLAREVHSSGKAIKTLDSWIH  427

Query  222  VSN  214
             SN
Sbjct  428  SSN  430



>gb|KDO69595.1| hypothetical protein CISIN_1g023127mg [Citrus sinensis]
Length=279

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  91   STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  150

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  151  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  210

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADA ILNA AALLVS  V TLA+G+ LAR    SGKAL+TL  WI+
Sbjct  211  EVLRRVLSGERGAIADALILNAAAALLVSCKVNTLAEGVALAREIQLSGKALNTLDLWIE  270

Query  222  VSNNV  208
            VS ++
Sbjct  271  VSKHL  275



>ref|XP_004298957.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X1 [Fragaria vesca subsp. vesca]
Length=404

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH AM+IV PVR+KL++KT+FN LG MLNPA+VPFAVVGVY E++V KMA+ALQ +G
Sbjct  213  APKYHSAMRIVRPVRKKLKVKTVFNILGPMLNPAKVPFAVVGVYTEDLVLKMAEALQSFG  272

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+TP KIEKF+FDPL+FGIPRCT+ DL+G GPEYNA
Sbjct  273  MKRALVVHSEGLDEMSPLGPGLILDVTPNKIEKFSFDPLDFGIPRCTVDDLRGGGPEYNA  332

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            + LKRVLSGE G +ADA ILNA AALLVSG V  LA+G+ LAR T RSGKA+ TL  W+ 
Sbjct  333  EALKRVLSGEKGSVADALILNAAAALLVSGRVTNLAEGVLLARDTQRSGKAIKTLDHWVS  392

Query  222  VSNNVK  205
            ++  ++
Sbjct  393  ITKTMR  398



>gb|KDO69597.1| hypothetical protein CISIN_1g023127mg [Citrus sinensis]
Length=281

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  91   STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  150

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  151  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  210

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADA ILNA AALLVS  V TLA+G+ LAR    SGKAL+TL  WI+
Sbjct  211  EVLRRVLSGERGAIADALILNAAAALLVSCKVNTLAEGVALAREIQLSGKALNTLDLWIE  270

Query  222  VS  217
            VS
Sbjct  271  VS  272



>ref|XP_004152482.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN64320.1| hypothetical protein Csa_1G046170 [Cucumis sativus]
Length=412

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV+PVR+KL++KT FN LG MLNPARVPFAVVGVY+EN+VSKMA ALQ +G
Sbjct  228  APKYHPAMKIVSPVRKKLKVKTAFNILGPMLNPARVPFAVVGVYSENLVSKMANALQLFG  287

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+ P K+EKF+FDPL+FGIPRCT+ DL+G   + NA
Sbjct  288  MKRALVVHSEGLDEMSPLGPGHILDVKPGKVEKFSFDPLDFGIPRCTIDDLRGGDSDCNA  347

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VLKRVLSGE G IA+A ILNA A+LLVS  V TL++GIELAR T +SGKA+ TL  WI 
Sbjct  348  KVLKRVLSGEKGHIANALILNAAASLLVSCKVNTLSEGIELARETQQSGKAMKTLDLWIK  407

Query  222  VSNNV  208
            +SN +
Sbjct  408  LSNKL  412



>gb|EMS54550.1| Anthranilate phosphoribosyltransferase, chloroplastic [Triticum 
urartu]
Length=350

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 157/204 (77%), Gaps = 18/204 (9%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENV------------  619
            S  YHPAMKIV PVR+KL+IKT+FN LG +LNPARVP+AV+GVY+EN+            
Sbjct  109  SANYHPAMKIVRPVRKKLKIKTVFNILGPLLNPARVPYAVIGVYHENILIPLLTKITDTP  168

Query  618  ------VSKMAKALQRYGMKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFG  457
                  V+KMAKA Q++GM+RALVVHS+GLDE+SPLGPG +LD+TP KIEK  FDPL+FG
Sbjct  169  TLNKQIVTKMAKAAQKFGMQRALVVHSKGLDEISPLGPGYILDVTPGKIEKMLFDPLDFG  228

Query  456  IPRCTLKDLQGAGPEYNADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELA  277
            IPRCTL DL+G  P +NA VL+ VL+G+ G IADA +LNA A+LLVSG VKTL +G+ LA
Sbjct  229  IPRCTLLDLKGGDPAFNAKVLQDVLAGQRGSIADALVLNAAASLLVSGKVKTLHEGVALA  288

Query  276  RCTHRSGKALHTLKFWIDVSNNVK  205
            + T RSG A++TL+ WI VSN+ K
Sbjct  289  QETQRSGVAINTLESWIKVSNHQK  312



>gb|KDO69596.1| hypothetical protein CISIN_1g023127mg [Citrus sinensis]
Length=287

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  91   STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  150

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  151  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  210

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADA ILNA AALLVS  V TLA+G+ LAR    SGKAL+TL  WI+
Sbjct  211  EVLRRVLSGERGAIADALILNAAAALLVSCKVNTLAEGVALAREIQLSGKALNTLDLWIE  270

Query  222  VS  217
            VS
Sbjct  271  VS  272



>ref|XP_003523084.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Glycine max]
 gb|KHN30924.1| Anthranilate phosphoribosyltransferase, chloroplastic [Glycine 
soja]
Length=399

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHP+MKIV PVR+KL+IKTIFN LG MLNPA  PFAVVGVY E++V KMAKAL R+G
Sbjct  207  STKYHPSMKIVRPVRKKLKIKTIFNILGPMLNPAHAPFAVVGVYTEDLVLKMAKALNRFG  266

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+  ++++KFAFDPLEFGIPRC ++ L+G GPEYNA
Sbjct  267  MKRALVVHSEGLDEMSPLGPGIVLDVMADRVDKFAFDPLEFGIPRCNIESLKGGGPEYNA  326

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VLKRVL GE GPIADA ILNA AALLVSG V  LA+G+ +AR T +SGKAL TL    D
Sbjct  327  EVLKRVLGGERGPIADALILNAAAALLVSGCVSNLAEGVSVARETQQSGKALKTLNLLKD  386

Query  222  VSNNVKE  202
            VSNN+K+
Sbjct  387  VSNNIKD  393



>ref|XP_004501916.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=428

 Score =   259 bits (661),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 155/183 (85%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAM IV PVRRKL+++TIFN LG MLNPA+VPFAVVGVY E++V KMAK L R+G
Sbjct  243  SPMYHPAMNIVRPVRRKLKVRTIFNTLGPMLNPAQVPFAVVGVYTEDLVFKMAKTLHRFG  302

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDE+SPLGPG VLD+TPEKI+KF+FDPL+FGIPRC L+ L+G  PEYNA
Sbjct  303  IKRALVVHSEGLDEISPLGPGLVLDVTPEKIDKFSFDPLDFGIPRCNLESLRGGDPEYNA  362

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VLKRVL GE G IADA +LNA AAL+VSG V+ LA+G+ LAR T +SGKA+ TL  W D
Sbjct  363  EVLKRVLGGEKGHIADALVLNAAAALMVSGFVRNLAEGVSLARETQQSGKAIQTLNHWKD  422

Query  222  VSN  214
            +SN
Sbjct  423  ISN  425



>ref|XP_011028718.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like, 
partial [Populus euphratica]
Length=319

 Score =   254 bits (650),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YH AMKIV PVR+KL+IKTIFN LG MLNPA VPFAV GV++E++V KMAKALQ +G
Sbjct  77   SPKYHLAMKIVGPVRKKLKIKTIFNTLGPMLNPACVPFAVGGVFHEDLVLKMAKALQSFG  136

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALV H EGLDEMSP GPG V +  PEKI KF+FDPL+FGIP CTL DL+G GP+YNA
Sbjct  137  MKRALVAHLEGLDEMSPPGPGVVYEANPEKISKFSFDPLDFGIPHCTLHDLRGGGPDYNA  196

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            + L+RVLSGE G IADA ILNA AAL  SG   +LA+G+ +AR T  SGKAL TL  WI+
Sbjct  197  ESLRRVLSGEKGVIADATILNAAAALFFSGRTNSLAEGVVVARETQLSGKALVTLNLWIE  256

Query  222  VSN  214
             SN
Sbjct  257  TSN  259



>ref|XP_010660887.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Vitis vinifera]
Length=406

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 144/187 (77%), Gaps = 17/187 (9%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YH AMKI APVR+KL +KT+FN LG MLNPARVPFAVVGVY +++V+KM KALQRYG
Sbjct  212  SPKYHGAMKIFAPVRKKLGVKTVFNILGPMLNPARVPFAVVGVYEDSMVTKMGKALQRYG  271

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TP K+EKF+FDP  FGIPRCTL+DL+G  PEYNA
Sbjct  272  MKRALVVHSEGLDEMSPLGPGVVLDVTPGKVEKFSFDPENFGIPRCTLEDLRGGDPEYNA  331

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             V                 LNA AALLVSGHV TL  G+ +AR TH SGKAL TL+ W +
Sbjct  332  KV-----------------LNAAAALLVSGHVSTLGDGVAVARTTHLSGKALRTLQCWTE  374

Query  222  VSNNVKE  202
            +S+ VKE
Sbjct  375  ISSKVKE  381



>gb|KFK26024.1| hypothetical protein AALP_AA8G193700 [Arabis alpina]
Length=426

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+ KT+FN LG MLNPARV +AVVGVY++++V KMAKALQR+G
Sbjct  238  SPMYHPAMKIVGPVRKKLKTKTVFNILGPMLNPARVSYAVVGVYHKDLVLKMAKALQRFG  297

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS GLDEMSPLG G V D+TPE IE+F+FDPL+FGIPRCTL+DL+G GP+YNA
Sbjct  298  MKRALVVHSHGLDEMSPLGGGLVYDVTPETIEEFSFDPLDFGIPRCTLEDLRGGGPDYNA  357

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            DVL+RVLSGE+G IADA ILNA AALLVS  V+TLA+G+ LAR    SGKA+ TL  WI 
Sbjct  358  DVLRRVLSGESGSIADALILNAAAALLVSNRVQTLAEGVTLAREVQSSGKAIKTLDSWIH  417

Query  222  VSNNVKE  202
             S++ ++
Sbjct  418  SSSSAQK  424



>ref|XP_006476804.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
[Citrus sinensis]
Length=413

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  223  STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  282

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  283  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  342

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADA ILNA AALLVS  V TLA+G+ LAR    SGKAL+TL  WI+
Sbjct  343  EVLRRVLSGERGAIADALILNAAAALLVSCKVNTLAEGVALAREIQLSGKALNTLDLWIE  402

Query  222  VS  217
            VS
Sbjct  403  VS  404



>ref|XP_006439846.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
 gb|ESR53086.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
Length=468

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  280  STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  339

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  340  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  399

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADA ILNA AALLVS  V TLA+G+ LAR    SGKAL+TL  WI+
Sbjct  400  EVLRRVLSGERGAIADALILNAAAALLVSCKVNTLAEGVALAREIQLSGKALNTLDLWIE  459

Query  222  VS  217
            VS
Sbjct  460  VS  461



>ref|XP_006439849.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
 gb|ESR53089.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
Length=468

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  280  STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  339

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  340  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  399

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADA ILNA AALLVS  V TLA+G+ LAR    SGKAL+TL  WI+
Sbjct  400  EVLRRVLSGERGAIADALILNAAAALLVSCKVNTLAEGVALAREIQLSGKALNTLDLWIE  459

Query  222  VSNNV  208
            VS ++
Sbjct  460  VSKHL  464



>ref|XP_006439847.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
 gb|ESR53087.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
Length=470

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  280  STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  339

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  340  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  399

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL+RVLSGE G IADA ILNA AALLVS  V TLA+G+ LAR    SGKAL+TL  WI+
Sbjct  400  EVLRRVLSGERGAIADALILNAAAALLVSCKVNTLAEGVALAREIQLSGKALNTLDLWIE  459

Query  222  VS  217
            VS
Sbjct  460  VS  461



>ref|XP_009383611.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=414

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAM+IV PVR+KL++KT+FN LG MLNPA+VP AVVGVYNE++V KMAKALQR+G
Sbjct  222  SPIYHPAMRIVGPVRKKLKVKTVFNILGPMLNPAQVPCAVVGVYNEDIVLKMAKALQRFG  281

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHS+GLDE+SPLG G  LD+TP  IEK  FDPL+FGIPRCT++DL+G  P++NA
Sbjct  282  MKRALVVHSKGLDEISPLGSGYFLDVTPRSIEKSHFDPLDFGIPRCTVEDLKGGDPQFNA  341

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            +VL RVLSGE GPIADA +LNA AALLVSG V   ++G+ +A+ TH+SGKA+ TL  W+ 
Sbjct  342  EVLTRVLSGEKGPIADALVLNAAAALLVSGRVTNFSEGVAVAQETHQSGKAIDTLASWMA  401

Query  222  VSNNVK  205
            VSN ++
Sbjct  402  VSNRLR  407



>ref|XP_008813580.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=401

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV PVRR L++KT+FN LG MLNPARVPFAVVGV NE++V KMAKALQR+G
Sbjct  215  APNYHPAMKIVRPVRRSLKVKTVFNILGPMLNPARVPFAVVGVCNEDIVMKMAKALQRFG  274

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDE+SPLGPG  LD+TP KI+K  FDPLEFGIPRCT+++L+G   E+NA
Sbjct  275  MKRALVVHSEGLDEISPLGPGYFLDVTPGKIQKLHFDPLEFGIPRCTMENLRGGDAEFNA  334

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VLSG+ G IADA +LNA AALLV G V T A+G+ LA+ TH+SGKA+ TL+ WI 
Sbjct  335  RVLRDVLSGQKGSIADALVLNAAAALLVGGRVSTFAEGVALAKETHQSGKAIDTLELWIG  394

Query  222  VSNNVK  205
             SN ++
Sbjct  395  ASNRLR  400



>emb|CAN74291.1| hypothetical protein VITISV_015980 [Vitis vinifera]
Length=830

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 144/187 (77%), Gaps = 17/187 (9%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YH AMKI APVR+KL +KT+FN LG MLNPARVPFAVVGVY +++V+KM KALQRYG
Sbjct  636  SPKYHGAMKIFAPVRKKLGVKTVFNILGPMLNPARVPFAVVGVYEDSMVTKMGKALQRYG  695

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TP K+EKF+FDP  FGIPRCTL+DL+G  PEYNA
Sbjct  696  MKRALVVHSEGLDEMSPLGPGVVLDVTPGKVEKFSFDPXNFGIPRCTLEDLRGGDPEYNA  755

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             V                 LNA AALLVSGHV TL  G+ +AR TH SGKAL TL+ W +
Sbjct  756  KV-----------------LNAAAALLVSGHVSTLGDGVAVARTTHLSGKALRTLQCWTE  798

Query  222  VSNNVKE  202
            +S+ VKE
Sbjct  799  ISSKVKE  805



>gb|KJB53200.1| hypothetical protein B456_008G296400 [Gossypium raimondii]
Length=385

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV+ VR+KL+IKT+FN LG MLNPARVPFAVVGVY+E++V KMAKALQR+G
Sbjct  219  APKYHPAMKIVSGVRKKLKIKTVFNVLGPMLNPARVPFAVVGVYHEDLVFKMAKALQRFG  278

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG VLD+TPEKIEKF+FDPLEFGIPRCTL DL+G G  YNA
Sbjct  279  MKRALVVHSEGLDEMSPLGPGRVLDVTPEKIEKFSFDPLEFGIPRCTLDDLRGGGKNYNA  338

Query  402  DVLKRVLSGETGPIADAFILN  340
            DVLKR+LSGE+GPIA+A + N
Sbjct  339  DVLKRILSGESGPIAEALVNN  359



>ref|XP_009597052.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X3 [Nicotiana tomentosiformis]
Length=409

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV P+R+KL++KT+FN LG MLNPARVPFAVVGVY E++V KMAKA+QR+G
Sbjct  267  APIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARVPFAVVGVYKEDLVHKMAKAVQRFG  326

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRAL+VHSEGLDEMSPLGPG VLD+TP+ IEKF+FDPL+FGIPRCTL+ L+G GP+YNA
Sbjct  327  MKRALIVHSEGLDEMSPLGPGLVLDVTPDNIEKFSFDPLDFGIPRCTLESLRGGGPDYNA  386

Query  402  DVLKRVLSGETGPIADAFIL  343
            ++LKRVLSGE GPIADAF L
Sbjct  387  EMLKRVLSGEKGPIADAFQL  406



>ref|XP_001774234.1| predicted protein [Physcomitrella patens]
 gb|EDQ61010.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMK+VAPVRR L+IKT FN LG MLNP+R P ++VGVY++N+V KMAK LQ +G
Sbjct  219  APTYHPAMKVVAPVRRSLKIKTAFNILGPMLNPSRAPHSIVGVYHDNLVEKMAKILQHFG  278

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             KR LVVH  GLDEMSPLG G VL++T +KIE F FDPL FGIPRCTL+DL+G   ++NA
Sbjct  279  TKRTLVVHCHGLDEMSPLGGGRVLEVTQDKIESFVFDPLNFGIPRCTLEDLKGGNADFNA  338

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
              L+ V +GE GPIAD+ ILNA A ++  G VK L +G+ LAR   RSG+A   L  WI 
Sbjct  339  KSLRNVFAGEPGPIADSLILNAAAGIMACGLVKDLGEGVSLARDVLRSGRANTVLDNWIS  398

Query  222  VSNNVK  205
            +S  +K
Sbjct  399  LSQKLK  404



>gb|KDO69601.1| hypothetical protein CISIN_1g023127mg [Citrus sinensis]
Length=233

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  91   STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  150

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  151  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  210

Query  402  DVLKRVLSGETGPIADAFI  346
            +VL+RVLSGE G IADA +
Sbjct  211  EVLRRVLSGERGAIADALV  229



>ref|XP_011464025.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic 
isoform X2 [Fragaria vesca subsp. vesca]
Length=394

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 147/186 (79%), Gaps = 10/186 (5%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH AM+IV PVR+KL++KT+FN LG MLNPA+VPFAVVGVY E++V KMA+ALQ +G
Sbjct  213  APKYHSAMRIVRPVRKKLKVKTVFNILGPMLNPAKVPFAVVGVYTEDLVLKMAEALQSFG  272

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPLGPG +LD+TP KIEKF+FDP           DL+G GPEYNA
Sbjct  273  MKRALVVHSEGLDEMSPLGPGLILDVTPNKIEKFSFDPY----------DLRGGGPEYNA  322

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            + LKRVLSGE G +ADA ILNA AALLVSG V  LA+G+ LAR T RSGKA+ TL  W+ 
Sbjct  323  EALKRVLSGEKGSVADALILNAAAALLVSGRVTNLAEGVLLARDTQRSGKAIKTLDHWVS  382

Query  222  VSNNVK  205
            ++  ++
Sbjct  383  ITKTMR  388



>ref|XP_009787827.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=380

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 145/187 (78%), Gaps = 20/187 (11%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV P+R+KL++KT+FN LG MLNPAR PFAVVGVY E++V KMAKA+QR+G
Sbjct  208  APIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPARAPFAVVGVYKEDLVHKMAKAVQRFG  267

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDEMSPL                    ++F IPRCTL+ L+G GP+YNA
Sbjct  268  MKRALVVHSEGLDEMSPL--------------------VDFAIPRCTLESLRGGGPDYNA  307

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++LKRVLSGE GPIADAF LNA AALLVSGHVK LA+G+ LAR T  SGKAL TL  W++
Sbjct  308  EMLKRVLSGEKGPIADAFALNAAAALLVSGHVKNLAEGVALARKTLVSGKALKTLDLWVE  367

Query  222  VSNNVKE  202
            VSN VKE
Sbjct  368  VSNEVKE  374



>ref|XP_009776444.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate phosphoribosyltransferase, 
chloroplastic-like, partial [Nicotiana sylvestris]
Length=284

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV P+R+KL++KT+FN LG MLNP+RVPFAVVGVY E++V KMAKA+QR+G
Sbjct  143  APIYHPAMKIVRPIRKKLKVKTVFNILGPMLNPSRVPFAVVGVYKEDLVHKMAKAVQRFG  202

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MK+ LVVHSEG DEMSPLGPG VLDIT + IEKF+FDP +F IPRCTL+ L+G GP+YNA
Sbjct  203  MKKVLVVHSEGPDEMSPLGPGLVLDITLDNIEKFSFDPSDFAIPRCTLESLRGGGPDYNA  262

Query  402  DVLKRVLSGETGPIADAFIL  343
            ++LKRVLSGE GPIADAF L
Sbjct  263  EMLKRVLSGEKGPIADAFQL  282



>ref|XP_006439848.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
 gb|ESR53088.1| hypothetical protein CICLE_v10020016mg [Citrus clementina]
Length=422

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  280  STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  339

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDPL++GIPRCTL+ LQG GP YNA
Sbjct  340  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNA  399

Query  402  DVLKRVLSGETGPIADAFI  346
            +VL+RVLSGE G IADA +
Sbjct  400  EVLRRVLSGERGAIADALV  418



>gb|KEH35038.1| anthranilate phosphoribosyltransferase [Medicago truncatula]
Length=363

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+++T+FN LG MLNPA+ P+AVVGVY E++V KMAKAL ++G
Sbjct  204  SPKYHPAMKIVRPVRKKLKVRTVFNILGPMLNPAQAPYAVVGVYTEDLVFKMAKALNKFG  263

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDE+SPLGPG VLD+TP  I+KF+FDPL+FGIPRC L+ L+G  P YNA
Sbjct  264  MKRALVVHSEGLDEISPLGPGLVLDVTPGGIDKFSFDPLDFGIPRCNLESLKGGDPRYNA  323

Query  402  DVLKRVLSGETGPIADAFI  346
            +VLKR+L GE GPIADAF+
Sbjct  324  EVLKRILGGERGPIADAFV  342



>ref|XP_002986483.1| hypothetical protein SELMODRAFT_425447 [Selaginella moellendorffii]
 gb|EFJ12340.1| hypothetical protein SELMODRAFT_425447 [Selaginella moellendorffii]
Length=364

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 141/186 (76%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK+V PVR+ L++KT+FN LG +LNPARVP  +VGVY++++V KMAKALQ  G
Sbjct  170  APKFHPAMKVVGPVRKSLKVKTVFNILGPLLNPARVPHQIVGVYSKSLVPKMAKALQLLG  229

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             K ALVVHSEGLDEMSPLGPG +L++TP  I++F+FDPL+FG PRCT++DL+G    +N+
Sbjct  230  TKHALVVHSEGLDEMSPLGPGFILEVTPTSIKEFSFDPLDFGFPRCTVEDLRGGDAAFNS  289

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL G+ G IA+A ILNAGA L+  G    L  G+E+A+   +SG+AL  L  WI 
Sbjct  290  KVLRDVLGGQEGHIANALILNAGAGLVACGVADDLKSGVEMAQAAQQSGQALKVLDSWIH  349

Query  222  VSNNVK  205
            +S  +K
Sbjct  350  LSQELK  355



>ref|XP_002964901.1| hypothetical protein SELMODRAFT_230552 [Selaginella moellendorffii]
 gb|EFJ33739.1| hypothetical protein SELMODRAFT_230552 [Selaginella moellendorffii]
Length=394

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 141/186 (76%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK+V PVR+ L++KT+FN LG +LNPARVP  +VGVY++++V KMAKALQ  G
Sbjct  200  APKFHPAMKVVGPVRKSLKVKTVFNILGPLLNPARVPHQIVGVYSKSLVPKMAKALQLLG  259

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             K ALVVHSEGLDEMSPLGPG +L++TP  I++F+FDPL+FG PRCT++DL+G    +N+
Sbjct  260  TKHALVVHSEGLDEMSPLGPGFILEVTPTSIKEFSFDPLDFGFPRCTVEDLRGGDAAFNS  319

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VL G+ G IA+A ILNAGA L+  G    L  G+E+A+   +SG+AL  L  WI 
Sbjct  320  KVLRDVLGGQEGHIANALILNAGAGLVACGVADDLKSGVEMAQAAQQSGQALKVLDSWIH  379

Query  222  VSNNVK  205
            +S  +K
Sbjct  380  LSQELK  385



>ref|XP_008813581.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=381

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 139/186 (75%), Gaps = 20/186 (11%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMKIV PVRR L++KT+FN LG MLNPARVPFAVVGV NE++V KMAKALQR+G
Sbjct  215  APNYHPAMKIVRPVRRSLKVKTVFNILGPMLNPARVPFAVVGVCNEDIVMKMAKALQRFG  274

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MKRALVVHSEGLDE+SPL                    +EFGIPRCT+++L+G   E+NA
Sbjct  275  MKRALVVHSEGLDEISPL--------------------VEFGIPRCTMENLRGGDAEFNA  314

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             VL+ VLSG+ G IADA +LNA AALLV G V T A+G+ LA+ TH+SGKA+ TL+ WI 
Sbjct  315  RVLRDVLSGQKGSIADALVLNAAAALLVGGRVSTFAEGVALAKETHQSGKAIDTLELWIG  374

Query  222  VSNNVK  205
             SN ++
Sbjct  375  ASNRLR  380



>emb|CEF98313.1| Glycosyl transferase, family 3 [Ostreococcus tauri]
Length=362

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 126/187 (67%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM  V+PVR+ L+++T FN LG MLNPA   +A+VGVY+  V   MA +L R G
Sbjct  173  APRYHPAMAKVSPVRKALKVRTAFNMLGPMLNPAHSKYALVGVYSTGVQQLMADSLMRLG  232

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MK+ALVVHS GLDE++P GP  V+++TP     + F+P + G+  CTL+DL+G  P+ NA
Sbjct  233  MKKALVVHSMGLDELTPAGPADVVEVTPNGTRSYTFEPKDVGVKACTLEDLRGGDPQMNA  292

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +L+  L GE GPIA+  ILNAG A+  +   K + +GI +AR  H SGKA  TL  WI 
Sbjct  293  KLLRAALEGEKGPIAETLILNAGVAMAAAQQAKDVTEGIAMAREAHESGKAGKTLNAWIA  352

Query  222  VSNNVKE  202
            ++  +K+
Sbjct  353  LTQELKK  359



>gb|AFW89746.1| hypothetical protein ZEAMMB73_227948 [Zea mays]
Length=330

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -3

Query  618  VSKMAKALQRYGMKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTL  439
            V+KMAKA Q++GMKRALVVHS+GLDE+SPLGPG +LD+TPEKIEK  FDPL+FGIPRCTL
Sbjct  192  VTKMAKAAQKFGMKRALVVHSKGLDEISPLGPGYILDVTPEKIEKMFFDPLDFGIPRCTL  251

Query  438  KDLQGAGPEYNADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRS  259
            +DL+G  P +NA VL+ VL+G+ G IADA +LNA A+LLVSG VK L  G+ LA+ T RS
Sbjct  252  EDLKGGDPAFNAKVLQDVLAGQRGAIADALVLNAAASLLVSGKVKNLHDGVALAQETQRS  311

Query  258  GKALHTLKFWIDVSNNVKE  202
            GKA++TL+ WI  SN+ ++
Sbjct  312  GKAINTLESWIKKSNSSRD  330



>ref|XP_003079802.1| phosphoribosylanthranilate transferase (ISS) [Ostreococcus tauri]
Length=352

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 122/184 (66%), Gaps = 0/184 (0%)
 Frame = -3

Query  759  PYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGM  580
            P   PAM  V+PVR+ L+++T FN LG MLNPA   +A+VGVY+  V   MA +L R GM
Sbjct  156  PEIPPAMAKVSPVRKALKVRTAFNMLGPMLNPAHSKYALVGVYSTGVQQLMADSLMRLGM  215

Query  579  KRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNAD  400
            K+ALVVHS GLDE++P GP  V+++TP     + F+P + G+  CTL+DL+G  P+ NA 
Sbjct  216  KKALVVHSMGLDELTPAGPADVVEVTPNGTRSYTFEPKDVGVKACTLEDLRGGDPQMNAK  275

Query  399  VLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
            +L+  L GE GPIA+  ILNAG A+  +   K + +GI +AR  H SGKA  TL  WI +
Sbjct  276  LLRAALEGEKGPIAETLILNAGVAMAAAQQAKDVTEGIAMAREAHESGKAGKTLNAWIAL  335

Query  219  SNNV  208
            + +V
Sbjct  336  TQDV  339



>ref|XP_001418201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=370

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 124/187 (66%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM  V+PVR+ L+++T FN LG MLNPA   +A+VGVY+  V   MA +L + G
Sbjct  181  APRYHPAMAKVSPVRKALKVRTAFNMLGPMLNPAHSKYALVGVYSTGVQQLMADSLMKLG  240

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MK+AL+VHS GLDE++P GP  V+++TP     + F+P +  I  CTL+DL+G  P  NA
Sbjct  241  MKKALIVHSMGLDELTPAGPADVVEVTPSGTRAYTFEPKDVDIKPCTLEDLRGGDPTTNA  300

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +L+  L GE GP+A+  ILNAG A+  +   K + +GI +AR  H SGKA  TL  WI 
Sbjct  301  RILRAALEGEKGPVAETLILNAGVAMAAAQQAKDVVEGIAMAREAHESGKAGKTLDSWIK  360

Query  222  VSNNVKE  202
            ++  +++
Sbjct  361  LTQELRK  367



>gb|EPS69209.1| hypothetical protein M569_05556, partial [Genlisea aurea]
Length=139

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  618  VSKMAKALQRYGMKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTL  439
            V KM KALQR+GMKRA VVHS+GLDEM+P+GPG +LD+TP++I+KF+FDPL+FGIPRCT+
Sbjct  1    VDKMGKALQRFGMKRAFVVHSKGLDEMTPIGPGLILDVTPDRIDKFSFDPLDFGIPRCTV  60

Query  438  KDLQGAGPEYNADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRS  259
            +DL+G GPEYNA  ++RVL GE G +A+A ILNA AALLV G V  LA+G+ELAR TH S
Sbjct  61   EDLRGGGPEYNAAAMRRVLDGEEGHVANALILNAAAALLVGGQVGDLAEGVELARKTHVS  120

Query  258  GKALHTLKFWIDVSNNVKE  202
            GK   TL  WID S   KE
Sbjct  121  GKGRETLDLWIDASKKFKE  139



>ref|XP_011400011.1| Anthranilate phosphoribosyltransferase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27055.1| Anthranilate phosphoribosyltransferase, chloroplastic [Auxenochlorella 
protothecoides]
Length=312

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 121/182 (66%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK V PVRR L+I+T+FN LG +LNPA   + +VGVY+ ++   MA ALQR G
Sbjct  124  APVFHPAMKAVVPVRRALKIRTVFNLLGPLLNPAHAAYGLVGVYSPSISHVMADALQRLG  183

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             +R+LVVHS GLDE++PLGP +V+++T     +++ +P + GIPR T++DL+G     NA
Sbjct  184  TQRSLVVHSMGLDELTPLGPASVVEVTQAGKREYSLEPRDLGIPRATVEDLKGGDARLNA  243

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +L+ V  G  GP+ADA  LNAG AL  +G V +   G+ LA+ T R G    TL  W  
Sbjct  244  AILEDVFGGGRGPVADALNLNAGVALCAAGVVASAEDGVALAQETQRRGAPGETLARWRA  303

Query  222  VS  217
            VS
Sbjct  304  VS  305



>ref|XP_007513285.1| anthranilate phosphoribosyltransferase [Bathycoccus prasinos]
 emb|CCO16843.1| anthranilate phosphoribosyltransferase [Bathycoccus prasinos]
Length=405

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 124/187 (66%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAM  V+PVR+ L+++T FN LG MLNPA   +A+VGVY+ ++   MA +  R G
Sbjct  216  APRFHPAMAKVSPVRKSLKVRTAFNLLGPMLNPAHSKYALVGVYSTDIQRLMADSFMRLG  275

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            MK+AL+VHS GLDE++P GP  V++++ + ++ + F+P + GI +C LKDL G   + NA
Sbjct  276  MKKALIVHSMGLDELTPCGPADVMEVSKDGVKTYTFEPSKVGIKKCELKDLAGGDAKLNA  335

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +L+  L GETGP+A+  ILNAG A+  +    ++ +GI + R  H++GK    L  WI 
Sbjct  336  KILREALGGETGPVAETLILNAGVAMAAAEQAASVEEGIAMCREAHKTGKGGEKLDSWIQ  395

Query  222  VSNNVKE  202
            ++   K+
Sbjct  396  LTQECKK  402



>ref|XP_005704575.1| anthranilate phosphoribosyltransferase [Galdieria sulphuraria]
 gb|EME28055.1| anthranilate phosphoribosyltransferase [Galdieria sulphuraria]
Length=513

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 128/186 (69%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHP+MK+VA +R+ LRI+T FN LG + NPA V   V+GV +E ++ K+A ALQ  G
Sbjct  328  APRYHPSMKLVANIRKGLRIRTAFNLLGPLTNPALVSRQVIGVSHEELMEKLAIALQLLG  387

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             +R+ V+H  GLDE+SPLG  TVL++TP+ I ++A +P ++G P C L+DL+GA   +NA
Sbjct  388  TERSWVLHCSGLDELSPLGSATVLEVTPDDIHRYAINPAQYGFPTCQLEDLKGADANFNA  447

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +L+  L G+   I+++ ILNAGAAL+VSG  ++  + I LA  T  SG +L  L+ WI 
Sbjct  448  HILRECLRGKPSAISNSIILNAGAALVVSGMSESFGEAITLAARTLMSGSSLELLERWIR  507

Query  222  VSNNVK  205
            ++  ++
Sbjct  508  LTQTLE  513



>ref|XP_005715714.1| unnamed protein product [Chondrus crispus]
 emb|CDF35895.1| unnamed protein product [Chondrus crispus]
Length=385

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 127/189 (67%), Gaps = 2/189 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMKIV PVR+ ++I+T+FN +G +LNP     AV+GVY  N++  MA+ L   G
Sbjct  196  APNFHPAMKIVGPVRKAMKIRTVFNVIGPLLNPCLAKCAVIGVYELNLLDLMAEVLISTG  255

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDP-LEFGIPRCTLKDLQGAGPEYN  406
            +KRA+VVH+EGLDE S  G   V+++   + E++AFDP  E G+P+  + DL+G    YN
Sbjct  256  VKRAVVVHTEGLDEYSNTGVSQVIEVKGGQKERYAFDPKAELGMPKAEISDLRGGDARYN  315

Query  405  ADVLKRVLSGE-TGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFW  229
            AD+++RVLSGE  GPI +A  LNAG    V G   ++ +G++LA+   ++GK LHTL+ W
Sbjct  316  ADIIRRVLSGELEGPITNAIALNAGVGCYVYGVADSVKEGVDLAKGVLKTGKPLHTLETW  375

Query  228  IDVSNNVKE  202
              VS   K+
Sbjct  376  AAVSQLSKD  384



>ref|XP_002500831.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62089.1| predicted protein [Micromonas sp. RCC299]
Length=199

 Score =   171 bits (433),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 123/190 (65%), Gaps = 4/190 (2%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMK V PVR+ L+++T FN LG MLNPA   +A+VGVY  ++   MA +L   G
Sbjct  6    APRYHPAMKAVVPVRKALKVRTAFNMLGPMLNPAGTQYALVGVYTPDLQPLMADSLMALG  65

Query  582  MKRALVVHSE----GLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGP  415
            MK+ALVV S      LDEM+P GP +V+++TP   + ++FDP + GIP C LKDL G   
Sbjct  66   MKKALVVCSTVGDLSLDEMTPCGPTSVVEVTPAGTKSYSFDPKDVGIPPCELKDLAGGDA  125

Query  414  EYNADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLK  235
            + NA +L   L GE GP+AD  +LNAG A+  +   +++ +G+ + +  H  GKA  TL+
Sbjct  126  KLNARMLTDALGGEKGPVADCLMLNAGVAMAAAAQAESVEEGVAMCKEAHAQGKAGDTLR  185

Query  234  FWIDVSNNVK  205
             WI++S  +K
Sbjct  186  SWIELSQELK  195



>ref|XP_005650910.1| anthranilate phosphoribosyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26366.1| anthranilate phosphoribosyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=338

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 115/187 (61%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM  V PVRR L+++T FN LG +LNPA   + ++GVY+  +   MA  LQR G
Sbjct  148  APRYHPAMAAVVPVRRSLKVRTAFNILGPLLNPAAAAYGLIGVYSPAISGLMAATLQRLG  207

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             KRALVVHS GLDE++P+G   +L++TP     +  DPL+ GI RC + DL G   + NA
Sbjct  208  TKRALVVHSHGLDELTPMGDAEILEVTPSGTRSYRLDPLDLGIKRCQVADLAGGDAQLNA  267

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +L  V  G  G +ADA  LNAG AL  +    + A+G+ +A+   +SGKA   L+ W  
Sbjct  268  SILTDVFGGARGAVADALNLNAGVALAAAEIAASPAEGVAMAQEAQQSGKAGDLLQRWRK  327

Query  222  VSNNVKE  202
            VS   +E
Sbjct  328  VSQGCRE  334



>ref|XP_005844184.1| hypothetical protein CHLNCDRAFT_27114, partial [Chlorella variabilis]
 gb|EFN52082.1| hypothetical protein CHLNCDRAFT_27114 [Chlorella variabilis]
Length=355

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 120/187 (64%), Gaps = 4/187 (2%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQ---  592
            +P YHPAMK V PVR+ LR++T FN LG MLNPA   + +VGVY+ +V   MA ALQ   
Sbjct  152  APTYHPAMKTVVPVRKSLRVRTAFNLLGPMLNPADAAYGLVGVYSTSVSHLMADALQASG  211

Query  591  -RYGMKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGP  415
             R G+K+ALVVHS GLDE++P+GP  V+++T +    ++ +P+E GIPRC + DL G   
Sbjct  212  MRLGVKKALVVHSSGLDELTPMGPADVVEVTQQGKHSYSLEPIELGIPRCEVADLAGGDA  271

Query  414  EYNADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLK  235
              NA +L     G  GP+ADA  LNAG AL  +       +G+ +A+   RSG+A  T++
Sbjct  272  ALNARILMDAFGGARGPVADALNLNAGVALAAATLAADAKEGVAMAQDAQRSGRAGDTMR  331

Query  234  FWIDVSN  214
             W++VS 
Sbjct  332  KWLEVSQ  338



>ref|XP_001702699.1| anthranilate phosphoribosyltransferase [Chlamydomonas reinhardtii]
 gb|EDP06478.1| anthranilate phosphoribosyltransferase [Chlamydomonas reinhardtii]
Length=390

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 119/179 (66%), Gaps = 1/179 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHP MK V PVR  L+++T  N LG +LNPA   + +VGVY+ ++   MA +L R G
Sbjct  192  APRYHPGMKAVRPVRSALKVRTALNMLGPLLNPAEASYGLVGVYDTSISELMAGSLLRMG  251

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEK-IEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            +++ALVVHS GLDE++P+GP  V+++T    +++++ DP E GIPRC ++DL+G   + N
Sbjct  252  VQKALVVHSMGLDELTPMGPADVVEVTAGGPLKRYSLDPKEVGIPRCEVEDLKGGDAQLN  311

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFW  229
            A +L+ V +G+ G +ADA  LNAG AL       T A+G+++A+   R G A  TL+ W
Sbjct  312  AAILRDVFAGQKGAVADALCLNAGYALAACRVAATPAEGVKMAQEVQRRGDATATLQRW  370



>gb|KDO69602.1| hypothetical protein CISIN_1g023127mg [Citrus sinensis]
Length=219

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            S  YHPAMK V PVR+KL++KT+FN LG MLNPA VPFAVVGVYNEN+V KMA ALQR+G
Sbjct  91   STKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFG  150

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDP  469
            +KRALVVHSEGLDEMSPLGPG +LD+T EKIE+F+FDP
Sbjct  151  LKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDP  188



>gb|KDD75826.1| glycosyl transferase [Helicosporidium sp. ATCC 50920]
Length=345

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 120/182 (66%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHP M  +AP+RR LR++T FN LG +LNPA+   A+VGVY+  V   + +A+ +  
Sbjct  148  APRYHPYMAALAPLRRALRVRTAFNLLGPLLNPAQARHALVGVYSFGVAPLVGQAMSQLR  207

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
              R LVVHS GLDE++PLG G +L+IT     ++  DP   GIPRC+++DL+G     NA
Sbjct  208  AGRVLVVHSCGLDELTPLGEGQILEITESGTREYILDPTTLGIPRCSVEDLKGGDAAVNA  267

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +L+ VL+GE G +ADA +LNAGAAL  +G   +L  G++ AR THRSG A   L+ W  
Sbjct  268  RILENVLAGEPGGVADALVLNAGAALYAAGLAPSLQDGVQRARETHRSGAAADVLQRWRQ  327

Query  222  VS  217
            V+
Sbjct  328  VA  329



>gb|KDO25949.1| anthranilate phosphoribosyltransferase [Saprolegnia parasitica 
CBS 223.65]
Length=343

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 119/192 (62%), Gaps = 2/192 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++HPAMK V PVRR + I+TIFN LG ++NPA    AV+GVY  +++    + L   G
Sbjct  151  APHFHPAMKHVMPVRRAMGIRTIFNVLGPLINPAGCKHAVIGVYTPSLLPLFGEVLYGLG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEK-IEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            ++ ALVVH  GLDE++P+G   V++++  K   ++   P E GIPRCTLKDL+G   E N
Sbjct  211  VEHALVVHCAGLDELNPIGNADVVEVSRTKGCTRYTLTPEELGIPRCTLKDLEGGDCEVN  270

Query  405  ADVLKRVLSGET-GPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFW  229
            A +LK V  G     +      NAGA L V G   ++  G E+A+ T  SGKA+ TL+ W
Sbjct  271  ARILKDVFRGNCDNAVGHTIAYNAGAGLYVYGLASSIKDGYEMAKKTLASGKAMDTLQRW  330

Query  228  IDVSNNVKEP*T  193
             DV+ N+ +P T
Sbjct  331  SDVAQNLHKPTT  342



>ref|XP_008614909.1| anthranilate phosphoribosyltransferase [Saprolegnia diclina VS20]
 gb|EQC31510.1| anthranilate phosphoribosyltransferase [Saprolegnia diclina VS20]
Length=343

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 119/189 (63%), Gaps = 2/189 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++HPAMK V PVRR + I+TIFN LG ++NPA    AV+GVY  +++    + L   G
Sbjct  151  APHFHPAMKHVMPVRRAMGIRTIFNVLGPLINPASCKHAVIGVYTPSLLPLFGEVLYGLG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEK-IEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            ++ ALVVH  GLDE++P+G   V++++  K   ++   P E GIPRCTLKDL+G   + N
Sbjct  211  VEHALVVHCAGLDELNPIGNADVVEVSRTKGCTRYTLTPEELGIPRCTLKDLEGGDCDLN  270

Query  405  ADVLKRVLSGET-GPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFW  229
            A +LK V  G    P+      NAGA L V G   ++ +G E+A+ T  SGKA+ TL+ W
Sbjct  271  ARILKDVFRGNCDNPVGHTIAYNAGAGLYVYGLASSIKEGYEMAKKTLASGKAMDTLQRW  330

Query  228  IDVSNNVKE  202
             DV+ N+ +
Sbjct  331  SDVAQNLHK  339



>ref|WP_027089668.1| anthranilate phosphoribosyltransferase [[Clostridium] saccharogumia]
Length=335

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 117/181 (65%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVRR+L I+T+FN LG + NPA     V+GVY+E +V  +AK L   G+KR
Sbjct  154  YHIAMKYVAPVRRELGIRTVFNILGPLTNPAGASKQVMGVYDETLVEPLAKVLSNLGVKR  213

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+ +  LDE+S   P +V ++   K  ++   P +FG  RC   DL G  PEYNA +
Sbjct  214  AMVVYGQDCLDEISLSAPTSVCEVKDGKYARYVITPEQFGFKRCVKGDLVGGDPEYNAKI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +LSG+ GP  DA +LNAGAA+ ++G  +T+ +GIELA      GKAL  L+ +I+ +
Sbjct  274  TREILSGKKGPQRDAVLLNAGAAIYIAGRSETMQEGIELAAKLIDEGKALAKLEQFIEET  333

Query  216  N  214
            N
Sbjct  334  N  334



>ref|WP_024722206.1| anthranilate phosphoribosyltransferase [Clostridiales bacterium 
VE202-01]
Length=335

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 118/181 (65%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVRR+L I+T+FN LG + NPA     V+GVY+E +V  +AK L   G+KR
Sbjct  154  YHIAMKYVAPVRRELGIRTVFNILGPLTNPAGASKQVMGVYDETLVEPLAKVLSNLGVKR  213

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+ +  LDE+S   P +V ++   K  ++   P +FG  RC  +DL G  PEYNA +
Sbjct  214  AMVVYGQDCLDEISLSAPTSVCEVKDGKYTRYVITPEQFGFKRCVKEDLVGGDPEYNAKI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L+G+ GP  DA +LNAGAA+ ++G  +T+ +GIELA      GKAL  L+ +I+ +
Sbjct  274  TREILNGKKGPQRDAVLLNAGAAIYIAGRSETMQEGIELAAKLIDEGKALAKLEQFIEET  333

Query  216  N  214
            N
Sbjct  334  N  334



>ref|WP_013943362.1| anthranilate phosphoribosyltransferase [Simkania negevensis]
 emb|CCB88895.1| Anthranilate phosphoribosyltransferase [Simkania negevensis Z]
Length=330

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 114/178 (64%), Gaps = 0/178 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P+YHP  K +A VR++L I+T+FNF+G +LNPA  PF + GV    ++  +A  L    
Sbjct  150  APFYHPVFKEIAKVRKQLGIRTLFNFIGPLLNPAIPPFHLFGVARSELIDLLADVLLLLK  209

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             KRAL+ H EGLDE++P+GP  ++++T  K  +F  DP + G  RCT KDL+G  P+ NA
Sbjct  210  TKRALIFHCEGLDELTPVGPCDIVEVTEGKKIRFTLDPKDLGFQRCTKKDLEGDDPKLNA  269

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFW  229
             +L     G+ GPIAD  ILNAG A+ V G   ++ +GIE AR   ++GKA+  ++ W
Sbjct  270  RLLLEAFQGKPGPIADTLILNAGVAIYVYGLANSIEEGIEKAREVQQTGKAMEVVEKW  327



>ref|XP_002182062.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 ref|XP_002182064.1| anthranilate phosphoribosyltransferase [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|EEC46602.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46604.1| anthranilate phosphoribosyltransferase [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=357

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 118/197 (60%), Gaps = 12/197 (6%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P  HP+MK VAP+R+KL ++T FN LG M N A    AV+GV++  ++S MA AL+  G
Sbjct  154  APVNHPSMKYVAPIRKKLGVRTCFNILGPMTNAAGAQHAVIGVFHPELLSLMAGALKEVG  213

Query  582  -MKRALVVHSEGLDEMSPLGPGTVLDI-------TPEKIE--KFAFDPLEFGIPRCTLKD  433
             +  A+V+H  GLDE+SPLGP T+L+I        P   E  +F FDPL  GI RC L D
Sbjct  214  RVDHAVVIHGLGLDEISPLGPSTILEIKNIAAPGEPRIYEEREFEFDPLSIGIARCELAD  273

Query  432  LQGAGPEYNADVLKRVL--SGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRS  259
            L+G GPE NA   + VL   G T    D+ +LNAG    V G  K++  G +LAR T  S
Sbjct  274  LKGGGPEENAQKFRDVLLGGGHTDAKRDSIVLNAGVGCYVFGLAKSIEDGCDLARATLES  333

Query  258  GKALHTLKFWIDVSNNV  208
            GKA   L+ W+ VS  +
Sbjct  334  GKASSLLESWVKVSQEI  350



>ref|XP_006400341.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum]
 gb|ESQ41794.1| hypothetical protein EUTSA_v10013530mg [Eutrema salsugineum]
Length=372

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            SP YHPAMKIV PVR+KL+IKT+FN LG MLNPA V +AVVGVY++N+V KMAKALQR+G
Sbjct  260  SPMYHPAMKIVGPVRKKLKIKTVFNILGPMLNPASVSYAVVGVYHKNLVLKMAKALQRFG  319

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLE  463
            MKRALVVHS GLDEMSPLG G V D+TP KIE+F+FDP +
Sbjct  320  MKRALVVHSYGLDEMSPLGGGLVYDVTPAKIEEFSFDPCK  359



>ref|XP_008867255.1| anthranilate phosphoribosyltransferase, variant 2 [Aphanomyces 
invadans]
 gb|ETW04299.1| anthranilate phosphoribosyltransferase, variant 2 [Aphanomyces 
invadans]
Length=347

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 118/188 (63%), Gaps = 3/188 (2%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++HPAMK VAPVR+ + I+++FN LG ++NPA+   +V+GVY  +++    + L   G
Sbjct  151  APHFHPAMKHVAPVRKSMGIRSVFNVLGPLINPAKCQTSVIGVYTPSLLDLFGQVLHLMG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            ++ ALVVH  GLDE++P+G   ++++T +  +++   P E GIPRCTLKDL+G   + N 
Sbjct  211  VEHALVVHCAGLDELNPIGDAEIVEVTQQGCQRYTLTPEEIGIPRCTLKDLEGGDADENC  270

Query  402  DVLKRVLSGE---TGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKF  232
             +L++V  G       I +    NAGA L V G   T+  G E+A+   ++G+AL TL  
Sbjct  271  RILRQVFQGGEHCENAIGNTIAYNAGAGLYVYGLANTIKHGYEVAKAALKAGEALKTLDR  330

Query  231  WIDVSNNV  208
            W +V+  +
Sbjct  331  WSEVATRL  338



>ref|WP_011457991.1| anthranilate phosphoribosyltransferase [Chlamydophila felis]
 sp|Q254S7.1|TRPD_CHLFF RecName: Full=Anthranilate phosphoribosyltransferase [Chlamydophila 
felis Fe/C-56]
 dbj|BAE81211.1| anthranilate phosphoribosyltransferase [Chlamydophila felis Fe/C-56]
Length=343

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 115/187 (61%), Gaps = 1/187 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAK-ALQRY  586
            +P YHP++K +AP+R+ ++I + FN LG +LNPA   ++++GV NE ++  M++  LQ  
Sbjct  150  APIYHPSLKKLAPIRKGMKIPSTFNILGPLLNPANTEYSLIGVSNEPILELMSEVCLQFQ  209

Query  585  GMKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
              +R  + H  GLDE++ LG     DI   K  +   DP  FG   C +++L+G   + N
Sbjct  210  NTQRTFLFHGSGLDELTTLGKVVGYDIQQGKKTRIEIDPTSFGFASCKIEELKGGDSKMN  269

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +LK+  SG+ G IADA I NAGAA+ + G+  TL +GI++AR T   G+AL  L+ W+
Sbjct  270  AFILKKAFSGQQGAIADALIFNAGAAVWIFGNATTLEEGIQIARQTLMEGEALRVLEKWV  329

Query  225  DVSNNVK  205
              S  +K
Sbjct  330  AFSQQLK  336



>ref|XP_009828138.1| anthranilate phosphoribosyltransferase [Aphanomyces astaci]
 gb|ETV82469.1| anthranilate phosphoribosyltransferase [Aphanomyces astaci]
Length=345

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 114/188 (61%), Gaps = 3/188 (2%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++HPAMK V PVR+ + I+++FN LG ++NPA+   +V+GVY   ++    + L   G
Sbjct  151  APHFHPAMKHVGPVRKSMGIRSVFNILGPLINPAKCQTSVIGVYTPALLDLFGQVLYMMG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            ++ ALVVH  GLDE++P+G   ++++T     ++   P E GIPRCTL+DL+G   + N 
Sbjct  211  VEHALVVHCAGLDELNPIGDAEIVEVTQNGYRRYTLTPEELGIPRCTLQDLEGGDADDNC  270

Query  402  DVLKRVLSGE---TGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKF  232
             +L++V  G       I +    NAGA L V G   ++  G ELA+   ++G AL+TL+ 
Sbjct  271  RILRQVFQGGEHCDNAIGNTIAYNAGAGLYVYGLADSIKHGYELAKAALKAGHALNTLER  330

Query  231  WIDVSNNV  208
            W  VS  +
Sbjct  331  WSQVSTRL  338



>ref|WP_013798972.1| anthranilate phosphoribosyltransferase [Methanotorris igneus]
 ref|YP_004484435.1| anthranilate phosphoribosyltransferase [Methanotorris igneus 
Kol 5]
 gb|AEF96370.1| Anthranilate phosphoribosyltransferase [Methanotorris igneus 
Kol 5]
Length=336

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 117/185 (63%), Gaps = 0/185 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH AMK   PVR+++ I+T+FN LG + NPA   + VVGVY+ ++  K+A+ L+  G
Sbjct  152  APLYHSAMKHALPVRKEIGIRTVFNVLGPLTNPANAEYQVVGVYDASLTEKIAEVLKLLG  211

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +K A+VVH  G+DE++  G   + ++   +I+ +   P  FG+ R  + +L+G   + NA
Sbjct  212  LKGAMVVHGSGMDEITTTGETKISELKDGEIKTYTITPERFGLKRADIDELKGGDAKENA  271

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
            ++LKR+L GE G   D  +LNA A L V G  K+L +GI++A  +  SGKA+  L+  ++
Sbjct  272  NILKRILEGEEGAKRDIVLLNAAATLYVCGEAKSLEEGIKMAEKSIDSGKAMEKLEKLVE  331

Query  222  VSNNV  208
             +N++
Sbjct  332  FTNSI  336



>ref|WP_033166158.1| anthranilate phosphoribosyltransferase [Clostridium sp. KNHs205]
Length=335

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 115/182 (63%), Gaps = 1/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVRR+L I+TIFN LG + NPA     ++GV++E +V  +A+ L + G+KR
Sbjct  154  YHTAMKYVAPVRRELGIRTIFNILGPLSNPAGANMQLLGVFDEKLVEPLAQVLNKLGVKR  213

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VVH  +G+DE+S   P    +I   K+  +  +P +FG+ +C  +DL G GP  NA++
Sbjct  214  AMVVHGRDGIDEISLSAPTYCCEIRDGKLTTYVLEPEQFGLNKCKKEDLVGGGPSENAEI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             K +L+GE GP  DA +LN  A + +     +  + ++LA  T  SGKA+  L+ +I +S
Sbjct  274  AKAILAGEKGPKRDAVVLNTAACIYIVKDNISFKEAVKLAEDTIDSGKAMRQLEEFISLS  333

Query  216  NN  211
            NN
Sbjct  334  NN  335



>ref|WP_003536516.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Erysipelotrichaceae]
 gb|EDS19232.1| anthranilate phosphoribosyltransferase [Erysipelatoclostridium 
ramosum DSM 1402]
 gb|EEO32100.1| anthranilate phosphoribosyltransferase [Coprobacillus sp. D7]
 gb|EHM91715.1| anthranilate phosphoribosyltransferase [Coprobacillus sp. 3_3_56FAA]
 emb|CCZ31619.1| anthranilate phosphoribosyltransferase [Coprobacillus sp. CAG:183]
Length=335

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 115/181 (64%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVRR+L I+T+FN LG + NPA     V+GVY E +V  +A+ L   G+KR
Sbjct  154  YHIAMKYVAPVRRELGIRTVFNILGPLTNPAGANMQVMGVYEEALVEPLAEVLTNLGVKR  213

Query  573  ALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+  + LDE+S   P +V ++      ++   P +FG+ RC  ++L G  P+ NA +
Sbjct  214  AMVVYGQDSLDEISLSAPTSVCEVKDGTYTRYTITPEQFGLTRCCKEELVGGTPKDNAKI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +LSG  GP  DA +LNAGAA+ ++G  KT+ +GIELA      GKAL  L+ +I+ +
Sbjct  274  TRDILSGVKGPKRDAVLLNAGAAIYIAGRTKTMQEGIELAARLIDDGKALAKLEEFINKT  333

Query  216  N  214
            N
Sbjct  334  N  334



>ref|WP_008791409.1| anthranilate phosphoribosyltransferase [Coprobacillus sp. 8_2_54BFAA]
 gb|EHQ48038.1| anthranilate phosphoribosyltransferase [Coprobacillus sp. 8_2_54BFAA]
Length=335

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 115/181 (64%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVRR+L I+T+FN LG + NPA     V+GVY E +V  +A+ L   G+KR
Sbjct  154  YHIAMKYVAPVRRELGIRTVFNILGPLTNPAGANMQVMGVYEEALVEPLAEVLTNLGVKR  213

Query  573  ALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+  + LDE+S   P +V ++      ++   P +FG+ RC  ++L G  P+ NA +
Sbjct  214  AMVVYGQDSLDEISLSAPTSVCEVKDGTYTRYTITPEQFGLTRCCKEELVGGTPKDNAKI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +LSG  GP  DA +LNAGAA+ ++G  KT+ +GIELA      GKAL  L+ +I+ +
Sbjct  274  TRDILSGVKGPKRDAVLLNAGAAIYIAGRTKTMQEGIELAARLIDDGKALAKLEEFINKT  333

Query  216  N  214
            N
Sbjct  334  N  334



>ref|XP_005853457.1| anthranilate phosphoribosyltransferase [Nannochloropsis gaditana 
CCMP526]
 gb|EKU22900.1| anthranilate phosphoribosyltransferase [Nannochloropsis gaditana 
CCMP526]
Length=378

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 120/199 (60%), Gaps = 12/199 (6%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P  HP MK VAP+R+ L ++T FN +G +LN A    AVVGV+ E ++  +A  L   G
Sbjct  177  APVVHPTMKKVAPIRKALGVRTAFNIVGPLLNAAGAQHAVVGVFQERLLDVLAGTLGEIG  236

Query  582  -MKRALVVHSEGLDEMSPLGPGTVLD---ITPEKIEK------FAFDPLEFGIPRCTLKD  433
             + RAL++H  GLDE+SPLGP T+++   + P    +      + FDPL  GIPRC ++D
Sbjct  237  TVDRALIIHGVGLDEISPLGPSTIVELKNVAPAGQARVYERTSYTFDPLTCGIPRCAIED  296

Query  432  LQGAGPEYNADVLKRVLSG--ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRS  259
            L+G     NA +L++VLSG  E G   DA +LNA A L V G V +LA+G+ LA     S
Sbjct  297  LRGGDATENAALLRQVLSGGPERGAKRDAVVLNAAAGLYVYGSVPSLAEGVTLAYDILAS  356

Query  258  GKALHTLKFWIDVSNNVKE  202
            GKAL  L  WI  S  +++
Sbjct  357  GKALVKLDEWIACSQALRK  375



>ref|WP_026492110.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Butyrivibrio]
Length=344

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 114/185 (62%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +RR+L  +T+FN LG + NP      ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGAIRRELGFRTVFNILGPLTNPGSPKMQLLGVYDEYLVEPLAQVLVTLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  V +I     + +   P +FG+ RCT  DL+G  PE NA++
Sbjct  217  GMVVYGMDKLDEISLSAPTKVCEIKDGWFKTYTIKPEDFGLNRCTKDDLKGGNPEENAEI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +R+L+GE GP  DA ++NAGA+L + G   + A GI+LA     SGKA  TL+  I+VS
Sbjct  277  TRRILAGEKGPKRDAVLMNAGASLYIGGKADSFADGIKLAAKIIDSGKATETLEKLIEVS  336

Query  216  NNVKE  202
            N  +E
Sbjct  337  NRAEE  341



>gb|KJF17241.1| anthranilate phosphoribosyltransferase [Acidithrix ferrooxidans]
Length=332

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 116/189 (61%), Gaps = 6/189 (3%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM  V PVRR L + T FNFLG ++NPA+    VVGV+N +++  MA+ L + G
Sbjct  142  APRYHPAMANVVPVRRGLGVPTSFNFLGPLVNPAKAKRQVVGVFNGSMLKTMAEVLSKLG  201

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEK-----IEKFAFDPLEFGIPRCTLKDLQGA  421
             + ALV HS +G DE+S   P  V+++T +       +++  D ++FG+ RC  K+L G 
Sbjct  202  SEHALVAHSYDGYDELSTTSPNYVVELTRDGDSSAIFDEYVLDAMDFGLRRCDPKELLGG  261

Query  420  GPEYNADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHT  241
               YNA +L   L G+ G + D  +LN+GA + V G  +++A GIE+AR    SG+A  T
Sbjct  262  DASYNASILLECLDGKQGAVRDIVVLNSGAGIYVGGGARSIADGIEMAREFIDSGRAKRT  321

Query  240  LKFWIDVSN  214
            L+ +I  SN
Sbjct  322  LEGFIATSN  330



>ref|WP_009005354.1| anthranilate phosphoribosyltransferase [Clostridium sp. D5]
 gb|EGB91043.1| anthranilate phosphoribosyltransferase [Clostridium sp. D5]
Length=338

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 115/182 (63%), Gaps = 2/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVR++L I+TIFN LG + NPA     V+GVY E +V  +A+ L++ G+K 
Sbjct  154  YHIAMKYVAPVRKELGIRTIFNILGPLANPAGANMEVMGVYEEALVEPLARVLEKLGVKN  213

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+ +  LDE+S   P TV +I   +   +   P +FG   C   +LQG  P+ NA++
Sbjct  214  AMVVYGQDKLDEISMSAPTTVCEIKNGEFHSYVITPEQFGFTSCDKTELQGGTPQENAEI  273

Query  396  LKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
             + VLSG E GP   A +LNAGAAL V+G  +TL +G++LA+    SGKA   L+ +I  
Sbjct  274  TRAVLSGREKGPKRSAVLLNAGAALYVAGRAETLEEGVKLAQEAIDSGKAQEKLEQFIRY  333

Query  219  SN  214
            SN
Sbjct  334  SN  335



>gb|AHF09860.1| anthranilate phosphoribosyltransferase [Dehalobacter restrictus 
DSM 9455]
Length=336

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 1/183 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++H +MK   PVR+ L  KTIFN LG + NPA  P  ++GVY++++V   A+ L R+ 
Sbjct  151  APHFHASMKYAMPVRKALGFKTIFNILGPLANPAAAPRQLIGVYDKSLVPVAAEVLNRHQ  210

Query  582  MKRALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
               AL+VH S+GLDE++  G     ++   K+ +F   P ++G   CTL+DL G  P+ N
Sbjct  211  AVHALIVHGSDGLDEITLTGSTYAAELKDGKVTEFVIHPEDYGFSYCTLQDLVGGTPQEN  270

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +   +L+G  GP AD  ILNAGAA+ V G   +L +GIE+AR T R  KAL  L  +I
Sbjct  271  AQITLDILAGGQGPKADTVILNAGAAIYVGGKAGSLQEGIEMARATVREKKALPVLNEFI  330

Query  225  DVS  217
             V+
Sbjct  331  AVT  333



>ref|WP_038603201.1| anthranilate phosphoribosyltransferase [Dehalobacter restrictus]
Length=339

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 1/183 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++H +MK   PVR+ L  KTIFN LG + NPA  P  ++GVY++++V   A+ L R+ 
Sbjct  154  APHFHASMKYAMPVRKALGFKTIFNILGPLANPAAAPRQLIGVYDKSLVPVAAEVLNRHQ  213

Query  582  MKRALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
               AL+VH S+GLDE++  G     ++   K+ +F   P ++G   CTL+DL G  P+ N
Sbjct  214  AVHALIVHGSDGLDEITLTGSTYAAELKDGKVTEFVIHPEDYGFSYCTLQDLVGGTPQEN  273

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +   +L+G  GP AD  ILNAGAA+ V G   +L +GIE+AR T R  KAL  L  +I
Sbjct  274  AQITLDILAGGQGPKADTVILNAGAAIYVGGKAGSLQEGIEMARATVREKKALPVLNEFI  333

Query  225  DVS  217
             V+
Sbjct  334  AVT  336



>ref|WP_015359669.1| MULTISPECIES: anthranilate phosphoribosyltransferase TrpD [Ruminiclostridium]
 ref|YP_007679987.1| anthranilate phosphoribosyltransferase [ [[Clostridium] stercorarium 
subsp. stercorarium DSM 8532]
 gb|AGC68990.1| anthranilate phosphoribosyltransferase TrpD [ [[Clostridium] 
stercorarium subsp. stercorarium DSM 8532]
 gb|AGI39969.1| anthranilate phosphoribosyltransferase [ [[Clostridium] stercorarium 
subsp. stercorarium DSM 8532]
Length=336

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 115/184 (63%), Gaps = 1/184 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +PYYH +MK  APVR++L ++TIFN LG + +PA   + ++GVY+EN+V  +A+ L   G
Sbjct  151  APYYHSSMKYAAPVRKELGVRTIFNILGPLASPANAAYQLLGVYDENLVEPLARVLSNLG  210

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            +K+A+VVH  +GLDE++     TV ++    +  F  DP +FG   C   DL G GPE N
Sbjct  211  VKKAMVVHGHDGLDEVTLTTSSTVCEVNNGHLNSFFLDPRQFGFEYCKPGDLTGGGPEEN  270

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A++ +++L GE GP  D  +LN+   L +  +  TL + + LA  T  SG+A+  L+ +I
Sbjct  271  AEIARKILGGEKGPKRDIVLLNSAVCLYMFYNNMTLRECVRLAADTIDSGRAMEQLERFI  330

Query  225  DVSN  214
             +SN
Sbjct  331  RLSN  334



>ref|WP_026657597.1| anthranilate phosphoribosyltransferase [Butyrivibrio sp. AC2005]
Length=344

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 115/185 (62%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L  +T+FN LG + NP      ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGAIRKELGFRTVFNILGPLTNPGTPKMQLLGVYDEYLVEPLAQVLVSLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  V +I     + +   P +FG+ RCT +DL+G  PE NA++
Sbjct  217  GMVVYGMDKLDEISLSAPTKVCEIKDGWFKTYTIKPEDFGLNRCTKEDLKGGKPEENAEI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             KR+L+GE GP  DA ++NAGA+L + G   + A GI+LA     SGKA  TL+  I+VS
Sbjct  277  TKRILAGEKGPKRDAVLMNAGASLYIGGKADSFADGIKLAAEIIDSGKATETLEKLIEVS  336

Query  216  NNVKE  202
            N  +E
Sbjct  337  NREEE  341



>ref|WP_026496455.1| anthranilate phosphoribosyltransferase [Butyrivibrio sp. WCD3002]
Length=338

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 112/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V P+R++L  +T+FN LG + NPA     ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGPIRKELGFRTVFNILGPLTNPATPSMQLLGVYDEYLVEPLAQVLISLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  V +I     + +  +P +FG  +CT  DL+G  PE NA +
Sbjct  217  GMVVYGMDKLDEISLSAPTKVCEIKEGWYKTYTIEPEDFGFNKCTKDDLKGGTPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L G  GP  DA +LNAGA+L + G   +  +G+ELA  T  SGKAL TL+ +I VS
Sbjct  277  TREILGGAKGPKRDAVLLNAGASLYIGGKADSFKEGVELATKTIDSGKALETLENFIKVS  336

Query  216  N  214
            N
Sbjct  337  N  337



>ref|WP_027434225.1| anthranilate phosphoribosyltransferase [Lachnospiraceae bacterium 
MD2004]
Length=336

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 108/182 (59%), Gaps = 2/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AM+ V PVR++L I+T+FN LG + NPA     ++GVY++ +V  MAK LQ  G+KR
Sbjct  154  YHTAMRFVGPVRKELGIRTVFNILGPLTNPASANMQIMGVYSKELVEPMAKVLQNLGVKR  213

Query  573  ALVVHSE-GLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV  E GLDE++      V +I  E++E +   P +FG  RC   DL G   E NA +
Sbjct  214  GMVVFGEDGLDEITSSSDTYVCEIKGEELETYEISPEQFGYKRCKKSDLVGGTGEENAAI  273

Query  396  LKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
             K +L G E GP  D   +N GAAL ++G  K+L KGI +A     SG+A   L+ ++  
Sbjct  274  TKEILEGREQGPKRDTVCMNVGAALYIAGKAKSLEKGIRMAEVLIDSGEAFQKLQEFVSA  333

Query  219  SN  214
            +N
Sbjct  334  TN  335



>ref|WP_019225527.1| anthranilate phosphoribosyltransferase [Dehalobacter sp. E1]
Length=339

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 113/183 (62%), Gaps = 1/183 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++H +MK   PVR+ L  KTIFN LG + NPA  P  ++GVY++++V   A+ L R+ 
Sbjct  154  APHFHASMKYAMPVRKALGFKTIFNILGPLANPAAAPRQLIGVYDKSLVPVAAEVLNRHQ  213

Query  582  MKRALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
               AL+VH S+GLDE++  G     ++   K+ +F   P ++G   CTL+DL G  P+ N
Sbjct  214  AVHALIVHGSDGLDEITLTGSTYAAELKDGKVTEFVIHPEDYGFSYCTLQDLVGGTPQEN  273

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +   +L+G  GP AD  ILNAGAA+ V G   +L +GIE+AR T R  KAL  L  +I
Sbjct  274  ARITLDILAGGQGPKADTVILNAGAAIYVGGKAGSLQEGIEMARATVREKKALPVLNEFI  333

Query  225  DVS  217
             V+
Sbjct  334  AVT  336



>ref|WP_026670938.1| anthranilate phosphoribosyltransferase [Butyrivibrio sp. AE3006]
Length=338

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 112/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V P+R++L  +T+FN LG + NPA     ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGPIRKELGFRTVFNILGPLTNPATPTMQLLGVYDEYLVEPLAQVLINLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  V +I     + +  +P +FG  +CT  DL+G  PE NA +
Sbjct  217  GMVVYGMDKLDEISLSAPTKVCEIKEGWYKTYTIEPEDFGFNKCTKDDLKGGTPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L G  GP  DA +LNAGA+L + G   +  +G+ELA  T  SGKAL TL+ +I VS
Sbjct  277  TREILGGAKGPKRDAVLLNAGASLYIGGKADSFKEGVELAAKTIDSGKALETLENFIKVS  336

Query  216  N  214
            N
Sbjct  337  N  337



>ref|WP_011639806.1| anthranilate phosphoribosyltransferase [Syntrophomonas wolfei]
 sp|Q0B006.1|TRPD_SYNWW RecName: Full=Anthranilate phosphoribosyltransferase [Syntrophomonas 
wolfei subsp. wolfei str. Goettingen G311]
 gb|ABI67698.1| anthranilate phosphoribosyltransferase [Syntrophomonas wolfei 
subsp. wolfei str. Goettingen G311]
Length=340

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 112/185 (61%), Gaps = 1/185 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P+YHP +K V  +RR L I TIFNF+G +LNP R  + V+G+ + N+   +A  LQR G
Sbjct  151  APHYHPILKQVGGLRRGLGIATIFNFMGPLLNPCRPSYQVLGISDSNLQEAVAGTLQRLG  210

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
             KRALVVH+  G+DE+SP G   V D+    +E F  DP E GI   +L  +QG     +
Sbjct  211  RKRALVVHAFNGMDEISPEGKTRVFDVGEHGLEVFDIDPEELGIGGFSLDAIQGGDATAS  270

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A ++ +VL GE GP  D  ILN  AALL +G  K + +G+++A     +GK++ TL+  I
Sbjct  271  ARLVIKVLQGEPGPYRDTVILNTAAALLTAGRAKNIQEGMQMAAEAIDAGKSMETLQKMI  330

Query  225  DVSNN  211
              S +
Sbjct  331  SFSRD  335



>ref|WP_014587514.1| anthranilate phosphoribosyltransferase [Methanosaeta harundinacea]
 ref|YP_005920960.1| anthranilate phosphoribosyltransferase [Methanosaeta harundinacea 
6Ac]
 gb|AET65337.1| Anthranilate phosphoribosyltransferase [Methanosaeta harundinacea 
6Ac]
Length=341

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 112/179 (63%), Gaps = 0/179 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HP+MK VA +RR+L  +T+FN LG + NPA  PF V+GVY+  +  K+A AL+  G
Sbjct  150  APVFHPSMKRVASIRRELATRTVFNILGPLTNPAGAPFQVMGVYDPRLCDKLALALKILG  209

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             +RALVVH  GLDE++  GP  + ++    ++ +   P EFG P   +++++G  PE NA
Sbjct  210  TERALVVHGSGLDEITNTGPTRISELDRGALKSYTVTPQEFGYPLARIEEIRGGSPEENA  269

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
              L  +LSG  GP  D   +N+GAAL V+G  ++L  G  +A  +  SG+AL TLK  +
Sbjct  270  GRLVEILSGAKGPGRDVVAMNSGAALYVAGIAESLFDGARMAEESIDSGRALTTLKRLV  328



>ref|WP_025657700.1| anthranilate phosphoribosyltransferase [Clostridiales bacterium 
VE202-21]
Length=338

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 113/182 (62%), Gaps = 2/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVR++L I+TIFN LG + NPA     V+GVY E +V  +A+ L++ G+K 
Sbjct  154  YHIAMKYVAPVRKELGIRTIFNILGPLANPAGANMEVMGVYEEALVEPLARVLEKLGVKN  213

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+ +  LDE+S   P TV +I   +   +   P +FG   C   +LQG  P+ NA++
Sbjct  214  AMVVYGQDKLDEISMSAPTTVCEIKNGEFHSYTVTPEQFGFTSCGKNELQGGTPQENAEI  273

Query  396  LKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
             K VLSG E GP   A +LNAGAAL V+G   TL  G+++A+    SGKA   L+ +I  
Sbjct  274  TKAVLSGRELGPKRSAVLLNAGAALYVAGRADTLEAGVKMAQEAIDSGKAQEKLEQFIAY  333

Query  219  SN  214
            SN
Sbjct  334  SN  335



>ref|WP_006715793.1| anthranilate phosphoribosyltransferase [Desulfitobacterium metallireducens]
 gb|AHF07954.1| anthranilate phosphoribosyltransferase [Desulfitobacterium metallireducens 
DSM 15288]
Length=343

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 111/174 (64%), Gaps = 1/174 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YHPAM  VA  RR+L I+TIFN LG +LNPA  P+ ++GV   +V+  MAKALQ  G++R
Sbjct  156  YHPAMAKVASQRRELGIRTIFNLLGPLLNPANAPYQLLGVSALSVLPTMAKALQLLGIQR  215

Query  573  ALV-VHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+V V  +GLDE+S  GP   + +  +++  F   P EFG  RC++ +++G  PE NA +
Sbjct  216  AIVMVGEDGLDEVSLSGPTQAILVNGDELIDFVITPEEFGFKRCSINEIKGGSPEENAHI  275

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLK  235
               +L GE GP  D  +LNAG AL  +   K++A+GI LA  +  SG+AL  L+
Sbjct  276  TLSILQGEKGPKRDIVLLNAGTALFATHKAKSIAEGIALATESLDSGRALEKLE  329



>gb|EWM24949.1| anthranilate phosphoribosyltransferase [Nannochloropsis gaditana]
Length=482

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 120/199 (60%), Gaps = 12/199 (6%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P  HP MK VAP+R+ L ++T FN +G +LN A    AVVGV+ E ++  +A  L   G
Sbjct  281  APVVHPTMKKVAPIRKALGVRTAFNIVGPLLNAAGAQHAVVGVFQERLLDVLAGTLGEIG  340

Query  582  -MKRALVVHSEGLDEMSPLGPGTVLD---ITPEKIEK------FAFDPLEFGIPRCTLKD  433
             + RAL++H  GLDE+SPLGP T+++   + P    +      + FDPL  GIPRC ++D
Sbjct  341  TVDRALIIHGVGLDEISPLGPSTIVELKNVAPAGQARVYERTSYTFDPLTCGIPRCAIED  400

Query  432  LQGAGPEYNADVLKRVLSG--ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRS  259
            L+G     NA +L++VLSG  E G   DA +LNA A L V G V +LA+G+ LA     S
Sbjct  401  LRGGDATENAALLRQVLSGGPERGAKRDAVVLNAAAGLYVYGSVPSLAEGVTLAYDILAS  460

Query  258  GKALHTLKFWIDVSNNVKE  202
            GKAL  L  WI  S  +K+
Sbjct  461  GKALVKLDEWIACSQALKK  479



>ref|WP_018591472.1| hypothetical protein [Terrisporobacter glycolicus]
Length=343

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 114/185 (62%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK+VAP+R++L I+T+FN LG + NPA     ++GVY+E++V  +AK L    +KR
Sbjct  154  YHNAMKLVAPIRKELEIRTVFNILGPLSNPASANMQLMGVYDESLVEPLAKVLSNLEVKR  213

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV   +GLDE+S   P  V ++   K+  +   P   G+ RC  KDL G  PE NA +
Sbjct  214  AMVVFGLDGLDEISLSSPTKVCEVNDGKLNSYTITPEGLGMNRCNKKDLVGCTPEDNAKI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
              ++L+GE GP  DA +LN+ AAL V+G  + L +GI  A     + KA + L  +I +S
Sbjct  274  AIQILNGEKGPKRDAVVLNSAAALYVAGKAENLQEGISQAERIIDTKKAKNQLDTFIMLS  333

Query  216  NNVKE  202
            NN+ E
Sbjct  334  NNLGE  338



>ref|WP_020491591.1| anthranilate phosphoribosyltransferase [Dehalobacter sp. FTH1]
Length=339

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 111/183 (61%), Gaps = 1/183 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++H +MK   PVR+ L  KTIFN LG + NPA  P  ++GVY+ N+V   A+ L R+ 
Sbjct  154  APHFHASMKYAMPVRKALGFKTIFNVLGPLANPAAAPRQLIGVYDRNLVPVAAEVLNRHQ  213

Query  582  MKRALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
               AL+VH S+GLDE++  GP    ++   ++ +F   P ++G   CT +DL G  P+ N
Sbjct  214  ADHALIVHGSDGLDEITLTGPTYAAELKDGEVTEFVIHPEDYGFCLCTPQDLVGGTPQEN  273

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +   +L+G+ GP AD  ILNAGAA+ V G   +L +GIE AR   R  KAL  L  +I
Sbjct  274  ARITLDILAGDQGPKADIVILNAGAAIYVGGKAASLQEGIETARAAVREKKALQVLNEFI  333

Query  225  DVS  217
             V+
Sbjct  334  AVT  336



>ref|WP_022777376.1| anthranilate phosphoribosyltransferase [Butyrivibrio sp. AE3009]
Length=338

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 115/182 (63%), Gaps = 1/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V P+R++L  +T+FN LG + NP +    ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGPIRKELGFRTVFNILGPLTNPGKPAMQLLGVYDEYLVEPLAQVLVSLGVKR  216

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+ +  LDE+S   P TV +I     + +   P +FG+ RC  K+L G  PE NA +
Sbjct  217  GMVVYGQDKLDEISLSAPTTVCEIKDGWYKVYTITPEDFGLTRCEKKNLLGGTPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +++L+GE GP  DA ++NAGA+L + G   + A+GI+LA     SGKA  TL  +I+VS
Sbjct  277  TRKILAGEKGPKRDAVLMNAGASLYIGGKAASFAEGIKLAAEIIDSGKATETLNKFIEVS  336

Query  216  NN  211
            N+
Sbjct  337  NS  338



>ref|WP_022856711.1| anthranilate phosphoribosyltransferase [Alloscardovia omnicolens]
Length=345

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 118/186 (63%), Gaps = 2/186 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AM+ V P+R++L I+T+FN LG + NPAR  + ++GVY+E +V  +A+ L + G++R
Sbjct  160  YHSAMRFVGPIRKELGIRTVFNILGPLTNPARPSYQLLGVYDEYLVEPLARVLSQLGVRR  219

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             LVV+  + +DE+S   P  V +I   +   +   P +FG+ RC+ +D++G  P+ NA +
Sbjct  220  GLVVYGKDKMDEISLSAPTAVCEIKDGEFTSYTIAPEDFGLVRCSKEDVEGGTPQENAQI  279

Query  396  LKRVLSGE-TGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
             + +L+GE TGP  D  +LNAGAAL ++    ++A GI+ AR    +G AL TL   + +
Sbjct  280  TRAILAGELTGPKLDVVLLNAGAALYINDKADSIADGIDQARTLISNGSALDTLNKAVAL  339

Query  219  SNNVKE  202
            SN  KE
Sbjct  340  SNEGKE  345



>ref|WP_028246671.1| anthranilate phosphoribosyltransferase [Pseudobutyrivibrio ruminis]
Length=357

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 116/184 (63%), Gaps = 1/184 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L  +T+FN LG + NPA     ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGAIRKELGFRTVFNILGPLTNPATPSMQLLGVYDEYLVEPLAQVLVSLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  + +I   ++  +   P +FG  RCT +DLQG  PE NA +
Sbjct  217  GMVVYGMDKLDEISLSAPTKICEIYNGELLTYTIKPEDFGFNRCTKEDLQGGTPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L+G  GP  DA +LNAGA+L + G  ++ ++GI+LA     SGKAL TL+ ++ VS
Sbjct  277  TREILNGAKGPKRDAVLLNAGASLFIGGKAESFSEGIKLAAEIIDSGKALETLEKFVLVS  336

Query  216  NNVK  205
            N +K
Sbjct  337  NEIK  340



>gb|EJK51401.1| hypothetical protein THAOC_29427 [Thalassiosira oceanica]
Length=356

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 114/198 (58%), Gaps = 13/198 (7%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P  HPAMK VAPVR++L ++T FN LG M N A    AV+GV++E ++  MA+ L+  G
Sbjct  155  APINHPAMKAVAPVRKQLGVRTCFNILGPMTNAASAQRAVIGVFHEELLELMAETLKEVG  214

Query  582  -MKRALVVHSEGLDEMSPLGPGTVLDITPE---------KIEKFAFDPLEFGIPRCTLKD  433
             +  A+V+H  GLDE+SPLGP T+++I               K+ FDP+   IPRC ++D
Sbjct  215  RVDHAVVIHGVGLDEISPLGPATIVEIKNTAPPGEPRVYTTTKYEFDPMSVNIPRCKVED  274

Query  432  LQGAGPEYNADVLKRVLSG---ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHR  262
            L+G  P  NA   + VL+G   ET    D+ +LNAG    V G   ++ +G  LA+ T  
Sbjct  275  LKGGDPAQNAKEFELVLTGGEYETNAKKDSIVLNAGVGCYVYGLSDSIEEGCALAKKTLV  334

Query  261  SGKALHTLKFWIDVSNNV  208
            SGKA   L  W  VS  +
Sbjct  335  SGKATEVLNEWRQVSKEI  352



>ref|WP_007044222.1| anthranilate phosphoribosyltransferase [Methanotorris formicicus]
 gb|EHP87375.1| anthranilate phosphoribosyltransferase [Methanotorris formicicus 
Mc-S-70]
Length=338

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 116/187 (62%), Gaps = 0/187 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH AMK   PVR+++ I+T+FN LG + NPA   + VVGVY+ N+  K+A+ L+  G
Sbjct  152  APLYHSAMKHALPVRKEIGIRTVFNVLGPLTNPANAEYQVVGVYDGNLTEKIAEVLKLLG  211

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +K A+VVH  G+DE++  G   + ++    ++ +   P EFG  R  + +L+G   + NA
Sbjct  212  LKGAMVVHGSGMDEITTTGETKISELKDGDVKTYTITPEEFGFKRANVDELKGGDAKENA  271

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +L+ +L G+ G   D  ++NA AAL V    K+L +GI++A  +  SGKA+  L+  ++
Sbjct  272  RILREILDGKEGAKRDIVLINAAAALYVCNEAKSLEEGIKMAEKSIDSGKAMEKLEKLVE  331

Query  222  VSNNVKE  202
             +NN+++
Sbjct  332  FTNNIQK  338



>ref|WP_022449488.1| anthranilate phosphoribosyltransferase [Roseburia sp. CAG:303]
 emb|CDE52798.1| anthranilate phosphoribosyltransferase [Roseburia sp. CAG:303]
Length=335

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 115/181 (64%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AM+ V  VR+++ I+TIFN LG + NPA     ++GVY+E++V  +A+ L   G+KR
Sbjct  154  YHTAMRFVGAVRKEMGIRTIFNILGPLANPAGANLQLLGVYSEDLVEPLARVLVNLGVKR  213

Query  573  ALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+  + +DE+S   P TV ++   + + +   P +FG  RC   +L G  P+ NA +
Sbjct  214  AMVVYGQDSIDEISMSAPTTVCEVRNGEYKSYVIQPEDFGFERCEKSELVGGTPQENAAI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +++L GE GP  DA ILNAGAA+ ++    T+ +GI +AR    SG+AL  L+ +I++S
Sbjct  274  ARQILGGEKGPKTDAVILNAGAAIHIAKENCTMEEGIRIARLALESGQALRQLEQFIELS  333

Query  216  N  214
            N
Sbjct  334  N  334



>ref|WP_026517738.1| anthranilate phosphoribosyltransferase [Butyrivibrio sp. MC2021]
Length=338

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 113/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L  +T+FN LG + NP +    ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGAIRKELGFRTVFNILGPLTNPGKPAMQLLGVYDEYLVQPLAQVLVSLGVKR  216

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+ +  LDE+S   P TV +I     + +   P +FG+ RC  KDL G  PE NA++
Sbjct  217  GMVVYGQDKLDEISLSAPTTVCEIKDGWYKVYTITPEDFGLTRCEKKDLVGGTPEENAEI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +++L+GE GP  DA ++NAGA+L + G  +T A G++LA     SGKA  TL   I+VS
Sbjct  277  TRKILAGEKGPKRDAVLMNAGASLYIGGKAETFAAGVKLAAEIIDSGKATETLNKLIEVS  336

Query  216  N  214
            N
Sbjct  337  N  337



>ref|WP_015042598.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Dehalobacter]
 gb|AFV01555.1| Anthranilate phosphoribosyltransferase [Dehalobacter sp. DCA]
 gb|AFV04591.1| Anthranilate phosphoribosyltransferase [Dehalobacter sp. CF]
 gb|EQB22273.1| Anthranilate phosphoribosyltransferase [Dehalobacter sp. UNSWDHB]
Length=339

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 114/185 (62%), Gaps = 1/185 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++H +MK   PVR+ L  KTIFN LG + NPA  P  ++GVY++++V   A+ L+R+ 
Sbjct  154  APHFHASMKYAMPVRKALGFKTIFNILGPLANPAAAPRQLIGVYDKSLVPVAAEVLKRHQ  213

Query  582  MKRALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
               A++VH S+GLDE++  GP    ++   K+ ++   P ++G   CT +DL G  P+ N
Sbjct  214  AVHAIIVHGSDGLDEITLTGPSYAAELKDGKVTEYVIHPGDYGFSLCTPQDLVGGTPQEN  273

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +   +L+G  GP AD  ILNAGAA+ V G   +L +GIE+AR T R  KAL  L  +I
Sbjct  274  ARITLDILAGGQGPKADTVILNAGAAIYVGGKAASLQEGIEMARATVREQKALPVLNEFI  333

Query  225  DVSNN  211
             V+  
Sbjct  334  AVTRQ  338



>ref|WP_026525919.1| anthranilate phosphoribosyltransferase [Butyrivibrio sp. MB2005]
Length=338

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 112/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V P+R++L  +T+FN LG + NPA     ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGPIRKELGFRTVFNILGPLTNPATPTMQLLGVYDEYLVEPLAQVLISLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  + ++     + +  +P +FG  +CT  DL+G  PE NA +
Sbjct  217  GMVVYGMDKLDEISLSAPTKICELKEGWYKTYTIEPEDFGFNKCTKDDLKGGTPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L G  GP  DA +LNAGA+L + G   +  +G+ELA  T  SGKAL TL+ +I VS
Sbjct  277  TREILGGAKGPKRDAVLLNAGASLYIGGKADSFKEGVELAAKTIDSGKALETLENFIKVS  336

Query  216  N  214
            N
Sbjct  337  N  337



>ref|WP_014867406.1| anthranilate phosphoribosyltransferase [Methanoculleus bourgensis]
 ref|YP_006545147.1| anthranilate phosphoribosyltransferase [Methanoculleus bourgensis 
MS2]
 emb|CCJ36431.1| anthranilate phosphoribosyltransferase [Methanoculleus bourgensis 
MS2]
Length=338

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 109/186 (59%), Gaps = 0/186 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM+     R+++ I+T+FN LG + NP RV   ++GVY+  + + +A+ L   G
Sbjct  153  APVYHPAMQHARSARQEIGIRTVFNLLGPLTNPGRVGAHLLGVYDPRLTAPVARVLGDLG  212

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             +RA+VVH  GLDE++  GP  V ++    I  +  D  EFGIPR     L+G GPE NA
Sbjct  213  ARRAMVVHGAGLDEIATTGPTVVAELRDGAIRTYTLDCTEFGIPRAPAAALRGGGPEENA  272

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             +L  VL+G+ GP  D  +LNAGAA+ + G    LA GI  A  +  SG AL  L+  I+
Sbjct  273  RILLSVLAGDGGPARDIVLLNAGAAVYIGGKTADLAGGIARAAESIDSGAALDRLQRLIE  332

Query  222  VSNNVK  205
            V+    
Sbjct  333  VAGGAS  338



>ref|WP_004593546.1| anthranilate phosphoribosyltransferase [Methanocaldococcus villosus]
 gb|ENN95706.1| anthranilate phosphoribosyltransferase [Methanocaldococcus villosus 
KIN24-T80]
Length=333

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 107/180 (59%), Gaps = 0/180 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAMK   PVRR ++I+T+FN LG + NPA   + ++GVY+E +V K+   L+   
Sbjct  150  APNYHPAMKYALPVRRDIKIRTVFNILGPLTNPANANYQLMGVYDEKLVDKLIYVLKNLN  209

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +K A+V H  G+DE++ +G   + +    +I+ +  +P +FG  +  L+DL G   E NA
Sbjct  210  LKGAIVAHGSGMDEITTVGKTKIAEFKDNEIKFYEIEPEQFGFKKAKLEDLMGGSAEENA  269

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
             ++K +L GE G   D  +LN+  AL + G  K + +GIE A     SGKAL  L+  ID
Sbjct  270  KIIKNILEGEEGAKRDIVVLNSAFALYICGEAKNVFEGIEKANKAIDSGKALKQLEKLID  329



>ref|XP_005535316.1| anthranilate phosphoribosyltransferase [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM79030.1| anthranilate phosphoribosyltransferase [Cyanidioschyzon merolae 
strain 10D]
Length=465

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 115/187 (61%), Gaps = 1/187 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HP +  VAP+RR LR++T+FN LG +LNPAR  + V+GV    ++  MA+A+ R G
Sbjct  279  APRFHPQLATVAPLRRSLRVRTVFNNLGPLLNPARSRYQVIGVAAPELMEPMAEAVARLG  338

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIE-KFAFDPLEFGIPRCTLKDLQGAGPEYN  406
             +R+ +VH  GLDEM+P+G   V+++  +    +F  +P   G+P CT++DL G     N
Sbjct  339  TERSWIVHCAGLDEMAPIGATEVIEVRKDVPPCRFRVEPETLGMPLCTVEDLVGDDCAAN  398

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A  +  +L G  GPI++A I+NAGA L+V G  +TL    ++A     SG A  TL+ W 
Sbjct  399  AATITSILQGAPGPISNAIIMNAGAGLVVYGLAETLQDACDMAANALMSGAAWETLEKWK  458

Query  225  DVSNNVK  205
             +S  ++
Sbjct  459  SLSRQLQ  465



>ref|WP_028077075.1| anthranilate phosphoribosyltransferase [Solirubrobacterales bacterium 
URHD0059]
Length=345

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 110/180 (61%), Gaps = 1/180 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +H A + V PVR++L ++TIFNFLG + NPA     VVGV + N +  +A AL R G
Sbjct  155  APRHHAATRFVIPVRKELAVRTIFNFLGPLTNPAGARRQVVGVSDPNAIEALAGALARLG  214

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
              RALVV S +GLDEMS   P  V+++  E++ ++   P E G+       + G  P  N
Sbjct  215  CDRALVVSSADGLDEMSTSAPTHVVEVNGEELRRYDVSPGEVGLTEAPAAAITGGDPAAN  274

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A V + V +G TGP AD  +LNAGAA+  +G V+ L +G+ELAR T  SG A  TL+ ++
Sbjct  275  AAVTRAVFAGATGPDADLVLLNAGAAIYAAGRVEDLREGVELARETIASGAAASTLEDYV  334



>ref|XP_008867256.1| anthranilate phosphoribosyltransferase, variant 3 [Aphanomyces 
invadans]
 gb|ETW04300.1| anthranilate phosphoribosyltransferase, variant 3 [Aphanomyces 
invadans]
Length=334

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 109/173 (63%), Gaps = 3/173 (2%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++HPAMK VAPVR+ + I+++FN LG ++NPA+   +V+GVY  +++    + L   G
Sbjct  151  APHFHPAMKHVAPVRKSMGIRSVFNVLGPLINPAKCQTSVIGVYTPSLLDLFGQVLHLMG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            ++ ALVVH  GLDE++P+G   ++++T +  +++   P E GIPRCTLKDL+G   + N 
Sbjct  211  VEHALVVHCAGLDELNPIGDAEIVEVTQQGCQRYTLTPEEIGIPRCTLKDLEGGDADENC  270

Query  402  DVLKRVLSGE---TGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGK  253
             +L++V  G       I +    NAGA L V G   T+  G E+A+   ++G+
Sbjct  271  RILRQVFQGGEHCENAIGNTIAYNAGAGLYVYGLANTIKHGYEVAKAALKAGE  323



>ref|WP_011006520.1| anthranilate phosphoribosyltransferase [Chlamydophila caviae]
 sp|Q822W6.1|TRPD_CHLCV RecName: Full=Anthranilate phosphoribosyltransferase [Chlamydophila 
caviae GPIC]
 gb|AAP05305.1| phosphoribosylanthranilate transferase [Chlamydophila caviae 
GPIC]
Length=343

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 108/187 (58%), Gaps = 1/187 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRY-  586
            +P YHP++K +AP+R+ ++  ++FN LG +LNPA   +A++GV NE ++  M++   ++ 
Sbjct  150  APIYHPSLKKLAPIRKGMKFPSVFNILGPLLNPANTEYALIGVSNEPILELMSEVCLKFK  209

Query  585  GMKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
              KR  + H  GLDE++ LG     DI   K  +   DP   G   C ++DL+G   + N
Sbjct  210  NTKRTFLFHGSGLDELTTLGKVVGYDIQQGKKTRLEIDPTSLGFNSCKIEDLKGGNSKLN  269

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +LK+   G+   IADA I NAGAA+ V G+  TL +GI  AR T   G+AL  L  W 
Sbjct  270  ACILKKAFMGQQSAIADALIFNAGAAMWVFGNAATLEEGIHSARKTLMEGEALRVLAQWA  329

Query  225  DVSNNVK  205
              S  +K
Sbjct  330  AFSQQLK  336



>ref|WP_009145722.1| anthranilate phosphoribosyltransferase [Phascolarctobacterium 
succinatutens]
 gb|EFY04662.1| anthranilate phosphoribosyltransferase [Phascolarctobacterium 
succinatutens YIT 12067]
Length=338

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 113/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V P+R++L I+T+FN LG + NP      ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGPIRKELGIRTVFNILGPLTNPGSPKMQLLGVYDEYLVQPLAQVLMNLGVKR  216

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+ +  LDE+S   P TV +     ++ +   P +FG+ RCT  DL G  PE NA +
Sbjct  217  GMVVYGQDRLDEISLSAPTTVCEFKDAWMKNYVIKPEDFGMERCTKADLVGGLPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L+G  GP  +A +LNAGA+L + G  ++ A G++LA     SGKAL TL+  I++S
Sbjct  277  TRDILAGAQGPKRNAVLLNAGASLYIGGKAESFADGVKLAAELIDSGKALQTLEKLIELS  336

Query  216  N  214
            N
Sbjct  337  N  337



>ref|WP_015791010.1| anthranilate phosphoribosyltransferase [Methanocaldococcus fervens]
 ref|YP_003127771.1| anthranilate phosphoribosyltransferase [Methanocaldococcus fervens 
AG86]
 gb|ACV24271.1| anthranilate phosphoribosyltransferase [Methanocaldococcus fervens 
AG86]
Length=336

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 112/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++HPAMK   PVRR+L I+T+FN LG + NPA   + ++GVY+E +  K+A  L+  G
Sbjct  151  APHFHPAMKYATPVRRELGIRTVFNVLGPLTNPANANYQLMGVYDEKLTEKLAYVLKNLG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +K ALVVH  G+DE++ +G   + ++    I  +  +P +FGI R  L+D++G  PE NA
Sbjct  211  LKGALVVHGSGMDEITTIGKTKISELRNGDIRNYYIEPEDFGIKRAKLEDIRGGSPEENA  270

Query  402  DVLKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
             +++ +  G E G   D  +LN+  AL ++   K + +GI+LA  +   GKAL  L+  I
Sbjct  271  KIIRDIFEGEEVGAKRDIVVLNSAFALYIAEEAKDVEEGIKLAEKSIDKGKALKKLEELI  330

Query  225  D  223
            +
Sbjct  331  E  331



>ref|WP_016279538.1| anthranilate phosphoribosyltransferase [Lachnospiraceae bacterium 
A4]
 gb|EOS35626.1| anthranilate phosphoribosyltransferase [Lachnospiraceae bacterium 
A4]
Length=336

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 113/182 (62%), Gaps = 2/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AM+ V PVR+ + ++T+FN LG + NPA+    ++GVY+E +V  +A  L   G+KR
Sbjct  154  YHAAMRFVGPVRKGIGLRTVFNILGPLSNPAQANAELMGVYSEELVEPLAHVLNNLGIKR  213

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            ALVV+ +  LDE+S   P T +++   K E++   P +FG  RC   +L G     NA +
Sbjct  214  ALVVYGQDRLDEISMSAPTTCVEVRDGKFERYVIIPEQFGFKRCQKSELTGGDGIENAKI  273

Query  396  LKRVLSGE-TGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
             +R+  GE T   ADA ILNAGA + + G    +A+G+E+AR T RSGKA  TL+ ++ +
Sbjct  274  TERIFKGECTDAKADAVILNAGAGIYLMGGASNIAQGVEIARETIRSGKAYETLQNFVRL  333

Query  219  SN  214
            +N
Sbjct  334  TN  335



>ref|WP_015733750.1| anthranilate phosphoribosyltransferase [Methanocaldococcus vulcanius]
 ref|YP_003248014.1| anthranilate phosphoribosyltransferase [Methanocaldococcus vulcanius 
M7]
 gb|ACX73532.1| anthranilate phosphoribosyltransferase [Methanocaldococcus vulcanius 
M7]
Length=336

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 111/181 (61%), Gaps = 1/181 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK   PVRR L I+T+FN LG + NPA   + ++GVY+E +  K+A  L+  G
Sbjct  151  APQFHPAMKYATPVRRDLGIRTVFNVLGPLTNPANANYQLMGVYDEKLTEKLANVLKNLG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +K ALVVH  G+DE++ +G   + ++   +I+ +  DP +FGI +  L +++G   E NA
Sbjct  211  LKGALVVHGSGMDEITTIGKTKISEMKNGEIKTYYIDPEDFGIKKAKLDEIKGGNSEENA  270

Query  402  DVLKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
             +++ +  G E G   D  +LN+  AL ++   K + +GI+LA  +  SGKAL  L+  I
Sbjct  271  KIIRGIFEGEEVGAKRDIVVLNSAFALYIADETKNVEEGIKLAEKSIDSGKALKKLEDLI  330

Query  225  D  223
            D
Sbjct  331  D  331



>ref|WP_021719556.1| anthranilate phosphoribosyltransferase [Phascolarctobacterium 
succinatutens]
 emb|CDD11377.1| anthranilate phosphoribosyltransferase [Phascolarctobacterium 
succinatutens CAG:287]
Length=338

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 112/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V P+R++L I+T+FN LG + NP      ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGPIRKELGIRTVFNILGPLTNPGSPKMQLLGVYDEYLVQPLAQVLMNLGVKR  216

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+ +  LDE+S   P TV +     ++ +   P +FG+ RCT  DL G  PE NA +
Sbjct  217  GMVVYGQDRLDEISLSAPTTVCEFKDGWMKNYVIKPEDFGMERCTKADLVGGLPEENAQI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L+G  GP  +A +LNAGA+L + G   + A G++LA     SGKAL TL+  I++S
Sbjct  277  TRDILAGAQGPKRNAVLLNAGASLYIGGKAASFADGVKLAAELIDSGKALQTLEKLIELS  336

Query  216  N  214
            N
Sbjct  337  N  337



>ref|XP_005780664.1| hypothetical protein EMIHUDRAFT_442980 [Emiliania huxleyi CCMP1516]
 gb|EOD28235.1| hypothetical protein EMIHUDRAFT_442980 [Emiliania huxleyi CCMP1516]
Length=344

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 108/180 (60%), Gaps = 1/180 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK + PVR+ L ++T+FN LG ++NPA     V+GVY  ++V+ +A+AL   G
Sbjct  149  APGFHPAMKNIVPVRKALGVRTVFNILGPLINPAACTRGVIGVYAPSLVALVAEALHALG  208

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             +  +VVH  GLDE++P+G  +V  +TP  +E    D    G   C++ DL+G     NA
Sbjct  209  AELIMVVHCCGLDELAPIGEASVATVTPAGVEYSTLDCTRLGFAVCSIDDLKGGDCVENA  268

Query  402  DVLKRVLSGET-GPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
              L++VLSG   GPIAD   LNAGA L V+G   TL  G +LA     +G  + TL  W+
Sbjct  269  ASLRKVLSGTLPGPIADTVALNAGAGLYVAGVAPTLQAGCKLASEAIAAGSPISTLDKWV  328



>ref|XP_005792526.1| hypothetical protein EMIHUDRAFT_439707 [Emiliania huxleyi CCMP1516]
 gb|EOD40097.1| hypothetical protein EMIHUDRAFT_439707 [Emiliania huxleyi CCMP1516]
Length=344

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 108/180 (60%), Gaps = 1/180 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK + PVR+ L ++T+FN LG ++NPA     V+GVY  ++V+ +A+AL   G
Sbjct  149  APGFHPAMKNIVPVRKALGVRTVFNILGPLINPAACTRGVIGVYAPSLVALVAEALHALG  208

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             +  +VVH  GLDE++P+G  +V  +TP  +E    D    G   C++ DL+G     NA
Sbjct  209  AELIMVVHCCGLDELAPIGEASVATVTPAGVEYSTLDCTRLGFAVCSIDDLKGGDCVENA  268

Query  402  DVLKRVLSGET-GPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
              L++VLSG   GPIAD   LNAGA L V+G   TL  G +LA     +G  + TL  W+
Sbjct  269  ASLRKVLSGTLPGPIADTVALNAGAGLYVAGVAPTLQAGCKLASEAIAAGSPISTLDKWV  328



>ref|WP_041668704.1| anthranilate phosphoribosyltransferase [Acetobacterium woodii]
Length=340

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 108/186 (58%), Gaps = 1/186 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH +MK   PVR++L I+TIFN LG + NPA     ++GVY+EN+V  +A  L +  
Sbjct  151  APTYHASMKYAGPVRKELGIRTIFNILGPLANPAGANMQLLGVYDENLVEPLANVLNKLK  210

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            +KR +VVH  +GLDE++     T+ +I   KI  F   P +FG+ RCTL DL G   + N
Sbjct  211  VKRGMVVHGHDGLDEITLTDTTTICEIADGKINSFFITPEQFGLKRCTLNDLIGGEKDEN  270

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A + + VL GE GP  D  +LN+   L +S H  TL   + LA+    SGKA   L  +I
Sbjct  271  AQIARSVLDGEHGPKRDVVVLNSAFCLYMSHHDMTLRDCVTLAQDLIDSGKAKQKLDDFI  330

Query  225  DVSNNV  208
              SN +
Sbjct  331  KRSNEI  336



>gb|AFA48816.1| anthranilate phosphoribosyltransferase TrpD [Acetobacterium woodii 
DSM 1030]
Length=343

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 108/186 (58%), Gaps = 1/186 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH +MK   PVR++L I+TIFN LG + NPA     ++GVY+EN+V  +A  L +  
Sbjct  154  APTYHASMKYAGPVRKELGIRTIFNILGPLANPAGANMQLLGVYDENLVEPLANVLNKLK  213

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            +KR +VVH  +GLDE++     T+ +I   KI  F   P +FG+ RCTL DL G   + N
Sbjct  214  VKRGMVVHGHDGLDEITLTDTTTICEIADGKINSFFITPEQFGLKRCTLNDLIGGEKDEN  273

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A + + VL GE GP  D  +LN+   L +S H  TL   + LA+    SGKA   L  +I
Sbjct  274  AQIARSVLDGEHGPKRDVVVLNSAFCLYMSHHDMTLRDCVTLAQDLIDSGKAKQKLDDFI  333

Query  225  DVSNNV  208
              SN +
Sbjct  334  KRSNEI  339



>emb|CCZ23595.1| anthranilate phosphoribosyltransferase [Coprobacillus sp. CAG:235]
Length=335

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 112/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVR++L I+T+FN LG + NPA   + V+GVY+E++V  +A+ L   G+KR
Sbjct  154  YHLAMKYVAPVRKELGIRTVFNILGPLTNPAGATYQVMGVYDESLVELLAQVLSNLGVKR  213

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+  +GLDE+S      V +I   + + +   P +FG+ RC   +L G  P+ NA +
Sbjct  214  AMVVYGRDGLDEISASNETFVCEINENQFKTYTISPEQFGLQRCLKDELVGGTPKENAQI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + VL+G+ G    A ++NAGA L + G V +L  GI+LA     SGKA   L+ +I  S
Sbjct  274  TRDVLNGKQGGSRTAVLMNAGAGLYIGGKVDSLQAGIDLAAELIDSGKANEKLEEFIKES  333

Query  216  N  214
            N
Sbjct  334  N  334



>gb|AHG04416.1| anthranilate phosphoribosyltransferase [Halobacterium sp. DL1]
Length=336

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 109/177 (62%), Gaps = 1/177 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK V   RR+L ++TIFN LG + NPA     VVGVY+ ++V  +A+AL    
Sbjct  150  APAFHPAMKAVIGPRRELEMRTIFNLLGPLTNPAGADAQVVGVYDPDLVPTLARALSHMD  209

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            + RALVVH +GLDE +  GP TV ++  + +E++   P +FG+    ++ + G  PE NA
Sbjct  210  VDRALVVHGDGLDEFALHGPSTVAEVDGDSVEEYTVTPADFGLDEAPIEAVSGGTPEENA  269

Query  402  DVLKRVLSGE-TGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLK  235
              L+ ++SG+ TGP  D  + NAGAA+ V+G   +L  G E AR    SG A  TL+
Sbjct  270  RDLRGIVSGDVTGPKRDIILANAGAAIYVAGEADSLEAGAERAREAIDSGDAAETLR  326



>ref|WP_026652928.1| anthranilate phosphoribosyltransferase [Butyrivibrio proteoclasticus]
Length=344

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 111/181 (61%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +RR+L  +T+FN LG + NPA     ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGAIRRELGFRTVFNILGPLTNPASPSMQLLGVYDEYLVEPLAQVLINLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  + +I     + +   P +FG   CT  DL+G  PE NA++
Sbjct  217  GMVVYGMDKLDEISMSAPTKICEIKDGWYKTYMIKPEDFGFKTCTKDDLKGGAPEENAEI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +++L G  GP  DA +LNAGA+L + G   ++A+GIE+A+    SG+A  TL+  I VS
Sbjct  277  TRQILKGAQGPKTDAVLLNAGASLYIGGKASSIAEGIEVAKEAIASGRAYETLEEIIKVS  336

Query  216  N  214
            N
Sbjct  337  N  337



>ref|WP_014424144.1| anthranilate phosphoribosyltransferase [Selenomonas ruminantium]
 dbj|BAL82707.1| putative anthranilate phosphoribosyltransferase [Selenomonas 
ruminantium subsp. lactilytica TAM6421]
Length=343

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 114/184 (62%), Gaps = 1/184 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L ++T+FN LG + NP      ++GVY+E +V+ +A  L   G+KR
Sbjct  157  YHASMKYVGAIRKELGVRTVFNILGPLTNPGSPTRQLLGVYDEYLVAPLAHVLSSLGVKR  216

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+ +  LDE+S   P  V +I    ++ +   P +FG+ RC   DL+G  P+ NA +
Sbjct  217  GMVVYGKNKLDEISLSAPTAVCEIRDGWVKAYTIKPEDFGMERCMKDDLKGGNPQENAAI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L GE G   +A +LNAGAAL ++G  +TLA GIELA     SGKA+ TL+  I+VS
Sbjct  277  TRSILQGEKGHKRNAVLLNAGAALYINGKAETLAGGIELAAELIDSGKAMQTLEKLIEVS  336

Query  216  NNVK  205
            N  +
Sbjct  337  NQAE  340



>ref|WP_013719039.1| anthranilate phosphoribosyltransferase [Methanosaeta concilii]
 ref|YP_004383808.1| anthranilate phosphoribosyltransferase [Methanosaeta concilii 
GP6]
 gb|AEB67990.1| anthranilate phosphoribosyltransferase [Methanosaeta concilii 
GP6]
Length=341

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 108/182 (59%), Gaps = 0/182 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK V PVRR L I+T+FN LG + NPA     V+GVY+ ++  K+A  LQ  G
Sbjct  150  APAFHPAMKRVGPVRRDLGIRTVFNILGPLTNPAGAKAQVMGVYDPSLCEKLACVLQILG  209

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             KRA+VV+ EG+DE++  G   V ++    ++ +   P + G P+    D+ G  P+ NA
Sbjct  210  AKRAMVVNGEGMDEITNTGETRVSELKDGSVKSYTLRPEDLGYPQAESADIAGGMPDENA  269

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
              L  VL GET    D  ++N+GAA+ VSG V T+ KG  +A     SG+AL TL+  + 
Sbjct  270  KRLVEVLKGETSAARDIIVINSGAAVYVSGLVSTMKKGASMAEDAIDSGEALKTLQRMVK  329

Query  222  VS  217
             S
Sbjct  330  AS  331



>gb|AIJ06409.1| anthranilate phosphoribosyltransferase [Methanocaldococcus sp. 
JH146]
Length=336

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 115/181 (64%), Gaps = 1/181 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++HPAMK   PVRR+L I+T+FN LG + NPA   + ++GVY+E +  K+A  L+  G
Sbjct  151  APHFHPAMKYATPVRRELGIRTVFNVLGPLTNPANANYQLMGVYDEKLTEKLAYVLKNLG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +K ALVVH  G+DE++ +G   + ++   +++ +  +P +FGI R  L+D++G   E NA
Sbjct  211  LKGALVVHGSGMDEITTIGKTKISELRNGEVKSYYIEPEDFGINRAKLEDIRGGDAEENA  270

Query  402  DVLKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
             +++ +  G E G   D  +LN+  AL ++   K + +GI+LA  +  SGKAL+ L+  I
Sbjct  271  KIIRAIFEGEEVGAKRDIVVLNSAFALYIAEEAKDVEEGIKLAEKSIDSGKALNKLEELI  330

Query  225  D  223
            +
Sbjct  331  E  331



>ref|WP_012981387.1| anthranilate phosphoribosyltransferase [Methanocaldococcus sp. 
FS406-22]
 ref|YP_003459224.1| anthranilate phosphoribosyltransferase [Methanocaldococcus sp. 
FS406-22]
 gb|ADC70488.1| anthranilate phosphoribosyltransferase [Methanocaldococcus sp. 
FS406-22]
Length=335

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 113/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPAMK   PVRR+L I+T+FN LG + NPA   + ++GVY+E +  K+A  L+  G
Sbjct  151  APNFHPAMKYATPVRRELGIRTVFNVLGPLTNPANANYQLMGVYDEALTEKLANVLKNLG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            ++ ALVVH  G+DE++ +G   + ++   +++ +  +P +FGI R  L+D++G   E NA
Sbjct  211  LRGALVVHGSGMDEITTIGKTKISELRNGEVKSYYIEPEDFGIKRAKLEDIKGGNAEENA  270

Query  402  DVLKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
             +++ +  G E G   D  +LNA  AL ++   K + +GI+LA  +  SGKAL  L+  I
Sbjct  271  KIIRNIFEGEEVGAKRDIVVLNAAYALYIAEEAKDVEEGIKLAEKSIDSGKALKKLEDLI  330

Query  225  D  223
            +
Sbjct  331  E  331



>gb|KDE55247.1| anthranilate phosphoribosyltransferase [Methanoculleus sp. MH98A]
Length=338

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 110/184 (60%), Gaps = 0/184 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM+     R+++ I+T+FN LG + NPA     ++GVY+  +   +A+ L   G
Sbjct  153  APAYHPAMQYARTARQEIGIRTVFNLLGPLTNPAGAGAHLLGVYDPRLTVPVARVLADLG  212

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             +RA+VVH  GLDE++  GP TV ++   ++  +  D  EFG+PR ++  L+G GPE NA
Sbjct  213  AERAMVVHGAGLDEIATAGPTTVAELRGGEVMTYTLDCTEFGVPRSSVAALRGGGPEENA  272

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
              L  VL+GE GP  D  +LNAGAA+ + G  + +A+GI  A  +  SG AL  L+   +
Sbjct  273  ATLLAVLAGEEGPARDIVLLNAGAAIYLGGKARDIARGIARAGVSIDSGAALDRLRRLAE  332

Query  222  VSNN  211
             +  
Sbjct  333  ATGG  336



>ref|WP_029506616.1| MULTISPECIES: anthranilate phosphoribosyltransferase [unclassified 
Lachnospiraceae]
Length=336

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 107/182 (59%), Gaps = 2/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AM+ V PVR++L I+T+FN LG + NPA     ++GVY++ +V  MAK LQ  G+KR
Sbjct  154  YHTAMRFVGPVRKELGIRTVFNILGPLTNPASANMQIMGVYSKELVEPMAKVLQNLGVKR  213

Query  573  ALVVHSE-GLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV  E GLDE++      V +I  +++E +   P +FG  RC   DL G   E NA +
Sbjct  214  GMVVFGEDGLDEITSSSDTYVCEIKGKELETYEISPEQFGYKRCKKSDLVGGTGEENAAI  273

Query  396  LKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
             K +L G E G   D   +N GAAL ++G  K+L KGI +A     SG+A   L+ ++  
Sbjct  274  TKAILDGREQGAKRDTVCMNVGAALYIAGKAKSLEKGIRMAEVLIDSGEAFQKLQEFVSA  333

Query  219  SN  214
            +N
Sbjct  334  TN  335



>ref|WP_018133252.1| hypothetical protein [Effusibacillus pohliae]
Length=341

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 117/189 (62%), Gaps = 2/189 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH +MK     RR+L  KT+FN LG + NPA     V+G ++  ++ KMA+ L   G
Sbjct  151  APLYHQSMKHAVGPRRELGFKTVFNILGPLTNPAGARRQVIGTFSGGLLEKMARVLHALG  210

Query  582  MKRALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
             +  +VVH S+GLDE++  GP  V ++   K+E +   P +FG+P   L+ + G GPE N
Sbjct  211  AEHVMVVHGSDGLDEITVTGPTQVAELKSGKVELYEIHPEQFGLPVYPLEAIVGGGPETN  270

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +++RVL+GETG   D  +LNA A+L V+G   +L +G++LA+    SG+A  T +  +
Sbjct  271  ALIVRRVLNGETGATRDIVVLNAAASLYVAGKTASLQEGVQLAQSLIDSGRARLTFERLV  330

Query  225  DVSNN-VKE  202
            +VSN  VKE
Sbjct  331  EVSNRFVKE  339



>ref|WP_031389016.1| anthranilate phosphoribosyltransferase [Clostridium sp. KNHs209]
Length=335

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 110/182 (60%), Gaps = 1/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVR++L I+T+FN LG + NPA     ++GVY+E +V  MAK L   G+K 
Sbjct  154  YHIAMKYVAPVRKELGIRTVFNILGPLSNPAGANMQLLGVYDEELVEPMAKVLANLGVKN  213

Query  573  ALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV   +GLDE+S   P TV ++   + +K+  +P +FG+ RC  ++L G  PE NA +
Sbjct  214  AMVVFGQDGLDEISMSSPTTVCEVRNNEFKKYTLEPEQFGMVRCKKEELLGGTPEENAQI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
               +L GE GP  DA +LN+ AAL V+    TL + +   R     G A   L+ +I +S
Sbjct  274  TLSILKGEKGPKRDAVVLNSAAALYVADSSLTLQEAVCKVREAIDDGSAFKQLERFISLS  333

Query  216  NN  211
            N+
Sbjct  334  NS  335



>ref|WP_022299939.1| anthranilate phosphoribosyltransferase 1 [Clostridium sp. CAG:964]
 emb|CDC83004.1| anthranilate phosphoribosyltransferase 1 [Clostridium sp. CAG:964]
Length=338

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 117/186 (63%), Gaps = 1/186 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH AMK  APVR+++  +TIFN LG + NPA     ++GVY++ +V  +A+ L+  G
Sbjct  151  APVYHGAMKYAAPVRKEMGARTIFNILGPLSNPASATIQLMGVYSQELVKPIAEVLKNLG  210

Query  582  MKRALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            +++ +VV+  +G+DE+S +   T  +I   +I +F  +P ++G   C   DL G  P+ N
Sbjct  211  VEKGMVVYGQDGIDEVSLVAKTTACEIKNGEITEFTINPEDYGFTMCKKDDLVGGNPQEN  270

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A++ +++L+GE G   D  +LN+G A+ ++G   ++AKGIE+A  T  SGKA   L+ ++
Sbjct  271  AEIARKILNGEKGAKRDVVLLNSGIAIYIAGKADSIAKGIEIAAQTIDSGKAKAKLEEFV  330

Query  225  DVSNNV  208
              +N V
Sbjct  331  KATNEV  336



>ref|WP_040196665.1| anthranilate phosphoribosyltransferase [Candidatus Soleaferrea 
massiliensis]
Length=339

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 112/186 (60%), Gaps = 1/186 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH +MK  APVR++L ++TIFN LG + NPA     ++GVY+EN+V  +A+ L   G
Sbjct  151  APAYHASMKYAAPVRKELGVRTIFNILGPLANPAGANLQLLGVYDENLVEPLARTLSNLG  210

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            +KRA+VV+  +GLDE++     TV ++   K+  F  DP +FG   CT  DL G  P+ N
Sbjct  211  VKRAMVVYGHDGLDEVTLCSSSTVCEVNDGKLNSFFLDPKQFGFSTCTPGDLVGGNPQEN  270

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A + + +L G  GP  D  +LNA   L ++    TL + ++LA  T  SGKA   L+ +I
Sbjct  271  AQIARDILDGMPGPKRDIVLLNAAVCLYMAYSNITLRECVKLAADTIDSGKAKRKLEQFI  330

Query  225  DVSNNV  208
             +SN V
Sbjct  331  RLSNEV  336



>ref|WP_013778687.1| anthranilate phosphoribosyltransferase [Tepidanaerobacter acetatoxydans]
 ref|YP_007272516.1| Anthranilate phosphoribosyltransferase [Tepidanaerobacter acetatoxydans 
Re1]
 gb|AEE91765.1| Anthranilate phosphoribosyltransferase [Tepidanaerobacter acetatoxydans 
Re1]
 emb|CCP26540.1| Anthranilate phosphoribosyltransferase [Tepidanaerobacter acetatoxydans 
Re1]
Length=335

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 107/181 (59%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V PVR++L I+TIFN LG + NPA     V+GVYNE++V  +A  L   G+KR
Sbjct  154  YHTSMKYVGPVRKELGIRTIFNILGPLTNPASANMQVLGVYNESLVEPLAHVLSNLGVKR  213

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+ +  LDE+S   P TV + T +   K+  +P +FG  R    +L G  P  NA +
Sbjct  214  GMVVYGQDKLDEISISAPTTVCEFTEKNFNKYVIEPEDFGFKRSNKNELTGGMPRENAKI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
               +LSG  GP  +A +LNAGA L ++G   + AKG+ LA     SGKA   L  +I+ S
Sbjct  274  TLEILSGAKGPKREAVLLNAGAGLYIAGKTDSHAKGVILAEELIESGKAKAKLDQFIEQS  333

Query  216  N  214
            N
Sbjct  334  N  334



>ref|WP_013485217.1| anthranilate phosphoribosyltransferase [Ethanoligenens harbinense]
 gb|ADU26862.1| anthranilate phosphoribosyltransferase [Ethanoligenens harbinense 
YUAN-3]
Length=337

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 113/183 (62%), Gaps = 1/183 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            +H +MK  A  RR+L I+TIFN LG + NPAR    ++GVY+  +   +A+ L   G++R
Sbjct  154  FHGSMKYAAGPRRELGIRTIFNILGPLANPARANLQLLGVYDAALCQPLAQVLANLGVRR  213

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+  +GLDE+S  G   V ++  +++  +   P +FG+  C L+DL+G   + NA +
Sbjct  214  AMVVYGLDGLDEVSLCGQTQVSELIDQRVSNYLLSPEDFGLTPCALEDLRGGDAQENAQI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +LSGETGP  D  +LN+ AAL ++G    L  G+E+AR    SGKA   L+  + VS
Sbjct  274  ARNILSGETGPKRDMVLLNSAAALYMAGKADGLKAGVEMARELIDSGKAAEKLEELVRVS  333

Query  216  NNV  208
            N++
Sbjct  334  NSI  336



>ref|WP_040598214.1| anthranilate phosphoribosyltransferase, partial [Patulibacter 
medicamentivorans]
Length=341

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 103/161 (64%), Gaps = 1/161 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +H A + V PVR++L ++T+FN LG + +PA  P  V+GV   +V+ +MA A+ R G
Sbjct  155  APRHHAATRYVIPVRKELAVRTVFNVLGPLTSPAGAPRQVIGVGYPDVIERMADAVHRLG  214

Query  582  MKRALVVHSE-GLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
             +RAL+V SE GLDE+S   P TVLD+TP+ +      P E G+    L  ++GA P  N
Sbjct  215  TERALLVRSEDGLDEISIAAPTTVLDVTPDGVRTLTVTPAELGVTSYPLDAVRGATPAEN  274

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIE  283
            ADV +RVL+ E GP  +  + NAGA +LV G   TLA+G+E
Sbjct  275  ADVTRRVLADEAGPALELVVANAGAGILVGGGAATLAEGVE  315



>ref|WP_027438851.1| anthranilate phosphoribosyltransferase [Lachnospira multipara]
Length=347

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 109/185 (59%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L  +T+FN LG + NPA   + ++GVY+E +V  +AK L   G+KR
Sbjct  157  YHTSMKYVGAIRKELGFRTVFNILGPLTNPASPKYQILGVYDEYLVEPLAKVLINLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  V +I     + +   P EFG+  CT  DL+G  PE NA +
Sbjct  217  GMVVYGMDKLDEISMSAPTKVCEIRDGWYKTYTITPEEFGLNSCTKDDLKGGTPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             K +LSG+ G   DA +LNAGAA+ V G   +  +G+ LA     SGKAL  L   I +S
Sbjct  277  TKEILSGKKGHKRDAVLLNAGAAIYVGGKADSFKEGVNLAAQIIDSGKALEVLDNMIRIS  336

Query  216  NNVKE  202
            N V +
Sbjct  337  NEVDD  341



>ref|WP_035599936.1| anthranilate phosphoribosyltransferase [Hyphomonas polymorpha]
 gb|KCZ97714.1| anthranilate phosphoribosyltransferase [Hyphomonas polymorpha 
PS728]
Length=341

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 106/180 (59%), Gaps = 1/180 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AM+ VAP+R+KL I+TIFN LG + NPA   ++V+GVY+   V+ MA+AL+  G +R
Sbjct  158  YHSAMRHVAPIRQKLGIRTIFNLLGPLSNPAGAEYSVLGVYDRQWVTPMAEALKALGTRR  217

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A VVH   G+DE+S  GP  V ++TPE +  F   P + G+P   +  ++G  PE NA  
Sbjct  218  AWVVHGLAGIDEISISGPTEVCEVTPESVRHFQLTPCDAGLPVHPISAIEGGAPEENAAA  277

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
            ++ +L G  GP  D  + NA A LLVSG V  L  G+  A     SG A  TL   +  S
Sbjct  278  IRDLLDGREGPFRDIVLFNAAAGLLVSGLVPDLPAGVARAAEAIDSGAARETLDKLVRTS  337



>ref|WP_031558137.1| anthranilate phosphoribosyltransferase [Lachnospira multipara]
Length=347

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 109/185 (59%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L  +T+FN LG + NPA   + ++GVY+E +V  +AK L   G+KR
Sbjct  157  YHTSMKYVGAIRKELGFRTVFNILGPLTNPASPKYQILGVYDEYLVEPLAKVLINLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  V +I     + +   P EFG+  CT  DL+G  PE NA +
Sbjct  217  GMVVYGMDKLDEISMSAPTKVCEIRDGWYKTYTITPEEFGLNSCTKDDLKGGTPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             K +LSG+ G   DA +LNAGAA+ V G   +  +G+ LA     SGKAL  L   I +S
Sbjct  277  TKEILSGKKGHKRDAVLLNAGAAIYVGGKADSFKEGVNLAAQIIDSGKALEVLDNMIRIS  336

Query  216  NNVKE  202
            N V +
Sbjct  337  NEVDD  341



>ref|WP_010253936.1| anthranilate phosphoribosyltransferase [Treponema primitia]
Length=343

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 117/186 (63%), Gaps = 1/186 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK VAPVR++L I+TIFN LG ++NPA     ++GVY++ +   MA+ L   G+K 
Sbjct  154  YHLSMKYVAPVRKELGIRTIFNILGPLVNPAGANMELLGVYDQELTEPMARVLSNLGVKS  213

Query  573  ALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            ALVV+  +GLDE+S   P +V ++       +  +P +FG  RC  +DL G  P  NA +
Sbjct  214  ALVVYGQDGLDEISMSAPTSVCEVRDGVFRSYVIEPEQFGFRRCNKEDLVGGTPAENAAI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +LSGE GP  DA +LN+ AA+ ++    ++A  I +A+ T  SGKAL+ L+ +I++S
Sbjct  274  SRAILSGEKGPKRDAVLLNSAAAIHIAKPEFSIADAIGIAKETIDSGKALNQLEQFINLS  333

Query  216  NNVKEP  199
              V+ P
Sbjct  334  KAVEVP  339



>ref|WP_022203837.1| anthranilate phosphoribosyltransferase [Eubacterium sp. CAG:248]
 emb|CDB66406.1| anthranilate phosphoribosyltransferase [Eubacterium sp. CAG:248]
Length=338

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 111/181 (61%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L ++T+FN LG + NP      ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGAIRKELGVRTVFNILGPLTNPGSPSMQLLGVYDEYLVEPLAQVLVSLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  V +I    ++ +   P +FG+ RCT  DL G  PE NA +
Sbjct  217  GMVVYGMDKLDEISMSAPTKVCEIRDGWMKSYVIKPEDFGLMRCTKDDLNGGAPEDNARI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L+GE GP  DA ++NAGA+L + G   +LA GI+LA     SGKA   L  +I+VS
Sbjct  277  TRAILNGEKGPKRDAVLMNAGASLYIGGKADSLADGIKLAAELIDSGKADKVLDKFIEVS  336

Query  216  N  214
            N
Sbjct  337  N  337



>ref|WP_011842929.1| anthranilate phosphoribosyltransferase [Methanoculleus marisnigri]
 ref|YP_001045990.1| anthranilate phosphoribosyltransferase [Methanoculleus marisnigri 
JR1]
 sp|A3CRK8.1|TRPD_METMJ RecName: Full=Anthranilate phosphoribosyltransferase [Methanoculleus 
marisnigri JR1]
 gb|ABN56008.1| anthranilate phosphoribosyltransferase [Methanoculleus marisnigri 
JR1]
Length=338

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 109/184 (59%), Gaps = 0/184 (0%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM+     R+++ I+T+FN LG + NPA     ++GVY+  +   +A+ L   G
Sbjct  153  APAYHPAMQYARIARQEIGIRTVFNLLGPLTNPAGAGAHLLGVYDPCLTLPVARVLGDLG  212

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
             +RA+VVH  GLDE++  GP TV ++   ++  +  D  EFG+PR ++  L+G GPE NA
Sbjct  213  AERAMVVHGAGLDEIATAGPTTVAELRGGEVTTYTLDCTEFGVPRSSVAALRGGGPEENA  272

Query  402  DVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWID  223
              L  VL+GE GP  D  +LNAGAA+ + G    +A GI  A  +  SG AL  L+  ++
Sbjct  273  ATLLAVLAGEEGPARDIVLLNAGAAIYLGGKADGIAGGIAHAEASLDSGAALDRLRRLVE  332

Query  222  VSNN  211
             +  
Sbjct  333  ATGG  336



>ref|WP_026510516.1| anthranilate phosphoribosyltransferase [Butyrivibrio sp. LC3010]
Length=344

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 110/185 (59%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L  +T+FN LG + NP      ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGAIRKELGFRTVFNILGPLTNPGSPTMQLLGVYDEYLVEPLAQVLINLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  + +I     + +   P EFG  RCT  DL+G  PE NA++
Sbjct  217  GMVVYGMDKLDEISMSAPTKICEIKDGWYKCYTITPEEFGFERCTKDDLKGGSPEENAEI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +++L GE G   +A +LNAGA+L + G   +   GIELA     SGKAL TL+  I+VS
Sbjct  277  TRKILGGEKGHKRNAVLLNAGASLYIGGKADSFKDGIELAAEIIDSGKALDTLEKLIEVS  336

Query  216  NNVKE  202
            N   E
Sbjct  337  NREAE  341



>ref|WP_008789151.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Coprobacillus]
 gb|EFW04645.1| anthranilate phosphoribosyltransferase [Coprobacillus sp. 29_1]
Length=337

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 108/181 (60%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVR++L I+T+FN LG + NPA     ++GVY+E +V  +A+ L   G+KR
Sbjct  154  YHIAMKYVAPVRKELGIRTVFNILGPLTNPAGASMQIMGVYDETLVEPLARVLNNLGVKR  213

Query  573  ALVVHSE-GLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+ E GLDE+S      + +I       +   P +FG  RC  ++L G  P+ NA +
Sbjct  214  AMVVYGEDGLDEISLSSSTQICEIHDGHYTCYKITPEQFGFERCLKEELVGGTPQENAKI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
               +L G+ GP  DA ++NAGAA+ + G  + L +GI +AR     GKAL  L+ +I  S
Sbjct  274  TLDILKGQKGPKRDAVLMNAGAAIYIGGKAQDLQEGIAIARQMIDEGKALKKLEDFIQAS  333

Query  216  N  214
             
Sbjct  334  Q  334



>gb|EHN12339.1| Anthranilate phosphoribosyltransferase [Patulibacter medicamentivorans]
Length=366

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 103/161 (64%), Gaps = 1/161 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +H A + V PVR++L ++T+FN LG + +PA  P  V+GV   +V+ +MA A+ R G
Sbjct  155  APRHHAATRYVIPVRKELAVRTVFNVLGPLTSPAGAPRQVIGVGYPDVIERMADAVHRLG  214

Query  582  MKRALVVHSE-GLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
             +RAL+V SE GLDE+S   P TVLD+TP+ +      P E G+    L  ++GA P  N
Sbjct  215  TERALLVRSEDGLDEISIAAPTTVLDVTPDGVRTLTVTPAELGVTSYPLDAVRGATPAEN  274

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIE  283
            ADV +RVL+ E GP  +  + NAGA +LV G   TLA+G+E
Sbjct  275  ADVTRRVLADEAGPALELVVANAGAGILVGGGAATLAEGVE  315



>ref|WP_022067441.1| anthranilate phosphoribosyltransferase [Blautia sp. CAG:257]
 emb|CDA06863.1| anthranilate phosphoribosyltransferase [Blautia sp. CAG:257]
Length=343

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 111/184 (60%), Gaps = 1/184 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L  +T+FN LG + NP      ++GVY+E +V  +A+ L   G++R
Sbjct  157  YHTSMKYVGAIRKELGFRTVFNILGPLTNPGTPSLQLLGVYDEYLVEPLAQVLISLGIRR  216

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+ +  LDE+S   P TV +I           P EFG  RCT +D++G  PE NA++
Sbjct  217  GMVVYGQDRLDEISMSAPTTVCEIRDGWFRTSVITPEEFGFTRCTKEDMKGGTPEENAEI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
               VL+GE G   DA +LNAGAAL + G  +++ +GI LA     SGKAL TL+  I+VS
Sbjct  277  TLSVLNGEKGAKRDAVLLNAGAALYIGGKAESIKEGIILAAEIIDSGKALTTLRRLIEVS  336

Query  216  NNVK  205
            N  +
Sbjct  337  NRTE  340



>ref|WP_010869732.1| anthranilate phosphoribosyltransferase [Methanocaldococcus jannaschii]
 ref|NP_247205.1| anthranilate synthase component II TrpD [Methanocaldococcus jannaschii 
DSM 2661]
 sp|Q57686.1|TRPD_METJA RecName: Full=Anthranilate phosphoribosyltransferase [Methanocaldococcus 
jannaschii DSM 2661]
 gb|AAB98221.1| anthranilate synthase component II (trpD) [Methanocaldococcus 
jannaschii DSM 2661]
Length=336

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 112/181 (62%), Gaps = 1/181 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P++HPAMK   PVR++L I+T+FN LG + NPA   + ++GVY+E +  K+A  L+  G
Sbjct  151  APHFHPAMKFATPVRKELGIRTVFNVLGPLTNPANANYQLMGVYDEKLTEKLANVLKNLG  210

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +K ALVVH  G+DE++ +G   + ++   +I+ +  +P +FGI +  L+D++G   E NA
Sbjct  211  LKGALVVHGSGMDEITTIGKTKISELRNGEIKSYYIEPEDFGIKKAKLEDIRGGDAEENA  270

Query  402  DVLKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
             ++  +  G E G   D  +LNA  AL ++   K + +GI+LA  +   GKAL  L+  I
Sbjct  271  KIIGEIFEGEEVGAKRDIVVLNAAFALYIAEEAKDVEEGIKLAEKSIDEGKALKKLEDLI  330

Query  225  D  223
            +
Sbjct  331  E  331



>ref|WP_027439836.1| anthranilate phosphoribosyltransferase [Lachnospiraceae bacterium 
AC2031]
Length=339

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 112/182 (62%), Gaps = 2/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V P+R++L  +T+FN LG + NP++    ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGPIRKELGFRTVFNILGPLTNPSKPTLMLLGVYDEYLVEPLAQVLADLGVKR  216

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV  +  LDE+S   P T+ +I     +     P EFG   C  +DL G  P  NA +
Sbjct  217  GMVVFGQDKLDEISLSSPTTICEIKDGWYKTRVICPEEFGFKTCKKEDLVGGDPAENAAI  276

Query  396  LKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
             + +LSG ETGP  DA +LNAGAAL + G   ++  GIELA+    SGKA+ TL+ +I+V
Sbjct  277  TRSILSGEETGPKRDATLLNAGAALYIGGKADSMEAGIELAKEIIASGKAVETLEKFIEV  336

Query  219  SN  214
            SN
Sbjct  337  SN  338



>ref|WP_007391016.1| anthranilate phosphoribosyltransferase [Megasphaera sp. UPII 
199-6]
 gb|EGL40686.1| anthranilate phosphoribosyltransferase [Megasphaera sp. UPII 
199-6]
Length=341

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 109/185 (59%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK V PVRR+L I T+FN LG + NPA     V+GVY+E +V  +A+ L   G+ R
Sbjct  154  YHQAMKYVGPVRRELGIPTVFNILGPLTNPAHAELQVLGVYDEALVEPLAQVLHALGVVR  213

Query  573  ALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VVH ++GLDE+SP  P  + +    +   +   P E  +P    ++L+G  PE NA +
Sbjct  214  GMVVHGTDGLDEISPSAPTKICEFAGSQFHTYILRPEEVHVPCGKKEELKGGSPEKNAAM  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
            L+ VL+GE+G    A +LNAGAAL V+    T+  G+ LA      GKAL TL+  I   
Sbjct  274  LRAVLAGESGTCRTAVLLNAGAALYVAQKAPTIEAGVRLAARLIDEGKALQTLQRVIQTG  333

Query  216  NNVKE  202
             +++E
Sbjct  334  RDLRE  338



>ref|WP_016369788.1| anthranilate phosphoribosyltransferase, partial [Lactobacillus 
paracasei]
 gb|EPC51227.1| anthranilate phosphoribosyltransferase, partial [Lactobacillus 
paracasei subsp. paracasei CNCM I-4270]
Length=207

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK VAPVR++L  +TIFN LG + NPA     ++GVY+E ++  +A  L++ G+  
Sbjct  20   YHKSMKYVAPVRKQLGFRTIFNILGPLANPAHPTHQLLGVYDETLLEPLANVLKKLGVTN  79

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VVH  +GLDEM+      V+++    + K+   P +FG+ R    DL G  PE NAD+
Sbjct  80   AMVVHGRDGLDEMTTADETAVVELHDGHLTKYTVTPEQFGLKRRQRADLVGGTPEANADI  139

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +R+L+G+ GP  D  +LNAGAAL V+    ++  GI+LA  T   GKA   L   +  S
Sbjct  140  TRRILAGDHGPQRDIVLLNAGAALHVAHPALSIQAGIDLAAKTIDDGKAFEELNRLLAFS  199

Query  216  NNVKE  202
            +  K+
Sbjct  200  DKRKD  204



>ref|WP_042688679.1| anthranilate phosphoribosyltransferase [Methanolinea tarda]
Length=339

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 110/172 (64%), Gaps = 1/172 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +HPA + VA VRR++   T+FN LG +LNPAR P  +VGV++  ++S +A AL+  G
Sbjct  153  APLFHPAFRHVAGVRREMGCHTVFNILGPLLNPARAPARLVGVFSPALLSPVAGALRILG  212

Query  582  MKRALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNA  403
            +++ALVVH  GLDE++  G   V ++    I+++A  P EFGIP   L+D+ G+G E NA
Sbjct  213  VRKALVVHGSGLDEITVSGETRVAELKGTSIDEYAISPREFGIPEYPLRDICGSGVEENA  272

Query  402  DVLKRVLSGE-TGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKA  250
             +++ +L G+ TG   D   +NAGAAL   G VK +  GIELA     +G A
Sbjct  273  SIIRGILHGQITGAARDVVAMNAGAALYAGGKVKEIGDGIELAMDAIATGSA  324



>ref|WP_022004562.1| anthranilate phosphoribosyltransferase [Firmicutes bacterium 
CAG:194]
 emb|CCZ28840.1| anthranilate phosphoribosyltransferase [Firmicutes bacterium 
CAG:194]
Length=335

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 108/181 (60%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK V  +R++L I+TIFN LG + NPA     V+GVY+E++V  +AK L   G+KR
Sbjct  154  YHTAMKYVGSIRKELGIRTIFNILGPLANPASANLQVMGVYDESLVEPLAKVLSNLGVKR  213

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            ALVV+ +  LDE+S     +V ++     + +   P +FG+ RC  ++L G  P+ NA +
Sbjct  214  ALVVYGQDRLDEISASAETSVCEVKDGTFKSYTISPEQFGLTRCKKEELTGGTPDENAAI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             K VL+GE G    A +LNAGA L V+G   ++  G+ LA     SGKA   L+ ++  S
Sbjct  274  TKAVLAGEQGARRTAVVLNAGAGLYVAGKADSIEAGVRLAEELIDSGKAEKKLEEFVKYS  333

Query  216  N  214
            N
Sbjct  334  N  334



>ref|XP_009040395.1| hypothetical protein AURANDRAFT_31792 [Aureococcus anophagefferens]
 gb|EGB04838.1| hypothetical protein AURANDRAFT_31792 [Aureococcus anophagefferens]
Length=397

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 109/197 (55%), Gaps = 18/197 (9%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P  HPAM+ VAPVR+ L ++T FN LG + N A     V+GV++E +V  +  AL+R G
Sbjct  194  APKNHPAMRFVAPVRKALGVRTAFNLLGPLTNAASAQRVVIGVFDEALVELLGAALERIG  253

Query  582  -MKRALVVHSEGLDEMSPLGPGTVLDITPE----KIEKFAFDPLEFGIPRCTLKDLQGAG  418
             +  A+V+H  GLDE+SPLGP TV ++  +        +  DPL++G+PRCTL DL G G
Sbjct  254  VVDHAVVIHGVGLDELSPLGPCTVKELKRDGDGYASSTWTLDPLDYGMPRCTLADLVGGG  313

Query  417  PEYNADVLKRVLSGETGPIA-------------DAFILNAGAALLVSGHVKTLAKGIELA  277
            P++N   L+R L+ +   I              DA  LNAG  L V G    L  GI LA
Sbjct  314  PDFNQRALRRCLAADPASIPLGEETTLDDAACRDAIALNAGMGLYVYGAAPDLKAGIALA  373

Query  276  RCTHRSGKALHTLKFWI  226
            +    SG  L  L  WI
Sbjct  374  KDGLASGAGLAKLDAWI  390



>ref|WP_035453620.1| anthranilate phosphoribosyltransferase [Lactobacillus composti]
 dbj|GAF40491.1| anthranilate phosphoribosyltransferase [Lactobacillus composti 
DSM 18527 = JCM 14202]
Length=341

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 109/185 (59%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +M+ VAPVR+ L  +TIFN LG + NPA     + GVYN N++  MA+ L + G+ R
Sbjct  154  YHKSMRFVAPVRKALGFRTIFNILGPLANPAHPQMQLFGVYNANLLEPMAEVLNKLGVAR  213

Query  573  ALVVHSE-GLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A++VHSE GLDE++      V+++   KI  +   P E G  R   +DL G  P  NA +
Sbjct  214  AMIVHSEDGLDELTTTAANQVVELNQGKITHYTLTPEELGFKRAKHEDLVGGTPAENAAI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + VL     P  DA +LNAGAAL ++    T+A+GI+LAR T  +GKA   L   ++ S
Sbjct  274  TREVLKNVQSPRLDAVLLNAGAALHLAKPELTIAQGIDLARQTIATGKAQAQLTKLVNFS  333

Query  216  NNVKE  202
             N ++
Sbjct  334  QNAED  338



>ref|WP_022085658.1| anthranilate phosphoribosyltransferase [Roseburia sp. CAG:197]
 emb|CDA24145.1| anthranilate phosphoribosyltransferase [Roseburia sp. CAG:197]
Length=336

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 113/185 (61%), Gaps = 2/185 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P+++PAMK V PVR ++ I+T+FN LG + NP+R    VVGVY+ ++   +A A+   G
Sbjct  151  APHFNPAMKYVGPVRNEMGIRTVFNTLGPLSNPSRAKAMVVGVYSPSLTEVIAGAMVNLG  210

Query  582  MKRALVVHSE-GLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            ++R  VV  E  +DE +  GP  V +I   K+E +   P +FG+ RC +++LQG     N
Sbjct  211  VERGFVVSGEDNMDEFTLTGPSIVSEIKDGKVETYEITPEQFGLKRCKIEELQGGDGAVN  270

Query  405  ADVLKRVLSG-ETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFW  229
            A + K +LSG E G   +  +LNAGAAL + G   ++ +GI +A  T  SGKA+ TL+  
Sbjct  271  AQITKDILSGKERGAKREIVLLNAGAALYIGGKADSIEEGIRIAGETIDSGKAMETLESM  330

Query  228  IDVSN  214
            +  +N
Sbjct  331  VKTTN  335



>ref|WP_004618449.1| anthranilate phosphoribosyltransferase [[Clostridium] papyrosolvens]
 gb|EGD48334.1| anthranilate phosphoribosyltransferase [ [[Clostridium] papyrosolvens 
DSM 2782]
Length=341

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 111/188 (59%), Gaps = 1/188 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH +MK  APVR++L ++TIFN LG + NPA     ++GVY+EN+V  +A+ L   G
Sbjct  151  APTYHASMKYAAPVRKELSVRTIFNILGPLANPAGANMQLLGVYDENLVEPLARVLLNLG  210

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            +KRA+VVH  +GLDE++     T+ +++   I  F   P + G  RC LKDL G  P+ N
Sbjct  211  VKRAMVVHGHDGLDEVTLCNTTTICEVSNGSINSFFLSPEQLGFSRCALKDLVGGDPKEN  270

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +   +L+G  GP  D  +LN+   L +S +  TL   +++A     SG A   L  +I
Sbjct  271  ASIALEILNGSKGPKRDIVVLNSALCLYMSYNQTTLRDCVKMAEQLIDSGAAKTQLDKFI  330

Query  225  DVSNNVKE  202
            ++SN+  +
Sbjct  331  ELSNSFNQ  338



>ref|WP_009256452.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Clostridiales]
 gb|EGN46623.1| anthranilate phosphoribosyltransferase [Lachnospiraceae bacterium 
3_1_57FAA_CT1]
Length=335

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 111/182 (61%), Gaps = 1/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AM+ V PVRR+L I+TIFN LG + NPA     V+GVY+E +V  +A+ L   G+KR
Sbjct  154  YHTAMRYVGPVRRELGIRTIFNILGPLANPAGANMEVMGVYDETLVEPLARVLVNLGVKR  213

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+  + LDE+S      V ++     + +  +P +FG  +C  K+L+G  PE NA +
Sbjct  214  AMVVYGMDKLDEISMSAKTYVCEVKDGDYKTYYLEPEQFGFVKCDKKELEGGTPEENAAI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
               +L GE GP  DA +LN+GAAL ++G  +++  G+ +A     SG+A   L+ +I  S
Sbjct  274  TLSILEGEKGPRRDAVVLNSGAALYIAGKAESMEAGVRMAEDIISSGRAKKKLEEFIACS  333

Query  216  NN  211
            N+
Sbjct  334  NS  335



>ref|WP_031516208.1| anthranilate phosphoribosyltransferase [Desulfotomaculum alkaliphilum]
Length=345

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 112/186 (60%), Gaps = 1/186 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P  H AMK  A  R+++ I+T+FN LG + NPA+    V+GVY  ++V KMA+AL R G
Sbjct  152  APNLHGAMKHAAQTRKEIGIRTVFNILGPLTNPAKAQTQVLGVYAADLVEKMAQALVRLG  211

Query  582  MKRALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
              RA V+H + GLDE+SP+G   + ++   ++ ++  DP E+G     ++DL G   E N
Sbjct  212  STRAFVLHGAGGLDEISPVGLAHICEVRAGEVHRYTIDPAEYGFAPAKVEDLAGGDAEEN  271

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A + K +L+G TGP  DA +LNA   L+ SG V  L  GI +A+    SG A+  L+  +
Sbjct  272  ARITKEILAGATGPKRDAVVLNAALGLICSGIVSNLKDGIAVAQRAIDSGAAIKKLEQLV  331

Query  225  DVSNNV  208
             V++ +
Sbjct  332  KVTSTM  337



>gb|KGA10287.1| anthranilate phosphoribosyltransferase [actinobacterium acAcidi]
Length=361

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 109/180 (61%), Gaps = 0/180 (0%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YHPA +  AP RR++ + T+FN LG M NP RV   ++GV N  V  +M  +L+ +G K 
Sbjct  174  YHPAFRFAAPSRREIGVPTVFNLLGPMANPGRVKRQLIGVANPMVAERMLASLRLHGSKS  233

Query  573  ALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADVL  394
            + VVH  GLDE++  GP TVL++   ++  F+ DP+  G+     ++L G  P +NADV+
Sbjct  234  SWVVHGGGLDELTTTGPSTVLELRGGQVRTFSVDPVSLGLAPAISEELVGGTPAFNADVV  293

Query  393  KRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVSN  214
            +RV++GE G   +  +LNAGA L+V+    +L +G+ +A  +  SG+A  TL   I  S 
Sbjct  294  RRVMAGEQGAHRNIVVLNAGAGLVVADVASSLEEGVAMAAESIDSGRANETLSKLITESQ  353



>ref|WP_035166652.1| anthranilate phosphoribosyltransferase [Lactobacillus curieae]
 gb|KHD03224.1| anthranilate phosphoribosyltransferase [Lactobacillus curieae]
Length=339

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 114/180 (63%), Gaps = 1/180 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK VAPVR+ L I+TIFN LG + NPA+    ++GVY++N++  +AK L R G+K 
Sbjct  154  YHKSMKYVAPVRKALGIRTIFNILGPLANPAKPTTQLLGVYDKNLMKPLAKVLARLGVKH  213

Query  573  ALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            ALVVH ++GLDE++  G   V+++T +K+ ++   P +FG+P     DL G  P  NA +
Sbjct  214  ALVVHGADGLDEVTTTGKTYVVEVTGDKLAEYTVTPEDFGLPLADQDDLVGGTPAENAQI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +LSG  GP  +  I+NAG A+  +    ++A GI++A  T  SGKA+  L   I +S
Sbjct  274  TRDILSGVKGPKRETVIMNAGMAIHTANPEISIANGIKIATETIDSGKAITKLNELIHLS  333



>ref|WP_029413160.1| anthranilate phosphoribosyltransferase [Acidobacteria bacterium 
JGI 0001001-H03]
Length=338

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 111/184 (60%), Gaps = 1/184 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P  H AMK     RR++ I+TIFN LG + NPA     ++G+Y+  +V  +A+ L+  G
Sbjct  153  APLLHEAMKYAVQPRREIGIRTIFNILGPLTNPAMATHQLIGIYSGEMVDMIARVLRNLG  212

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
              RA+VVH  EGLDE+S  GP  V ++   +++++  +P +F + RC L++LQG   + +
Sbjct  213  SVRAMVVHGLEGLDEISLCGPTKVAELRGGEVKQYVIEPEQFNLKRCRLEELQGGNAQES  272

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +++ VL G+ GP  D  +LN GAAL VSG   T+  GI LA  +  SG A   L   I
Sbjct  273  ALIMRAVLEGKKGPARDVVVLNGGAALYVSGRAATIEDGIRLAAESIDSGNARQKLAQLI  332

Query  225  DVSN  214
            +++N
Sbjct  333  ELTN  336



>ref|WP_015516023.1| anthranilate phosphoribosyltransferase [Eubacterium rectale]
 ref|YP_007772089.1| anthranilate phosphoribosyltransferase [Eubacterium rectale DSM 
17629]
 ref|YP_007841993.1| anthranilate phosphoribosyltransferase [Eubacterium rectale M104/1]
 emb|CBK89975.1| anthranilate phosphoribosyltransferase [Eubacterium rectale DSM 
17629]
 emb|CBK93183.1| anthranilate phosphoribosyltransferase [Eubacterium rectale M104/1]
Length=338

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 111/182 (61%), Gaps = 1/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V P+R++L  +T+FN LG + NP      ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGPIRKELGFRTVFNILGPLTNPGSPAMQLLGVYDEYLVEPLAQVLVSLGVKR  216

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+  + LDE+S   P  + +I    +      P +FG  RCT +DL+G  PE NA +
Sbjct  217  GMVVYGMDKLDEISMSAPTKICEIKDGWLRTTVISPEDFGFERCTKEDLKGGTPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
            ++ +L G+ G   +A ++NAGA+L + G   ++ +GIELA     SGKAL TL   I+VS
Sbjct  277  VRDILGGQKGHKRNAVLMNAGASLYIGGKADSMKEGIELAAKIIDSGKALETLDKLIEVS  336

Query  216  NN  211
            N+
Sbjct  337  NS  338



>ref|WP_038286365.1| anthranilate phosphoribosyltransferase [actinobacterium acAcidi]
Length=347

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 109/180 (61%), Gaps = 0/180 (0%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YHPA +  AP RR++ + T+FN LG M NP RV   ++GV N  V  +M  +L+ +G K 
Sbjct  160  YHPAFRFAAPSRREIGVPTVFNLLGPMANPGRVKRQLIGVANPMVAERMLASLRLHGSKS  219

Query  573  ALVVHSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADVL  394
            + VVH  GLDE++  GP TVL++   ++  F+ DP+  G+     ++L G  P +NADV+
Sbjct  220  SWVVHGGGLDELTTTGPSTVLELRGGQVRTFSVDPVSLGLAPAISEELVGGTPAFNADVV  279

Query  393  KRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVSN  214
            +RV++GE G   +  +LNAGA L+V+    +L +G+ +A  +  SG+A  TL   I  S 
Sbjct  280  RRVMAGEQGAHRNIVVLNAGAGLVVADVASSLEEGVAMAAESIDSGRANETLSKLITESQ  339



>ref|WP_032787364.1| anthranilate phosphoribosyltransferase, partial [Lactobacillus 
casei]
Length=207

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK VAPVR++L  +TIFN LG + NPA     ++GVY+E ++  +A  L++ G+  
Sbjct  20   YHKSMKYVAPVRKQLGFRTIFNILGPLANPAHPTRQLLGVYDEALLEPLANVLKKLGVTN  79

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VVH  +GLDEM+      V+++    + K+   P +FG+ R    DL G  PE NAD+
Sbjct  80   AMVVHGRDGLDEMTTADETAVVELHDGHLTKYTVKPEQFGLKRSQRADLVGGTPEANADI  139

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +R+L+G+ GP  D  +LNAGAAL V+    ++  GI+LA  T   GKA   L   +  S
Sbjct  140  TRRILAGDHGPQRDIVLLNAGAALHVAHPALSIQAGIDLAAKTIDDGKAFEELNRLLAFS  199

Query  216  NNVKE  202
            +  K+
Sbjct  200  DKRKD  204



>ref|WP_034613118.1| anthranilate phosphoribosyltransferase, partial [Desulfosporosinus 
sp. Tol-M]
 gb|KGP76226.1| anthranilate phosphoribosyltransferase, partial [Desulfosporosinus 
sp. Tol-M]
Length=259

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 110/177 (62%), Gaps = 1/177 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YHPAM  VA  RR+L I+TIFN LG +LNPA  P+ ++GV +  ++ KMA+AL+R  
Sbjct  80   APLYHPAMGKVALFRRELGIRTIFNLLGPLLNPASAPYQLLGVSSPGLLPKMAEALKRLD  139

Query  582  MKRALVV-HSEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
             KRALVV   +GLDE++  G    + +    ++ F   P ++G  RC+L  L+G   E N
Sbjct  140  SKRALVVVGDDGLDEVTLTGQTHAILVDQGVLKPFEIFPEDYGFKRCSLDALRGGSSEEN  199

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLK  235
            A + + +L GETGP  D  +LNAG A+ V+    T+ +GI+LAR +  SG+A   L 
Sbjct  200  ARLTQGILQGETGPKRDIVLLNAGIAIYVAKRTNTIQEGIDLARYSLDSGQAFGKLN  256



>ref|WP_028044471.1| anthranilate phosphoribosyltransferase [Candidatus Stoquefichus 
massiliensis]
Length=337

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 109/180 (61%), Gaps = 1/180 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAPVR++L I+T+FN LG + NPA     ++GVY+E++V  +A  L   G+KR
Sbjct  154  YHLAMKYVAPVRQELGIRTVFNILGPLTNPAGASMQLMGVYDESLVEPLANVLHNLGVKR  213

Query  573  ALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+  +GLDE+S      V +I       +   P +FG  RC  ++L G  P+ NA +
Sbjct  214  AMVVYGQDGLDEISLSSSTKVCEINNGHYMNYIITPEQFGFKRCQKEELVGGSPDENAQI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
               +L+G+  P  DA +LNAGAA+ + G  + + +GI +AR     GKA+H  K +++ S
Sbjct  274  TLDILNGKHNPKRDAVLLNAGAAIYLGGQAQNMHEGITIARQMIDEGKAIHKFKQFMNAS  333



>ref|WP_014315336.1| anthranilate phosphoribosyltransferase [Clostridium sp. BNL1100]
 gb|AEY67982.1| anthranilate phosphoribosyltransferase [Clostridium sp. BNL1100]
Length=337

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 111/185 (60%), Gaps = 1/185 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P YH +MK  APVR++L ++TIFN LG + NPA     ++GVY+EN+V  +A+ L   G
Sbjct  151  APTYHASMKYAAPVRKELSVRTIFNILGPLANPAGANMQLLGVYDENLVEPLARVLLNLG  210

Query  582  MKRALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
            +KRA+VVH  +GLDE++     T+ +++   I  F   P + G  RCTLK+L G  P+ N
Sbjct  211  VKRAMVVHGHDGLDEVTLCDTTTICEVSNGSINSFFLSPEQLGFSRCTLKELVGGDPKEN  270

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A +   +L+G  GP  D  +LN+   L +S +  TL   ++LA     SG A   L  +I
Sbjct  271  ASIALDILNGSKGPKRDIVVLNSALCLYMSYNQTTLRDCVKLAEQLIDSGAAKAQLDKFI  330

Query  225  DVSNN  211
            ++SN+
Sbjct  331  ELSNS  335



>ref|WP_022010738.1| anthranilate phosphoribosyltransferase [Firmicutes bacterium 
CAG:646]
 emb|CCZ34244.1| anthranilate phosphoribosyltransferase [Firmicutes bacterium 
CAG:646]
Length=343

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 109/185 (59%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L  +T+FN LG + NP      ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGAIRKELGFRTVFNILGPLTNPGSPSMQLLGVYDEYLVEPLAQVLISLGIKR  216

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+ +  LDE+S   P TV +I           P EFG  RC  +DL+G  PE NA +
Sbjct  217  GMVVYGQDKLDEISMSAPTTVCEIRDGWFRTSVITPEEFGFERCKKEDLEGGTPEENAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +L GE G   +A ++NAGAAL + G   ++ +GI LA     SGKA  TL+  I+VS
Sbjct  277  TRSILKGEKGHKRNAILMNAGAALYIGGKADSIREGITLAEQLIDSGKAFETLQKLIEVS  336

Query  216  NNVKE  202
            N ++E
Sbjct  337  NRLEE  341



>ref|WP_003604072.1| anthranilate phosphoribosyltransferase [Lactobacillus casei]
 gb|EKQ29245.1| anthranilate phosphoribosyltransferase [Lactobacillus casei Lc-10]
 gb|ERN49402.1| anthranilate phosphoribosyltransferase [Lactobacillus casei 5b]
Length=341

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 112/185 (61%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK VAPVR++L  +TIFN LG + NPA     ++GVY+E ++  +A  L++ G+  
Sbjct  154  YHKSMKYVAPVRKQLGFRTIFNILGPLANPAHPTHQLLGVYDETLLEPLANVLKKLGVTN  213

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VVH  +GLDEM+      V+++  + + K+   P +FG+ R    DL G  PE NAD+
Sbjct  214  AMVVHGRDGLDEMTTADETAVVELQDDHLTKYTVTPEQFGLKRRQRADLVGGTPEANADI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +R+L+G+ GP  D  +LNAGAAL V+    ++  GI+LA  T   GKA   L   +  S
Sbjct  274  TRRILAGDHGPQRDIVLLNAGAALHVAHPALSIQAGIDLAAKTIDDGKAFEELNRLLAFS  333

Query  216  NNVKE  202
            +  K+
Sbjct  334  DKRKD  338



>ref|WP_003577290.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Lactobacillus 
casei group]
 ref|YP_003787236.1| anthranilate phosphoribosyltransferase [Lactobacillus casei str. 
Zhang]
 gb|ADK17386.1| anthranilate phosphoribosyltransferase [Lactobacillus casei str. 
Zhang]
 gb|EKQ14359.1| anthranilate phosphoribosyltransferase [Lactobacillus casei M36]
 gb|EKQ16444.1| anthranilate phosphoribosyltransferase [Lactobacillus casei A2-362]
 gb|EKQ16821.1| anthranilate phosphoribosyltransferase [Lactobacillus casei T71499]
 gb|EKQ23726.1| anthranilate phosphoribosyltransferase [Lactobacillus casei UCD174]
 gb|EKQ29374.1| anthranilate phosphoribosyltransferase [Lactobacillus casei Lpc-37]
 gb|EPC28196.1| Anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp46]
 gb|EPC38027.1| Anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp120]
 gb|EPC38264.1| Anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp225]
 gb|EPC42126.1| anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp74]
 gb|EPC45634.1| anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp219]
 gb|EPC79184.1| anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp221]
 gb|EPC90811.1| anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp227]
 gb|EPC98043.1| anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei CNCM I-4648]
 gb|EPD09088.1| anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp70]
 gb|EPD09695.1| anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp48]
 gb|AGP66840.1| Anthranilate phosphoribosyltransferase [Lactobacillus casei LOCK919]
Length=341

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 112/185 (61%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK VAPVR++L  +TIFN LG + NPA     ++GVY+E ++  +A  L++ G+  
Sbjct  154  YHKSMKYVAPVRKQLGFRTIFNILGPLANPAHPTHQLLGVYDETLLEPLANVLKKLGVTN  213

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VVH  +GLDEM+      V+++  + + K+   P +FG+ R    DL G  PE NAD+
Sbjct  214  AMVVHGRDGLDEMTTADETAVVELQDDHLTKYTVTPEQFGLKRRQRADLVGGTPEANADI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +R+L+G+ GP  D  +LNAGAAL V+    ++  GI+LA  T   GKA   L   +  S
Sbjct  274  TRRILAGDHGPQRDIVLLNAGAALHVAHPALSIQAGIDLAAKTIDDGKAFEELNRLLAFS  333

Query  216  NNVKE  202
            +  K+
Sbjct  334  DKRKD  338



>ref|WP_028244049.1| anthranilate phosphoribosyltransferase [Pseudobutyrivibrio ruminis]
Length=355

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK V  +R++L  +T+FN LG + NPA     ++GVY+E +V  +A+ L   G+KR
Sbjct  157  YHTSMKYVGAIRKELGFRTVFNILGPLTNPATPSMQLLGVYDEYLVEPLAQVLISLGVKR  216

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             +VV+ +  LDE+S   P  + +I     + +  +P +FG  RCT  DL+G  PE NA +
Sbjct  217  GMVVYGQDKLDEISLSAPTKICEINDGWYKTYIIEPEDFGFERCTKDDLKGGTPENNAKI  276

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             + +LSG  G   +A +LNAGAAL + G   +   G++LA     SGKAL TL+ +I VS
Sbjct  277  TRDILSGAKGHKRNAVLLNAGAALYIGGKADSFKDGVKLAEKIIDSGKALETLEKFILVS  336

Query  216  NNVKE  202
            N + E
Sbjct  337  NEISE  341



>ref|WP_009540248.1| Anthranilate phosphoribosyltransferase [Caenispirillum salinarum]
 gb|EKV30803.1| Anthranilate phosphoribosyltransferase [Caenispirillum salinarum 
AK4]
Length=352

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 109/189 (58%), Gaps = 1/189 (1%)
 Frame = -3

Query  762  SPYYHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYG  583
            +P +H AM+ V P R +L  +T+FN LG + NPA   F V+GV+  N +  +A+ L R G
Sbjct  157  APRHHSAMRHVMPTRTELGTRTLFNLLGPLSNPANARFQVLGVFAHNWIEPIAQVLGRLG  216

Query  582  MKRALVVH-SEGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYN  406
             +RA VVH S+GLDE++  G   V ++   K+  F   P E G+ R ++ DL+G   E N
Sbjct  217  TERAWVVHGSDGLDEITTTGATYVAELRDGKVSTFEVTPEEAGLARASMNDLKGGDAEVN  276

Query  405  ADVLKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWI  226
            A  ++ VL+G      D  ++NAGAAL+V+G   TL  G+E A     SGKAL TL   I
Sbjct  277  AAAIRDVLAGRKSAYRDIVLMNAGAALVVAGKAATLRAGMEAAAQAVDSGKALETLNHMI  336

Query  225  DVSNNVKEP  199
             ++N    P
Sbjct  337  RITNGEPSP  345



>ref|WP_015534413.1| MULTISPECIES: anthranilate phosphoribosyltransferase [Coprococcus]
 ref|YP_007796731.1| anthranilate phosphoribosyltransferase [Coprococcus sp. ART55/1]
 emb|CBK83400.1| anthranilate phosphoribosyltransferase [Coprococcus sp. ART55/1]
 emb|CDB80286.1| anthranilate phosphoribosyltransferase [Coprococcus sp. CAG:131]
Length=337

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 109/182 (60%), Gaps = 2/182 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK   PVR+ L I T+FN LG + NPA+    ++GVY E +V +MA  L   G+KR
Sbjct  155  YHKAMKYAGPVRKALGIPTVFNILGPLTNPAKAQMQIMGVYKEELVDQMAPVLVGLGVKR  214

Query  573  ALVVHSEG-LDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
             LVV+ +  LDE+S   P TV +I   +I K+   P  FG  RC+ +DL G  PE NA +
Sbjct  215  GLVVYGQDCLDEISMSAPTTVAEIKDGEITKYEIKPENFGFERCSKEDLVGGDPEENAQI  274

Query  396  LKRVLSGE-TGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDV  220
             + +LSG+  G   +A +LNA A + ++G   ++A GI++A     SGKA  TL  ++ +
Sbjct  275  TRDILSGKIKGAKRNAVVLNAAACIYIAGKADSIADGIKVAEDVIDSGKAAETLDAFVRL  334

Query  219  SN  214
            +N
Sbjct  335  TN  336



>ref|WP_016371724.1| anthranilate phosphoribosyltransferase [Lactobacillus paracasei]
 gb|EPC62169.1| anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp14]
Length=341

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 112/185 (61%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK VAPVR++L  +TIFN LG + NPA     ++GVY+E ++  +A  L++ G+  
Sbjct  154  YHKSMKYVAPVRKQLGFRTIFNILGPLANPAHPTHQLLGVYDETLLEPLANVLKKLGVTN  213

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VVH  +GLDEM+      V+++  + + K+   P +FG+ R    DL G  PE NAD+
Sbjct  214  AMVVHGRDGLDEMTTADETAVVELQDDHLTKYTVTPEQFGLKRRQRADLVGGTPEANADI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +R+L+G+ GP  D  +LNAGAAL V+    ++  GI+LA  T   GKA   L   +  S
Sbjct  274  TRRILAGDHGPQRDIVLLNAGAALHVAHPALSIQAGIDLAAKTIDDGKAFEELNRLLAFS  333

Query  216  NNVKE  202
            +  K+
Sbjct  334  DKRKD  338



>ref|WP_021960818.1| anthranilate phosphoribosyltransferase [Butyrivibrio crossotus 
CAG:259]
 emb|CCY78259.1| anthranilate phosphoribosyltransferase [Butyrivibrio crossotus 
CAG:259]
Length=337

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 110/181 (61%), Gaps = 1/181 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH AMK VAP+R+KL  +T+FN LG + NPA     ++GV++E  V  +A  L   G+KR
Sbjct  154  YHSAMKYVAPIRKKLGFRTVFNILGPLTNPANASMQLMGVFSERFVESLAHVLYNLGVKR  213

Query  573  ALVVHSE-GLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VV+ E G+DE+S   P  V ++   + + +   P +F + RCT ++L G   E NA++
Sbjct  214  AMVVYGEDGMDEISASAPTKVCEVMDGEFKSYEITPEQFSLTRCTKEELTGGTGEENAEI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             K VL+GE      A ++NAGAAL V+G  +++  GI LA     +G A+  L+ ++ +S
Sbjct  274  TKAVLNGEKSGRRTAVVINAGAALYVAGKAESIGSGIRLAEELIDNGAAMRKLEQFVKLS  333

Query  216  N  214
            N
Sbjct  334  N  334



>ref|WP_016385052.1| Anthranilate phosphoribosyltransferase [Lactobacillus paracasei]
 gb|EPC11604.1| Anthranilate phosphoribosyltransferase [Lactobacillus paracasei 
subsp. paracasei Lpp230]
Length=341

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 112/185 (61%), Gaps = 1/185 (1%)
 Frame = -3

Query  753  YHPAMKIVAPVRRKLRIKTIFNFLGAMLNPARVPFAVVGVYNENVVSKMAKALQRYGMKR  574
            YH +MK VAPVR++L  +TIFN LG + NPA     ++GVY+E ++  +A  L++ G+  
Sbjct  154  YHKSMKYVAPVRKQLGFRTIFNILGPLANPAHPTHQLLGVYDETLLEPLANVLKKLGVTN  213

Query  573  ALVVHS-EGLDEMSPLGPGTVLDITPEKIEKFAFDPLEFGIPRCTLKDLQGAGPEYNADV  397
            A+VVH  +GLDEM+      V+++  + + K+   P +FG+ R    DL G  PE NAD+
Sbjct  214  AMVVHGRDGLDEMTTADETAVVELQDDHLTKYTVTPEQFGLKRRQRADLVGGTPEANADI  273

Query  396  LKRVLSGETGPIADAFILNAGAALLVSGHVKTLAKGIELARCTHRSGKALHTLKFWIDVS  217
             +R+L+G+ GP  D  +LNAGAAL V+    ++  GI+LA  T   GKA   L   +  S
Sbjct  274  TRRILAGDYGPQRDIVLLNAGAALHVAHPALSIQAGIDLAAKTIDDGKAFEELNRLLAFS  333

Query  216  NNVKE  202
            +  K+
Sbjct  334  DKRKD  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680