BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020B05

Length=805
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACL27272.1|  catalase                                                397   1e-132   Nicotiana benthamiana
emb|CCP37650.1|  catalase-1                                             396   1e-132   Nicotiana tabacum [American tobacco]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      396   1e-132   Nicotiana tomentosiformis
gb|AAB62892.1|  catalase-1                                              396   2e-132   Nicotiana glutinosa
gb|AFU48609.1|  catalase 1                                              396   2e-132   Nicotiana benthamiana
gb|AAB71764.1|  catalase 1                                              395   2e-132   Nicotiana tabacum [American tobacco]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      394   9e-132   Nicotiana sylvestris
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               393   2e-131   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAR14052.2|  catalase                                                392   3e-131   Solanum tuberosum [potatoes]
gb|AAM97541.1|  catalase 2                                              391   1e-130   Capsicum annuum
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      391   2e-130   Solanum tuberosum [potatoes]
gb|KJB14249.1|  hypothetical protein B456_002G115900                    380   2e-128   Gossypium raimondii
emb|CDP01803.1|  unnamed protein product                                385   2e-128   Coffea canephora [robusta coffee]
ref|NP_001234186.1|  catalase isozyme 2                                 384   9e-128   
emb|CAI43948.1|  catalase                                               384   1e-127   Populus deltoides
gb|AJE26131.1|  catalase                                                383   2e-127   Salix matsudana [tortured willow]
ref|XP_002301920.1|  catalase family protein                            383   2e-127   Populus trichocarpa [western balsam poplar]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 383   3e-127   Populus euphratica
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      381   1e-126   Vitis vinifera
gb|KJB14250.1|  hypothetical protein B456_002G115900                    381   1e-126   Gossypium raimondii
ref|XP_007046520.1|  Catalase 2                                         380   3e-126   Theobroma cacao [chocolate]
emb|CDY40645.1|  BnaA03g53180D                                          379   4e-126   Brassica napus [oilseed rape]
gb|KHG12976.1|  Catalase isozyme 2                                      380   4e-126   Gossypium arboreum [tree cotton]
gb|ACJ11733.1|  catalase                                                379   5e-126   Gossypium hirsutum [American cotton]
ref|XP_009138342.1|  PREDICTED: catalase-2                              379   6e-126   Brassica rapa
gb|ACV92695.1|  catalase                                                379   8e-126   Brassica oleracea
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         379   8e-126   Camelina sativa [gold-of-pleasure]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               379   1e-125   Gossypium hirsutum [American cotton]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               379   1e-125   Gossypium hirsutum [American cotton]
ref|XP_009106100.1|  PREDICTED: catalase-2                              379   1e-125   Brassica rapa
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      379   1e-125   Nicotiana tomentosiformis
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      378   1e-125   Nelumbo nucifera [Indian lotus]
ref|XP_007018034.1|  Catalase 2                                         378   1e-125   
gb|KJB57963.1|  hypothetical protein B456_009G187600                    378   1e-125   Gossypium raimondii
gb|AAB86582.2|  catalase                                                378   1e-125   Raphanus sativus
gb|AAF71742.1|AF248491_1  catalase                                      378   1e-125   Raphanus sativus
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         378   2e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              378   2e-125   Camelina sativa [gold-of-pleasure]
emb|CDX72514.1|  BnaC07g45360D                                          378   2e-125   
ref|XP_010094556.1|  Catalase isozyme 1                                 378   2e-125   Morus notabilis
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      378   2e-125   Citrus sinensis [apfelsine]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             378   2e-125   Citrus clementina [clementine]
gb|KHG25152.1|  Catalase isozyme 1                                      378   2e-125   Gossypium arboreum [tree cotton]
gb|AFU90823.1|  catalase                                                376   2e-125   Populus x beijingensis
gb|AFU90822.1|  catalase                                                377   3e-125   Populus tomentosa [Chinese white poplar]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      378   3e-125   
emb|CDP07287.1|  unnamed protein product                                377   3e-125   Coffea canephora [robusta coffee]
emb|CDP01802.1|  unnamed protein product                                376   4e-125   Coffea canephora [robusta coffee]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             377   4e-125   
ref|XP_011022275.1|  PREDICTED: catalase-like                           376   5e-125   Populus euphratica
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             377   6e-125   Populus trichocarpa [western balsam poplar]
gb|AIA61608.1|  catalase                                                377   6e-125   Gynostemma pentaphyllum [jiaogulan]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      377   6e-125   
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      377   6e-125   Populus euphratica
ref|XP_010530333.1|  PREDICTED: catalase-2                              377   7e-125   Tarenaya hassleriana [spider flower]
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             376   8e-125   Eutrema salsugineum [saltwater cress]
dbj|BAJ33995.1|  unnamed protein product                                376   8e-125   Eutrema halophilum
gb|KJB17473.1|  hypothetical protein B456_003G002800                    376   8e-125   Gossypium raimondii
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      376   8e-125   Nicotiana sylvestris
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              376   8e-125   Populus euphratica
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      376   1e-124   Prunus mume [ume]
emb|CDX76313.1|  BnaA08g10870D                                          375   2e-124   
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              376   2e-124   Populus euphratica
gb|ADU56199.1|  catalase                                                375   2e-124   Hevea brasiliensis [jebe]
ref|NP_001289779.1|  catalase isozyme 1                                 375   2e-124   Nelumbo nucifera [Indian lotus]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             375   2e-124   
gb|AAD17936.1|  catalase                                                375   2e-124   Brassica juncea [brown mustard]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 375   3e-124   Elaeis guineensis
gb|AET97564.1|  catalase                                                375   3e-124   Ziziphus jujuba [Chinese jujube]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         374   5e-124   Tarenaya hassleriana [spider flower]
gb|AAB88173.1|  catalase                                                368   5e-124   Glycine max [soybeans]
dbj|BAQ21275.1|  catalase                                               374   6e-124   Citrus tamurana
emb|CAD42908.1|  catalase                                               374   6e-124   Prunus persica
gb|AAD17935.1|  catalase                                                374   7e-124   Brassica juncea [brown mustard]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             374   7e-124   Prunus persica
emb|CDY17510.1|  BnaC03g65530D                                          374   7e-124   Brassica napus [oilseed rape]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             374   7e-124   Capsella rubella
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       374   8e-124   Cucumis sativus [cucumbers]
gb|AIS20825.1|  CAT                                                     374   9e-124   Pyrus x bretschneideri [bai li]
emb|CAA64220.1|  catalase                                               374   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      374   1e-123   Cucumis melo [Oriental melon]
gb|AAK96854.1|  catalase                                                373   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      373   2e-123   Phoenix dactylifera
ref|NP_195235.1|  catalase 2                                            373   2e-123   Arabidopsis thaliana [mouse-ear cress]
prf||1906388A  catalase                                                 373   2e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CAA45564.1|  catalase                                               373   2e-123   Arabidopsis thaliana [mouse-ear cress]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          373   2e-123   Soldanella alpina
gb|AHF27428.1|  catalase                                                367   3e-123   Cucurbita moschata [ayote]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          371   7e-123   Helianthus annuus
prf||2104177A  catalase                                                 371   8e-123   Helianthus annuus
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      371   9e-123   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX69111.1|  BnaC01g03420D                                          371   9e-123   
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 371   1e-122   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         371   1e-122   Jatropha curcas
gb|AAR84578.1|  catalase 1a                                             370   1e-122   Lotus japonicus
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      370   2e-122   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      370   2e-122   
ref|XP_002521709.1|  catalase, putative                                 370   2e-122   Ricinus communis
emb|CAC04509.1|  catalase                                               362   2e-122   Digitalis lanata [Grecian foxglove]
gb|KFK30147.1|  catalase                                                369   4e-122   Arabis alpina [alpine rockcress]
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 369   5e-122   Nicotiana tomentosiformis
ref|XP_002306976.2|  catalase family protein                            369   6e-122   
gb|AAO17721.1|  catalase                                                369   6e-122   Hypericum perforatum
ref|NP_001240021.1|  catalase                                           369   9e-122   Glycine max [soybeans]
gb|AAK67359.2|AF390210_1  catalase                                      369   1e-121   Suaeda salsa
gb|AAD17933.1|  catalase                                                369   1e-121   Brassica juncea [brown mustard]
emb|CAB56850.1|  catalase                                               366   1e-121   Prunus persica
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         368   2e-121   Tarenaya hassleriana [spider flower]
ref|NP_001237571.1|  catalase-4                                         368   2e-121   Glycine max [soybeans]
gb|AFN81243.1|  catalase 1                                              368   2e-121   Brassica rapa subsp. pekinensis [bai cai]
gb|AAC19397.1|  leaf catalase                                           367   2e-121   Mesembryanthemum crystallinum
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               367   2e-121   Cucurbita pepo
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              367   3e-121   
gb|AIP93616.1|  CAT1                                                    367   3e-121   Bassia scoparia [burning bush]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 367   4e-121   Nicotiana sylvestris
ref|XP_010692546.1|  PREDICTED: catalase                                367   4e-121   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                367   5e-121   Erythranthe guttata [common monkey flower]
gb|AGV54297.1|  peroxisomal catalase                                    366   8e-121   Phaseolus vulgaris [French bean]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      366   8e-121   Elaeis guineensis
gb|ADC95629.1|  catalase                                                366   1e-120   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      365   1e-120   Elaeis guineensis
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 365   1e-120   Prunus mume [ume]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    365   2e-120   
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             365   2e-120   Phaseolus vulgaris [French bean]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               365   2e-120   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001291326.1|  catalase isozyme 1                                 364   4e-120   Sesamum indicum [beniseed]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          364   5e-120   Amborella trichopoda
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 363   8e-120   Vitis vinifera
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             363   8e-120   Prunus persica
ref|XP_003558892.1|  PREDICTED: catalase-1                              363   8e-120   Brachypodium distachyon [annual false brome]
ref|NP_001268098.1|  catalase                                           363   9e-120   Vitis vinifera
ref|NP_001237556.1|  catalase-1/2                                       363   1e-119   Glycine max [soybeans]
emb|CAD42909.1|  catalase                                               363   1e-119   Prunus persica
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       360   1e-119   
gb|ACA50528.1|  putative catalase 2                                     363   2e-119   Brassica napus [oilseed rape]
dbj|BAA34205.1|  catalase                                               362   2e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             363   3e-119   Eutrema salsugineum [saltwater cress]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 362   3e-119   Cucumis melo [Oriental melon]
gb|AAM97542.1|  catalase 3                                              362   3e-119   Capsicum annuum
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           362   3e-119   
ref|NP_001048861.1|  Os03g0131200                                       362   3e-119   
gb|AGE15298.2|  catalase 1                                              362   3e-119   Eriobotrya japonica [loquat]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      362   3e-119   Solanum lycopersicum
ref|NP_564121.1|  catalase 1                                            362   4e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AHB72694.1|  catalase                                                362   5e-119   Beta vulgaris subsp. maritima [sea beet]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              362   5e-119   
ref|NP_001235974.1|  catalase-3                                         362   5e-119   Glycine max [soybeans]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              361   6e-119   Cicer arietinum [garbanzo]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           361   9e-119   Sesamum indicum [beniseed]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         361   1e-118   Oryza brachyantha
gb|AHA50082.1|  catalase                                                360   1e-118   Eleutherococcus senticosus
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 359   4e-118   Solanum tuberosum [potatoes]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       359   5e-118   Triticum aestivum [Canadian hard winter wheat]
gb|ACN36234.1|  unknown                                                 353   6e-118   Zea mays [maize]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      358   7e-118   Fragaria vesca subsp. vesca
dbj|BAJ90861.1|  predicted protein                                      358   7e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010061175.1|  PREDICTED: catalase-like                           358   1e-117   Eucalyptus grandis [rose gum]
gb|AAC17731.1|  catalase 1                                              358   1e-117   Arabidopsis thaliana [mouse-ear cress]
gb|AGC65520.1|  catalase                                                358   1e-117   Eriobotrya japonica [loquat]
gb|EMT05040.1|  Catalase-1                                              359   1e-117   
gb|ABK24453.1|  unknown                                                 358   1e-117   Picea sitchensis
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          358   2e-117   Vigna radiata var. radiata [golden gram]
gb|ACB11496.1|  catalase                                                357   2e-117   Pinus sylvestris [Scotch pine]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 357   2e-117   Phoenix dactylifera
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             357   3e-117   Phaseolus vulgaris [French bean]
gb|AAF19965.1|AF207906_1  catalase 1                                    357   3e-117   Zantedeschia aethiopica [arum-lily]
gb|ABM47415.1|  catalase                                                357   3e-117   Prunus avium [gean]
gb|ABQ44283.1|  catalase                                                352   3e-117   Saccharum hybrid cultivar NCo 376
dbj|BAJ88747.1|  predicted protein                                      358   4e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADZ45555.1|  catalase                                                357   4e-117   Vigna radiata [mung bean]
gb|AIZ77475.1|  catalase                                                356   5e-117   Triticum aestivum [Canadian hard winter wheat]
gb|AIX10947.1|  putative catalase                                       356   6e-117   Gardenia jasminoides
gb|AAY59707.1|  catalase                                                355   1e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 355   1e-116   Oryza brachyantha
gb|ADZ45556.1|  catalase                                                355   1e-116   Vigna radiata [mung bean]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     358   1e-116   Eucalyptus grandis [rose gum]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    355   1e-116   Oryza sativa Indica Group [Indian rice]
gb|ACL35349.1|  catalase                                                355   2e-116   Picea glauca
gb|KEH36312.1|  catalase heme-binding enzyme                            355   2e-116   Medicago truncatula
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 368   2e-116   
gb|EPS69543.1|  catalase                                                355   3e-116   Genlisea aurea
dbj|BAA05494.1|  catalase                                               354   3e-116   Oryza sativa Japonica Group [Japonica rice]
emb|CDP07288.1|  unnamed protein product                                354   3e-116   Coffea canephora [robusta coffee]
dbj|BAA34204.1|  catalase                                               354   4e-116   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       354   4e-116   
dbj|BAJ87148.1|  predicted protein                                      347   6e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF61732.1|AF243517_1  catalase 2                                    353   1e-115   Helianthus annuus
tpg|DAA43177.1|  TPA: catalase2                                         353   2e-115   
gb|AFW69584.1|  catalase1                                               348   2e-115   
gb|ACH63223.1|  catalase                                                353   2e-115   Rheum australe [Himalayan rhubarb]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         352   2e-115   Setaria italica
emb|CAG23920.1|  catalase                                               352   3e-115   Festuca arundinacea [tall fescue]
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               352   4e-115   Zea mays [maize]
prf||1803522A  catalase                                                 351   8e-115   Zea mays [maize]
gb|AIU99480.1|  catalase                                                351   8e-115   Saccharum spontaneum [fodder cane]
gb|AIU99481.1|  catalase                                                351   8e-115   Saccharum spontaneum [fodder cane]
gb|AAC17729.1|  catalase 1                                              347   9e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             351   9e-115   Eutrema salsugineum [saltwater cress]
ref|NP_001105310.1|  catalase isozyme 2                                 350   1e-114   
gb|AIM43584.1|  catalase                                                350   1e-114   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99479.1|  catalase                                                350   1e-114   Saccharum arundinaceum
gb|AIU99485.1|  catalase                                                350   1e-114   Saccharum spontaneum [fodder cane]
ref|XP_010105996.1|  Catalase isozyme 1                                 345   1e-114   
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 350   1e-114   Eucalyptus grandis [rose gum]
gb|AIU99484.1|  catalase                                                350   1e-114   Saccharum arundinaceum
gb|KHG21219.1|  Catalase isozyme 1                                      348   1e-114   Gossypium arboreum [tree cotton]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               350   2e-114   Ricinus communis
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    350   3e-114   Arabis alpina [alpine rockcress]
gb|ABY21704.1|  catalase-1 precursor                                    350   3e-114   Panax ginseng [Asiatic ginseng]
tpg|DAA43178.1|  TPA: catalase2                                         350   3e-114   
gb|AAD37788.1|AF149283_1  catalase 1                                    347   3e-114   Phaseolus vulgaris [French bean]
ref|XP_009103333.1|  PREDICTED: catalase-1                              349   4e-114   Brassica rapa
emb|CAA42720.1|  catalase-1                                             349   4e-114   Zea mays [maize]
ref|NP_001241808.1|  catalase isozyme B                                 349   4e-114   Zea mays [maize]
emb|CDY31877.1|  BnaC07g15270D                                          349   4e-114   Brassica napus [oilseed rape]
emb|CDY01363.1|  BnaA07g11360D                                          349   5e-114   
gb|AAB07026.1|  catalase 1                                              348   5e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AAG43363.1|AF151368_1  catalase                                      348   7e-114   Hevea brasiliensis [jebe]
gb|AIU99488.1|  catalase                                                348   8e-114   Saccharum hybrid cultivar ROC22
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          348   8e-114   
gb|AAF79625.1|AC027665_26  F5M15.5                                      362   9e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AIU99482.1|  catalase                                                348   9e-114   Saccharum hybrid cultivar ROC22
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               348   1e-113   Hordeum vulgare [barley]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          348   1e-113   Amborella trichopoda
gb|ABR15776.1|  catalase                                                340   2e-113   Litchi
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 349   2e-113   
gb|AIU99486.1|  catalase                                                347   2e-113   Saccharum spontaneum [fodder cane]
gb|AIU99487.1|  catalase                                                347   2e-113   Saccharum hybrid cultivar ROC22
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         346   4e-113   Camelina sativa [gold-of-pleasure]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                346   6e-113   Erythranthe guttata [common monkey flower]
gb|ADN94253.1|  catalase                                                346   6e-113   Puccinellia chinampoensis
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      345   8e-113   Brachypodium distachyon [annual false brome]
ref|XP_010477308.1|  PREDICTED: catalase-1                              345   1e-112   Camelina sativa [gold-of-pleasure]
gb|AIU99483.1|  catalase                                                345   1e-112   Saccharum hybrid cultivar ROC22
gb|ABY19573.1|  catalase                                                337   1e-112   Manihot esculenta [manioc]
ref|NP_001105415.1|  catalase isozyme 1                                 345   1e-112   
ref|XP_002890395.1|  F5M15.5                                            358   2e-112   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         345   2e-112   Camelina sativa [gold-of-pleasure]
gb|AAX84671.1|  catalase CAT2                                           337   2e-112   Manihot esculenta [manioc]
gb|ACJ22771.1|  catalase 1                                              345   2e-112   Jatropha curcas
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      344   3e-112   Eucalyptus grandis [rose gum]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                343   3e-112   Citrus sinensis [apfelsine]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             344   4e-112   Citrus clementina [clementine]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     344   4e-112   Sesamum indicum [beniseed]
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         343   9e-112   Triticum aestivum [Canadian hard winter wheat]
emb|CDY52649.1|  BnaAnng11640D                                          341   1e-111   Brassica napus [oilseed rape]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             343   1e-111   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              341   3e-111   
ref|XP_009149540.1|  PREDICTED: catalase-1                              341   6e-111   Brassica rapa
dbj|BAH19523.1|  AT4G35090                                              340   6e-111   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29518.1|  BnaA06g14520D                                          341   6e-111   Brassica napus [oilseed rape]
emb|CDY31490.1|  BnaC05g15990D                                          341   6e-111   Brassica napus [oilseed rape]
ref|NP_001031791.1|  catalase 2                                         340   6e-111   Arabidopsis thaliana [mouse-ear cress]
gb|AAA57551.1|  catalase                                                337   7e-111   Nicotiana sylvestris
gb|ACJ76836.3|  catalase                                                340   7e-111   Dimocarpus longan [longan]
gb|AEQ30070.1|  catalase                                                340   1e-110   Litchi chinensis [litchi]
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             339   2e-110   
dbj|BAC79443.1|  catalase                                               339   4e-110   Acacia ampliceps
dbj|BAH37035.1|  catalase 1                                             338   5e-110   Pisum sativum [garden pea]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 338   5e-110   Tarenaya hassleriana [spider flower]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      338   5e-110   Nicotiana sylvestris
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    338   5e-110   Nicotiana tabacum [American tobacco]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      338   5e-110   Nicotiana tomentosiformis
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          338   5e-110   Avicennia marina
gb|AAD50974.1|AF170272_1  catalase CAT1                                 338   6e-110   Manihot esculenta [manioc]
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             338   1e-109   Selaginella moellendorffii
gb|AAF61734.1|AF243519_1  catalase 4                                    338   1e-109   Helianthus annuus
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         337   1e-109   Tarenaya hassleriana [spider flower]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               337   1e-109   Ricinus communis
emb|CAE82295.1|  catalase                                               337   2e-109   Homogyne alpina
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               337   2e-109   Zea mays [maize]
gb|AFD29285.1|  catalase                                                337   3e-109   Vicia faba [broad bean]
dbj|BAF91369.1|  catalase                                               336   5e-109   Capsicum annuum
ref|XP_002510677.1|  catalase, putative                                 349   5e-109   
ref|NP_001031072.3|  catalase 3                                         332   8e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498496.1|  PREDICTED: catalase-3                              335   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_009110221.1|  PREDICTED: catalase-3                              335   2e-108   Brassica rapa
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    334   2e-108   Capsicum annuum
emb|CDY31488.1|  BnaC05g15970D                                          334   3e-108   Brassica napus [oilseed rape]
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               334   3e-108   
dbj|BAH20307.1|  AT1G20620                                              333   3e-108   
emb|CDY29519.1|  BnaA06g14510D                                          334   4e-108   
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         334   4e-108   
ref|XP_009149539.1|  PREDICTED: catalase-3                              335   5e-108   
emb|CDY33636.1|  BnaC08g19360D                                          333   5e-108   
gb|AAF61733.1|AF243518_1  catalase 3                                    333   6e-108   
gb|AAC48918.1|  salicylic acid binding catalase                         333   6e-108   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          333   6e-108   
gb|AHF21552.1|  catalase                                                333   9e-108   
ref|NP_564120.1|  catalase 3                                            333   9e-108   
emb|CDY01364.1|  BnaA07g11370D                                          335   1e-107   
gb|AAM65021.1|  unknown                                                 333   1e-107   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            332   1e-107   
emb|CDY31878.1|  BnaC07g15280D                                          332   1e-107   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    332   2e-107   
gb|AHF27430.1|  catalase                                                331   3e-107   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             331   4e-107   
gb|AHF27433.1|  catalase                                                331   5e-107   
gb|AFR53082.1|  CAT                                                     330   6e-107   
gb|AAD30292.1|AF139539_1  catalase 3                                    330   6e-107   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             330   7e-107   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      330   1e-106   
gb|AGI65617.1|  catalase                                                329   1e-106   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      330   1e-106   
gb|ABV55108.1|  catalase 2                                              330   1e-106   
gb|AAD30291.2|AF139538_1  catalase 2                                    330   1e-106   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               329   2e-106   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      329   3e-106   
gb|ADU56198.1|  catalase                                                328   5e-106   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      328   5e-106   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          328   7e-106   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 327   9e-106   
gb|ADM96039.1|  catalase                                                327   1e-105   
gb|AAC49807.1|  catalase 3                                              327   1e-105   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 327   1e-105   
gb|ACJ73905.1|  CAT1                                                    315   2e-105   
gb|ADK25939.1|  catalase                                                317   4e-105   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      326   4e-105   
gb|ADB03784.1|  catalase                                                326   5e-105   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          325   6e-105   
gb|AAL00886.1|  catalase                                                318   6e-105   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      324   1e-104   
ref|NP_001234827.1|  catalase isozyme 1                                 324   2e-104   
gb|AAG61140.2|AF332973_1  catalase 2                                    324   2e-104   
emb|CAA85470.1|  catalase                                               324   2e-104   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               324   2e-104   
gb|AAR97905.1|  catalase                                                324   2e-104   
gb|AII23739.1|  catalase                                                323   3e-104   
gb|AHF27429.1|  catalase                                                323   3e-104   
gb|AHF27432.1|  catalase                                                323   3e-104   
gb|ACJ73906.1|  CAT2                                                    317   5e-104   
gb|ABC01913.1|  catalase isozyme 1-like protein                         323   6e-104   
ref|XP_001752315.1|  predicted protein                                  323   8e-104   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               322   1e-103   
ref|NP_001274863.1|  catalase isozyme 1                                 322   2e-103   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               322   2e-103   
ref|XP_010692544.1|  PREDICTED: catalase-like                           318   4e-102   
gb|AJF34884.1|  catalase                                                318   4e-102   
ref|XP_001784759.1|  predicted protein                                  317   9e-102   
gb|EMS61345.1|  Catalase isozyme 1                                      320   3e-101   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     315   5e-101   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      315   6e-101   
ref|NP_001031073.1|  catalase 3                                         313   3e-100   
gb|ADQ28492.1|  catalase                                                312   9e-100   
gb|AAC17730.1|  catalase 2                                              308   1e-99    
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   314   2e-99    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          310   3e-99    
gb|ABB72796.1|  catalase isozyme 1-like protein                         311   4e-99    
gb|ADY02963.1|  catalase                                                310   6e-99    
gb|ACL81498.1|  catalase                                                310   7e-99    
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 309   9e-99    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               309   1e-98    
gb|AGT16203.1|  catalase                                                309   1e-98    
emb|CAH61266.1|  catalase                                               307   7e-98    
gb|EMS51034.1|  Catalase isozyme 2                                      308   7e-98    
gb|AAZ29552.1|  catalase-C                                              307   1e-97    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      306   1e-97    
ref|NP_001045673.1|  Os02g0115700                                       306   2e-97    
dbj|BAJ92414.1|  predicted protein                                      306   2e-97    
gb|ABN71233.2|  catalase                                                306   3e-97    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          306   4e-97    
gb|KIY96954.1|  catalase                                                300   4e-97    
gb|AAC19398.1|  root catalase                                           304   2e-96    
ref|XP_005645077.1|  catalase                                           304   2e-96    
gb|EMT06167.1|  Catalase isozyme 2                                      309   2e-96    
gb|ABK41476.1|  catalase                                                303   3e-96    
gb|AGT16188.1|  catalase                                                303   3e-96    
gb|AGT16054.1|  catalase                                                303   3e-96    
gb|AGT16310.1|  catalase                                                303   3e-96    
gb|AGT15888.1|  catalase                                                303   3e-96    
gb|ABK24449.1|  unknown                                                 303   4e-96    
gb|AHZ13843.1|  catalase                                                302   7e-96    
gb|AAX88799.1|  catalase                                                301   1e-95    
dbj|BAH56915.1|  AT1G20620                                              300   4e-95    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    300   6e-95    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      298   2e-94    
ref|XP_002950455.1|  catalase                                           298   2e-94    
ref|XP_001696763.1|  catalase/peroxidase                                298   3e-94    
gb|EMS35721.1|  Catalase isozyme 1                                      291   4e-94    
emb|CAA43814.1|  catalase                                               296   9e-94    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           295   2e-93    
gb|ABR16304.1|  unknown                                                 295   4e-93    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          295   6e-93    
gb|ABK24543.1|  unknown                                                 295   7e-93    
gb|AAB70006.1|  catalase                                                294   8e-93    
ref|XP_001779509.1|  predicted protein                                  294   9e-93    
gb|AFW66787.1|  catalase3                                               294   1e-92    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               294   1e-92    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              292   5e-92    
emb|CAA73663.1|  catalase                                               290   4e-91    
dbj|BAA34714.1|  catalase                                               290   5e-91    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    286   2e-90    
gb|AFW66785.1|  catalase3 isoform 1                                     294   2e-90    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             286   3e-90    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    285   6e-90    
gb|AEY70510.1|  catalase                                                280   6e-90    
gb|AAR84577.1|  catalase 1b                                             284   3e-89    
gb|AFY26882.1|  catalase                                                274   4e-89    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              285   9e-89    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      282   4e-88    
ref|XP_011396830.1|  Catalase isozyme 2                                 275   2e-85    
gb|AFW66789.1|  catalase3                                               267   9e-85    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            273   1e-84    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        272   4e-84    
ref|NP_001105416.1|  catalase isozyme 3                                 271   6e-84    
gb|ACV30589.1|  catalase                                                258   5e-83    
ref|XP_005708279.1|  catalase                                           267   2e-82    
gb|AFW66788.1|  catalase3                                               267   3e-82    
gb|ABB88582.1|  catalase                                                266   6e-82    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      255   2e-77    
gb|KDD77132.1|  catalase                                                250   7e-76    
gb|AFH53187.1|  catalase                                                242   1e-75    
gb|AFH53190.1|  catalase                                                241   2e-75    
gb|AFH53189.1|  catalase                                                241   2e-75    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      244   3e-74    
gb|AFR42410.1|  catalase                                                233   8e-74    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             243   1e-73    
dbj|BAH20283.1|  AT1G20620                                              233   1e-73    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 239   6e-72    
ref|XP_005536240.1|  catalase                                           240   7e-72    
gb|AFR42412.1|  catalase                                                228   1e-71    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 238   1e-71    
gb|ACU23083.1|  unknown                                                 230   2e-71    
gb|AAP57673.1|  catalase                                                225   4e-69    
gb|AID50071.1|  catalase                                                221   6e-69    
gb|KEH36313.1|  catalase heme-binding enzyme                            231   7e-69    
gb|AGS17821.1|  catalase 2                                              228   2e-68    
dbj|BAD07937.1|  catalase catA-like protein                             217   4e-67    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             223   5e-66    
emb|CAA10286.1|  catalase                                               212   1e-65    
gb|AAO16182.1|  catalase-1                                              210   5e-65    
gb|AFA36510.1|  catalase                                                213   2e-64    
gb|ABB51561.1|  truncated catalase 2                                    217   8e-64    
gb|ABY68160.1|  catalase                                                206   4e-63    
gb|ABY68162.1|  catalase                                                205   8e-63    
gb|ABY68159.1|  catalase                                                204   2e-62    
gb|AFI48101.1|  catalase isozyme B                                      204   2e-62    
gb|ABY68158.1|  catalase                                                204   2e-62    
gb|AFI48054.1|  catalase isozyme B                                      202   6e-62    
ref|NP_973873.1|  catalase 3                                            212   7e-62    
gb|AFI48111.1|  catalase isozyme B                                      202   9e-62    
gb|ABY68161.1|  catalase                                                202   1e-61    
emb|CBI29556.3|  unnamed protein product                                201   2e-61    
gb|AFI48130.1|  catalase isozyme B                                      200   5e-61    
gb|AFI48068.1|  catalase isozyme B                                      200   5e-61    
gb|AFI48131.1|  catalase isozyme B                                      200   5e-61    
gb|ABY68164.1|  catalase                                                200   6e-61    
gb|ABS89000.1|  catalase                                                201   7e-61    
gb|AFI48098.1|  catalase isozyme B                                      199   1e-60    
dbj|BAD94702.1|  catalase                                               197   6e-60    
gb|AEA86295.1|  putative catalase                                       197   2e-59    
gb|AFK46618.1|  unknown                                                 194   8e-59    
gb|ACJ71245.1|  catalase 2                                              199   2e-57    
ref|XP_005712277.1|  unnamed protein product                            201   6e-57    
gb|ACJ71244.1|  catalase 2                                              198   7e-57    
emb|CDP22058.1|  unnamed protein product                                190   1e-56    
gb|AAZ03546.1|  Catalase                                                191   2e-56    
gb|ADR01107.1|  catalase 3                                              194   2e-55    
gb|ABY68163.1|  catalase                                                183   2e-54    
gb|AAY22485.1|  catalase                                                185   6e-54    
gb|AAT68776.1|  catalase                                                186   1e-53    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     184   2e-52    
gb|AFV96158.1|  catalase                                                179   6e-52    
gb|AAR25790.1|  catalase                                                174   3e-51    
gb|ACY30463.1|  catalase                                                181   8e-51    
gb|ABN79860.2|  catalase                                                178   1e-50    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     181   2e-50    
emb|CAC16850.1|  catalase                                               173   5e-50    
ref|XP_005642928.1|  catalase                                           182   5e-50    
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             179   1e-49    
emb|CAC17121.1|  catalase                                               171   2e-49    
ref|XP_005644653.1|  catalase-domain-containing protein                 180   1e-48    
gb|KJE89728.1|  catalase isozyme 2                                      179   3e-48    
ref|XP_004366029.2|  catalase isozyme 2                                 178   4e-48    
gb|AAG23803.1|  catalase                                                167   2e-47    
ref|XP_005647994.1|  catalase-domain-containing protein                 173   2e-46    
ref|WP_035160169.1|  catalase                                           169   9e-45    
ref|WP_032122311.1|  catalase                                           167   2e-44    
gb|AII80275.1|  catalase                                                162   4e-44    
gb|KGS11078.1|  catalase                                                160   1e-43    
gb|EGH29791.1|  catalase                                                158   3e-43    
ref|WP_029198005.1|  catalase                                           164   3e-43    
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             156   3e-43    
ref|WP_032632526.1|  catalase                                           164   4e-43    
gb|AFC35182.1|  catalase dismutase                                      159   4e-43    
ref|WP_032664185.1|  catalase                                           164   4e-43    
gb|KIQ35234.1|  catalase                                                164   5e-43    
ref|WP_043304355.1|  catalase                                           164   6e-43    
gb|AHB35639.1|  catalase                                                155   6e-43    
gb|AIM05078.1|  catalase                                                159   9e-43    
ref|WP_001069151.1|  catalase                                           163   9e-43    
gb|AAU43642.1|  catalase                                                154   9e-43    
ref|WP_004887231.1|  catalase                                           163   1e-42    
ref|WP_031421259.1|  catalase                                           162   1e-42    
ref|WP_032632922.1|  catalase                                           162   2e-42    
ref|WP_038401366.1|  catalase                                           162   2e-42    
ref|WP_015881004.1|  catalase                                           162   2e-42    
ref|WP_031412803.1|  catalase                                           161   2e-42    
ref|WP_043193175.1|  catalase                                           162   3e-42    
ref|WP_003342200.1|  catalase                                           161   3e-42    



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   397 bits (1019),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWIS
Sbjct  410  STMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWIS
Sbjct  410  STMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   396 bits (1018),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNF QPGERYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWIS
Sbjct  410  STMCTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPGERYRSF+PDRQERFI RWV+ALSDPRIT+EIRSIWIS
Sbjct  410  STMCTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   396 bits (1017),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  289  TKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  348

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P
Sbjct  349  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  408

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWIS
Sbjct  409  STMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  468

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  469  YWSQADKSLGQKLASRLNVRPSI  491



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIR+IWIS
Sbjct  410  STMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   394 bits (1012),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQ G+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWIS
Sbjct  410  STMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNF NENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  283  TKTWPEDILPLQPVGRLVLNKNIDNFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  342

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P
Sbjct  343  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  402

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPRITYEIRSIWIS
Sbjct  403  STMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWIS  462

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  463  YWSQADKSLGQKLASRLNVRPSI  485



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  273  TKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  332

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE YP P
Sbjct  333  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIP  392

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + VC+GKREKC+I KENNFKQPGERYR+F+PDRQERFI RWV+ALSDPRITYEIRSIWIS
Sbjct  393  STVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  452

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  453  YWSQADKSLGQKLASRLNVRPSI  475



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQP+GRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  282  TKTWPEDIFPLQPLGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  341

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE YP P
Sbjct  342  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPIP  401

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              VC+GKREKC+I KENNF+QPGERYRSFS DRQERFI RWV+ALSDPRITYEIRSIWIS
Sbjct  402  TTVCSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWIS  461

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  462  YWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE YP P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + VC+GKREKC+I KENNFKQPGERYR+F+PDRQERFI RWV+ALSDPRITYEIRSIWI+
Sbjct  410  STVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWIT  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   380 bits (977),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYS
Sbjct  142  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYS  201

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P
Sbjct  202  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  261

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  262  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWIS  321

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKS+GQK+ASRLN+RP++
Sbjct  322  YWSQADKSVGQKLASRLNVRPSI  344



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLN+NIDNFFNENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE+DYFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +AV TG+REK +I KENNFKQPGERYRSF+PDRQERFICRWVDALSDPR+TYEIRSIWIS
Sbjct  410  SAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNIRPSI  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   384 bits (986),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNF   NEQLAFCPSIVVPG+YYSDDK+LQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFLYMNEQLAFCPSIVVPGVYYSDDKMLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE YP P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + VC+GKREKC+I KENNFKQPGERYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWI+
Sbjct  410  STVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIT  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  410  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR T+EIRSIWIS
Sbjct  410  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  410  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   383 bits (983),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKREKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALSDPR+T+EIRSIWIS
Sbjct  410  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+ TG+REKC+I KENNFKQPGERYRSF+PDRQERFI RWVDALSDPR+TYEIRSIWIS
Sbjct  410  PAILTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKS+GQK+ASRLN+RP++
Sbjct  470  YWSQADKSVGQKLASRLNVRPSI  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   380 bits (976),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCPSI+VPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPSIIVPGLYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+GKREKC+I KENNF+QPGERYRSF+PDRQERFI RWVDALSDPR+TYEIRSIWIS
Sbjct  410  TAICSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWS+ADKSLGQK+ASRL++RP++
Sbjct  470  YWSKADKSLGQKLASRLSVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   379 bits (974),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  283  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  342

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  343  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  402

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  403  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  462

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RPN+
Sbjct  463  YWSQADKSLGQKLASRLNVRPNI  485



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   380 bits (975),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSDPR+T+EIRSIWIS
Sbjct  410  STVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQKIASRLN+RP++
Sbjct  470  YWSQADKSLGQKIASRLNVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   379 bits (974),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWV+ALSDPR+T+EIRSIWIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   379 bits (974),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RPN+
Sbjct  470  YWSQADKSLGQKLASRLNVRPNI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   379 bits (973),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   379 bits (973),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+G RE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   379 bits (972),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKS+GQK+AS LN+RP++
Sbjct  470  YWSQADKSVGQKLASLLNVRPSI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   379 bits (972),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQP+GR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPMGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSDPR+T+EIRSIWIS
Sbjct  410  STVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQKIASRLN+RP++
Sbjct  470  YWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   379 bits (972),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPE+L+PLQPVGR+VLNKNIDNF  ENEQLAFCP+I+VPGIYYSDDKLLQTR+FSY+
Sbjct  290  TKTWPEELLPLQPVGRMVLNKNIDNFLAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP N+PKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RPN+
Sbjct  470  YWSQADKSLGQKLASRLNVRPNI  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   379 bits (972),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TGKR+KC++ KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  410  LRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQKIASRLN+RP M
Sbjct  470  YWSQADKSLGQKIASRLNIRPTM  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP +VVPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGVVVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNF+HRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +CTGKREKCVI KENNFKQPGERYRSF PDRQERFI RW DALSDPR+T+EIRSIWIS
Sbjct  410  PRICTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+A+RLN++P+M
Sbjct  470  YWSQADKSLGQKLATRLNVKPSM  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI+
Sbjct  410  PAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIT  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQA KSLGQK+ASRLN++PN+
Sbjct  470  YWSQACKSLGQKLASRLNVKPNI  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTR+FSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRVFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDP RHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+CTGKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDA+SDPR+T+EIRSIWI+
Sbjct  410  PALCTGKREKCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWIT  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  289  TKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  348

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  349  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  408

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  409  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  468

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  469  YWSQADKSLGQKLASRLNVRPSI  491



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   378 bits (971),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYD VRHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   378 bits (971),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYD VRHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  278  TKTWPEDLLPLQPVGRMVLNKNIDNFFTENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  337

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MN MHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  338  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTP  397

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  398  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  457

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  458  YWSQADKSLGQKLASRLNVRPSI  480



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   378 bits (971),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHR+EE++YFPSRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +A+CTG+RE+ VI KENNFKQPGERYRSFSPDRQERFI RWV+ALSDPR+T+EIRSIWIS
Sbjct  410  SAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   378 bits (971),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR IWIS
Sbjct  410  PEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQA KSLGQK+ASRLN+RPN+
Sbjct  470  YWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR IWIS
Sbjct  410  PEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQA KSLGQK+ASRLN+RPN+
Sbjct  470  YWSQACKSLGQKLASRLNVRPNI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWV+A SDPR+T+EIRSIWIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   376 bits (966),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY+
Sbjct  248  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYA  307

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P
Sbjct  308  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  367

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  368  PAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  427

Query  265  YWSQADKSLGQKIASRLNM  209
            YWSQADKSLGQK+ASRLN+
Sbjct  428  YWSQADKSLGQKLASRLNV  446



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY+
Sbjct  289  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYA  348

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P
Sbjct  349  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  408

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  409  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  468

Query  265  YWSQADKSLGQKIASRLNM  209
            YWSQADKSLGQK+ASRLN+
Sbjct  469  YWSQADKSLGQKLASRLNV  487



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   378 bits (971),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY+
Sbjct  310  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYA  369

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PTP
Sbjct  370  DTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTP  429

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR IWIS
Sbjct  430  PEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWIS  489

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQA KSLGQK+ASRLN+RPN+
Sbjct  490  YWSQACKSLGQKLASRLNVRPNI  512



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            + TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  SKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +GKR+KCVI KENNFKQPGERYRS++PDRQERFICRWVDALSD R+T+EIRSIWIS
Sbjct  410  PPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQKIA+RLN+RP M
Sbjct  470  YWSQADKSLGQKIATRLNVRPTM  492



>emb|CDP01802.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   376 bits (966),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 175/210 (83%), Positives = 195/210 (93%), Gaps = 7/210 (3%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLN+NIDNFFNENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY+
Sbjct  260  TKTWPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYA  319

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEE-------IDYFPSRYDPVRH  467
            DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE       +DYFPSRYDPVRH
Sbjct  320  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEHCTFCPCVDYFPSRYDPVRH  379

Query  466  AERYPTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYE  287
            AE +P P+AV TG+REK +I KENNFKQPGERYRSF+PDRQERFICRWVDALSDPR+TYE
Sbjct  380  AEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYE  439

Query  286  IRSIWISYWSQADKSLGQKIASRLNMRPNM  197
            IRSIWISYWSQADKSLGQK+ASRLN+RP++
Sbjct  440  IRSIWISYWSQADKSLGQKLASRLNIRPSI  469



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   377 bits (968),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  288  TKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  347

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P
Sbjct  348  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  407

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWIS
Sbjct  408  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  467

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LNMRP++
Sbjct  468  YWSQADKSLGQKLASHLNMRPSI  490



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   376 bits (966),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  274  TKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  333

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P
Sbjct  334  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  393

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWIS
Sbjct  394  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  453

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LNMRP +
Sbjct  454  YWSQADKSLGQKLASHLNMRPGI  476



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   377 bits (967),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWIS
Sbjct  410  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LNMRP++
Sbjct  470  YWSQADKSLGQKLASHLNMRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   377 bits (967),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTGKRE+CVI KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T+EIRSIWIS
Sbjct  410  PAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+S+GQK+AS LNMRP++
Sbjct  470  YWSQADRSVGQKLASHLNMRPSI  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   377 bits (967),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+TYEIRSIWIS
Sbjct  410  SNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+S GQK+ASRLN+RP++
Sbjct  470  YWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   377 bits (967),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +AVC+G+REKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALS+PR+T+E+RSIWIS
Sbjct  410  SAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LN+RP++
Sbjct  470  YWSQADKSLGQKLASHLNVRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   377 bits (967),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +C+G+RE+C+I KENNFKQPGERYRSF+PDRQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  410  PVICSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADQSLGQKLASRLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   376 bits (966),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   376 bits (966),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   376 bits (966),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSD R+T+EIRSIWIS
Sbjct  410  STVYSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQKIASRLN+RP++
Sbjct  470  YWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   376 bits (966),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TGKR+KC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  410  PRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADK+LGQKIASRLN+RP M
Sbjct  470  YWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   376 bits (966),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWIS
Sbjct  410  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LNMRP +
Sbjct  470  YWSQADKSLGQKLASHLNMRPGI  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVR+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + +GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWIS
Sbjct  410  PNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  275  TKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  334

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  335  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  394

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  395  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWIS  454

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADK+LGQK+ASRLN+RP++
Sbjct  455  YWSQADKTLGQKLASRLNVRPSI  477



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  309  TKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  368

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P
Sbjct  369  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  428

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWIS
Sbjct  429  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  488

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LNMRP +
Sbjct  489  YWSQADKSLGQKLASHLNMRPGI  511



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCPSIVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YP P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +A+ +G  EKCVI KENNFKQPGERYRSFS DR+ERFI RWV+A+SDPR+TYEIRSIWIS
Sbjct  410  SAILSGNCEKCVIPKENNFKQPGERYRSFSSDRKERFIRRWVEAMSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW QADKSLGQKIAS LNMRP M
Sbjct  470  YWYQADKSLGQKIASHLNMRPTM  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            + TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  SKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH++G MNF+HR+EE++YFPSRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +CTGKREKCVI KENNFKQPGERYRS++PDRQERFI RW+DALSDPR+T+EIRSIWIS
Sbjct  410  PQICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN++P+M
Sbjct  470  YWSQADKSLGQKLASRLNVKPSM  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAICSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+A+RLN+RP++
Sbjct  470  YWSQADKSLGQKLANRLNVRPSI  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   375 bits (962),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + TG+REKCVI KENNFKQPGERYRS++PDRQERFICRWV+ALSDPR+TYEIR+IWIS
Sbjct  410  FRILTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D+SLGQKIA+RLN++P+M
Sbjct  470  YWSQCDRSLGQKIATRLNVKPSM  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   375 bits (962),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +A+  GKREKC+I KENNFKQPGERYRS++PDRQERFI RW+DALSDPR+T+EIRSIWIS
Sbjct  410  SAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   374 bits (961),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+VPLQPVGRLVLNKNID+FF ENEQLAFCP I+VPGI+YSDDKLLQTR+FSYS
Sbjct  290  TKTWPEDIVPLQPVGRLVLNKNIDSFFAENEQLAFCPGIIVPGIHYSDDKLLQTRVFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + VC+G+RE+C+I KENNFKQPGERYRSF+PDR+ERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  410  SVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+ASR+N+RPN+
Sbjct  470  YWSQADQSLGQKLASRMNVRPNI  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   368 bits (944),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+
Sbjct  106  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYA  165

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAE +P P
Sbjct  166  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIP  225

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+WIS
Sbjct  226  PAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWIS  285

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIASRL+MRPN+
Sbjct  286  YWSQADRSLGQKIASRLSMRPNI  308



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   374 bits (959),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY+
Sbjct  274  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYA  333

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PTP
Sbjct  334  DTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTP  393

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +C G+REKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALSDPR+T+EIR IWIS
Sbjct  394  PEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWIS  453

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQA KSLGQK+ +RLN+RP++
Sbjct  454  YWSQACKSLGQKLTARLNVRPSI  476



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + +GKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+WIS
Sbjct  410  PNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   374 bits (960),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADK+LGQK+ASRLN+RP++
Sbjct  470  YWSQADKTLGQKLASRLNVRPSI  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   374 bits (960),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + +GKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+WIS
Sbjct  410  PNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   374 bits (959),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  275  TKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  334

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  335  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  394

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  395  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWIS  454

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADK+LGQK+AS LN+RP++
Sbjct  455  YWSQADKTLGQKLASHLNVRPSI  477



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   374 bits (960),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   374 bits (960),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI+
Sbjct  410  PAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWIT  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+S+GQK+AS LN+RP++
Sbjct  470  YWSQADRSVGQKLASHLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   374 bits (959),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+TYEIRSIWIS
Sbjct  410  SNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+S GQK+ASRLN+RP++
Sbjct  470  YWSQADRSFGQKLASRLNVRPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWIS
Sbjct  410  PAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+S+GQK+AS LN+RP++
Sbjct  470  YWSQADRSVGQKLASHLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR++LNKNIDNFF+ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRMILNKNIDNFFSENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V TG+REKCVI KENNFKQPGERYRS++PDRQ RFICRWV+ALSDPR+TYEIRSIWIS
Sbjct  410  SCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D+SLGQKIA+RLN++P+M
Sbjct  470  YWSQCDRSLGQKIATRLNVKPSM  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>prf||1906388A catalase
Length=492

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+++VPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLMPVGRLVLNKNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TGKR++C+I KENNFKQPGERYR+F+PDRQERF+CRWVDALSDPR+T+EIRSIWIS
Sbjct  410  PPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQK+ASRLN+RP M
Sbjct  470  YWTQADKSLGQKLASRLNVRPTM  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   367 bits (942),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+
Sbjct  142  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYA  201

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERYP P
Sbjct  202  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHP  261

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYRS++PDRQERF+ RWVDALSD R+T+EIRSIWIS
Sbjct  262  PAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWIS  321

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+AS LN+RP++
Sbjct  322  YWSQADRSLGQKLASHLNVRPSI  344



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   371 bits (953),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
                +GKR+KCVI KENNFKQPGERYRSFSPDRQERFI R V  LSDPR+T+E+RSIW+S
Sbjct  410  PVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPN  200
            YWSQADKSLGQKIASRLN++PN
Sbjct  470  YWSQADKSLGQKIASRLNVKPN  491



>prf||2104177A catalase
Length=492

 Score =   371 bits (953),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 172/202 (85%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
                +GKR+KCVI KENNFKQPGERYRSFSPDRQERFI R V  LSDPR+T+E+RSIW+S
Sbjct  410  PVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPN  200
            YWSQADKSLGQKIASRLN++PN
Sbjct  470  YWSQADKSLGQKIASRLNVKPN  491



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   371 bits (953),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCP++VVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRMVLNKNIDNFFGENEQLAFCPALVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TGKREKC+I KENNFKQPGERYRSFSPDRQERFI RWV+ALSDP++T+EIRSIWIS
Sbjct  410  TRVLTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSL QK+A+RL+++P+M
Sbjct  470  YWSQCDKSLSQKLATRLSVKPSM  492



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   371 bits (952),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  278  TKTWPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  337

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSRY+PVRHAE+YPTP
Sbjct  338  DTQRHRLGPNYLQLPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKYPTP  397

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC GKRE+CVI KENNFK+PGERYR F P+RQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  398  PAVCAGKRERCVIEKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRITHEIRSIWIS  457

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LN+RPN+
Sbjct  458  YWSQADKSLGQKLASHLNVRPNI  480



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGR+VLNKNIDNFFNENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRMVLNKNIDNFFNENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            ++V TG+REK +I KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+T+EIR IWIS
Sbjct  410  SSVVTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSLGQKIA+RLN++P M
Sbjct  470  YWSQCDKSLGQKIATRLNVKPTM  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLN+NIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRMVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG+REK VI KENNFKQPGERYRSF+PDR++RFI RWV+ALSDPR+TYEIRSIWIS
Sbjct  410  PPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQKIAS LNMRP M
Sbjct  470  YWSQADKSLGQKIASHLNMRPTM  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   370 bits (951),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGI YSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGISYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+CTG RE+C I KENNFKQPGERYRSF+PDRQ+RF+ RWVDALSDPR+T+EIRS WIS
Sbjct  410  PAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LN+RP++
Sbjct  470  YWSQADRSLGQKIASHLNLRPSI  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+T+EIRSIWIS
Sbjct  410  SNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+S GQK+ASRLN+RP++
Sbjct  470  YWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+T+EIRSIWIS
Sbjct  410  SNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+S GQK+ASRLN+RP++
Sbjct  470  YWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   370 bits (950),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCPSIVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MN MHRDEE++YFPSRYDP RHAE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNIMHRDEEVNYFPSRYDPARHAEQHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + +GKREKC+I KENNFKQPGERYRSF+PDR+ERFI RWV+AL+D RITYEIRSIWIS
Sbjct  410  PRILSGKREKCIILKENNFKQPGERYRSFTPDRKERFIRRWVEALTDTRITYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LNMRP M
Sbjct  470  YWSQADKSLGQKLASHLNMRPTM  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   362 bits (929),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  63   TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  122

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAER+P P
Sbjct  123  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHP  182

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
                 GKR++  I KENNFKQPGE+YRSF PDRQERFI RWVDALSDPR+T+EIRSIW+S
Sbjct  183  PVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVS  242

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQK+ASRLN+RP M
Sbjct  243  YWTQADKSLGQKLASRLNIRPTM  265



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   369 bits (948),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF P+RQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   369 bits (948),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + TGKR++C+I KENNFKQPGERYRS+SPDRQERFICRW++ALSDPR+T+EI +IWIS
Sbjct  410  PRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLG+KIASRLN+RP M
Sbjct  470  YWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   369 bits (947),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +AVC+G+REKC+I KENNFKQPGERYRS++PDRQERF+ RWVDALS+PR+T+E+RSIWIS
Sbjct  410  SAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LN+RP++
Sbjct  470  YWSQADKSLGQKLASHLNVRPSV  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   369 bits (947),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V  G+REKC+I KENNFKQPGERYRSFSPDRQERF+ RW+ +LSDPR+T+EIR+IW++
Sbjct  410  PVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVT  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW QADKSLGQK+ASRLN+RPNM
Sbjct  470  YWYQADKSLGQKLASRLNVRPNM  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   369 bits (946),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAE +P P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+WIS
Sbjct  410  PAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIASRL+MRPN+
Sbjct  470  YWSQADRSLGQKIASRLSMRPNI  492



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCPSIVVPG++YSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVHYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V  G REK  I KENNFKQPGERYRS  P RQERFICR VDALSDPR+T+EIRSIWIS
Sbjct  410  SNVLNGCREKQCIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLG K+ASRLN+RP M
Sbjct  470  YWSQADKSLGMKVASRLNVRPTM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   369 bits (946),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 195/207 (94%), Gaps = 4/207 (2%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPD----RQERFICRWVDALSDPRITYEIRS  278
             AVC+GKRE+CVI KENNFK+PGERYRSF+P+    RQERFI RW++ALSDPRIT+EIRS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRS  469

Query  277  IWISYWSQADKSLGQKIASRLNMRPNM  197
            IWISYWSQADK+LGQK+ASRLN+RP++
Sbjct  470  IWISYWSQADKTLGQKLASRLNVRPSI  496



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF+YS
Sbjct  221  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYS  280

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P
Sbjct  281  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIP  340

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+WIS
Sbjct  341  SNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWIS  400

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  401  YWSQADKSLGQKLASRLNVRPSI  423



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQ+AFCP++VVPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQVAFCPALVVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC  HNNH+DG MNFMHRDEE++YFPSR+DPVRHAER+P+P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+G+REKC+I KENNFKQPGERYRS++PDRQERF+ RWV+ALSD R T+EIRSIWIS
Sbjct  410  PAICSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP+ 
Sbjct  470  YWSQADKSLGQKLASRLNVRPSF  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+WIS
Sbjct  410  PAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS L+ RPN+
Sbjct  470  YWSQADRSLGQKIASHLSTRPNI  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++AL DPRIT+EIRSIWI 
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIF  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADK+ GQK+ASRLN+RP++
Sbjct  470  YWSQADKTFGQKLASRLNVRPSI  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRD+E+DYFPSRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V  G R++ +I KENNFKQPGERYRS+ P RQERFICRWVDALSDPRIT+EIR+IWIS
Sbjct  410  PNVLNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKS+G K+ASRLN+RP M
Sbjct  470  YWSQADKSVGMKLASRLNVRPTM  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYRS++PDRQERF+ RWVDALSD R+T+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+AS LN+RP++
Sbjct  470  YWSQADRSLGQKLASHLNVRPSI  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   367 bits (943),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 194/207 (94%), Gaps = 4/207 (2%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPD----RQERFICRWVDALSDPRITYEIRS  278
             AVC+GKRE+CVI KENNFK+PG RYRSF+PD    RQERFI RW++ALSDPRIT+EIRS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRS  469

Query  277  IWISYWSQADKSLGQKIASRLNMRPNM  197
            IWISYWSQADK+LGQK+ASRLN+RP++
Sbjct  470  IWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   367 bits (942),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHR EE+DYFPSRYDPVRHAE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRGEEVDYFPSRYDPVRHAEKFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +CTG+RE+ +I KENNFKQPGERYRS  P RQERFICR VDALSDPRIT+EIRSIWIS
Sbjct  410  SNICTGRRERQIIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLG K+ASRLN++  M
Sbjct  470  YWTQADKSLGMKVASRLNVKATM  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   367 bits (942),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFM+RDEE++YFPSR+DP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + TGKR++C+I KENNFKQPGERYRS+SPDRQERFICRW++ALSDPR+T+EIR IWIS
Sbjct  410  PRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLG+KIASRLN+RP M
Sbjct  470  YWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   367 bits (942),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+ YSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V  GKRE+ +I KENNFKQPGERYRS  P RQERFICR VDALSDPRIT+EIRSIW+S
Sbjct  410  SNVINGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEIRSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLG K+ASRLN+RP M
Sbjct  470  YWSQADKSLGMKVASRLNVRPTM  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   367 bits (941),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP +VVPG++YSDDK+LQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGLVVPGVHYSDDKMLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAE++P P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +GKR++C I KENNFKQPGERYR+FSPDRQERFI RWVDALSDPR+T+EIRSIWIS
Sbjct  410  PVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP M
Sbjct  470  YWSQADKSLGQKLASRLNVRPTM  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   366 bits (940),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYD VRHAE +P P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+G+REKC I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+WIS
Sbjct  410  PAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LNMRPN+
Sbjct  470  YWSQADRSLGQKIASHLNMRPNI  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   366 bits (940),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TG+REKCVI KENNFKQPGERYRS+ P+RQERFI RWV+ALSDPR+T+EI+SIWIS
Sbjct  410  SRILTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSLGQKIA+RLN++P M
Sbjct  470  YWSQCDKSLGQKIATRLNVKPCM  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   366 bits (939),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++Y PSR+DPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTG+REKC+I KENNFKQPGERYRS++PDRQERF  RWV+ALSDPR+T+EI SIWIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+Q DK LGQK+A+RLN+RP++
Sbjct  470  YWTQCDKFLGQKLATRLNVRPSI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            +  WPED+VPLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTR+FSY+
Sbjct  290  SKIWPEDIVPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TGKREKCVIGKENNFKQPGERYRSF P RQERF+ RWV+ALSD R+T+EIR IWI+
Sbjct  410  PRVLTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWIT  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSLGQK+A+RLNMRP+M
Sbjct  470  YWSQCDKSLGQKLATRLNMRPSM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPG+YYSDDK+LQTRIF+YS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGVYYSDDKMLQTRIFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +  GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWIS
Sbjct  410  SNILYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 189/203 (93%), Gaps = 2/203 (1%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGRLVLN+NIDNFF ENEQLAFCPSIVVPG++YSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLMPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVFYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+ TGKREK +I KENNFKQPGERYRS++PDRQERFICRWVDALSD   T+EIRS+WIS
Sbjct  410  TAMLTGKREKTIIEKENNFKQPGERYRSWTPDRQERFICRWVDALSD--XTHEIRSVWIS  467

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP++
Sbjct  468  YWSQADKSLGQKLASRLNVRPSI  490



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYD VRHAE +P P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+G+REKC I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+WIS
Sbjct  410  PAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LNMRPN+
Sbjct  470  YWSQADRSLGQKIASHLNMRPNI  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+IVVPG+Y SDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P
Sbjct  350  DAQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TGKR+KC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIW S
Sbjct  410  PCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADK+LGQKIASRLN+RP M
Sbjct  470  YWSQADKTLGQKIASRLNVRPTM  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   364 bits (935),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RH+E YP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +GKREK  I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T+EIRSIWIS
Sbjct  410  PVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP M
Sbjct  470  YWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   364 bits (934),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL  VGR+VLN+NIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLLLVGRMVLNRNIDNFFTENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDG MNF HRDEE+DYFPSR+DPVRHAE++P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +C+GKREKC+I KENNFKQPGERYRSF+ DRQERFI RWVDALSDPR+T+EI SIWIS
Sbjct  410  PQICSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSLGQK+A+ LN++PNM
Sbjct  470  YWSQCDKSLGQKLATHLNLKPNM  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   363 bits (933),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENE LAF P++VVPGIYY++DK+LQ RIF+YS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH+DGSMNFMHRDEE+DYFPSR+DPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +C GKREK VI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPR+TYEIRSIWIS
Sbjct  410  STICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRP  203
            YWSQAD+SLGQK+ASRLN++P
Sbjct  470  YWSQADRSLGQKLASRLNVKP  490



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   363 bits (933),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF+YS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWIS
Sbjct  410  SNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ SRLN+RP++
Sbjct  470  YWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   363 bits (933),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIIPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDG+MNFMHRDEE+DYFPSR+DP +HA RYP P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            ++ C G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI+SIW+S
Sbjct  410  SSTCNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKSIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+ASRL+ +P+M
Sbjct  470  YWSQADRSLGQKLASRLSAKPSM  492



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   363 bits (933),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENE LAF P++VVPGIYY++DK+LQ RIF+YS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH+DGSMNFMHRDEE+DYFPSR+DPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +C GKREK VI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPR+TYEIRSIWIS
Sbjct  410  STICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRP  203
            YWSQAD+SLGQK+ASRLN++P
Sbjct  470  YWSQADRSLGQKLASRLNVKP  490



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+ P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +  GKREKC+I KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIRSIWIS
Sbjct  410  PRILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LN++P++
Sbjct  470  YWSQADRSLGQKIASHLNLKPSI  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   363 bits (932),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF+YS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKVLQTRIFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWIS
Sbjct  410  SNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ SRLN+RP++
Sbjct  470  YWSQADKSLGQKLLSRLNVRPSI  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  203  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  262

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLP NAPKC+ HNNH+DG MNFM RDEEI+YFPSR DP RHAERYP P
Sbjct  263  DTQRYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQP  322

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +AV TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+IWIS
Sbjct  323  SAVYTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWIS  382

Query  265  YWSQADKSLGQKIASRLNMRPN  200
            YWSQADKSLG K+AS  N++ N
Sbjct  383  YWSQADKSLGHKLASHFNLKIN  404



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRP  203
            YW+QADKSLGQK+ASRLN+RP
Sbjct  470  YWTQADKSLGQKLASRLNVRP  490



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   362 bits (930),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+VPLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RYP P
Sbjct  350  DTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +A  TG+REK VI KENNFKQPGERYRS+ P RQ+RFI RW+DALSDPR+T+EIRSIW+S
Sbjct  410  SATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+ASRL+ +P+M
Sbjct  470  YWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 195/229 (85%), Gaps = 26/229 (11%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREK--------------------------CVIGKENNFKQPGERYRSFSPDRQ  344
             AVC+GKRE+                          C+I KENNFK+PGERYRSF+P+RQ
Sbjct  410  PAVCSGKRERVSNQIKPIFFSVSVSYGSESLKFVLQCIIEKENNFKEPGERYRSFAPERQ  469

Query  343  ERFICRWVDALSDPRITYEIRSIWISYWSQADKSLGQKIASRLNMRPNM  197
            ERFI RW++ALSDPRIT+EIRSIWISYWSQADKSLGQK+ASRLN+RP++
Sbjct  470  ERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  518



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DP  HAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AV TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+IWIS
Sbjct  410  PAVYTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWIS  469

Query  265  YWSQADKSLGQKIASRLNMR  206
            YWSQADKSLGQK+ASRLN++
Sbjct  470  YWSQADKSLGQKLASRLNVK  489



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFVENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V  GKR++C+I KENNFKQPGERYRS++PDRQERFICRWVDALS+PR+T+EIR+IW+S
Sbjct  410  PRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN++P M
Sbjct  470  YWSQADKSLGQKLASRLNVKPTM  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +GKR K  I KENNFKQPG+RYRS++PDRQERFI RWV+ALSDPR+T+EIRSIW+S
Sbjct  410  PVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP M
Sbjct  470  YWSQADKSLGQKLASRLNVRPAM  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+VPLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RYP P
Sbjct  350  DTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +A  TG+REK VI KENNFKQPGERYRS+ P RQ+RFI RW+DALSDPR+T+EIRSIW+S
Sbjct  410  SATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+ASRL+ +P+M
Sbjct  470  YWSQADRSLGQKLASRLSAKPSM  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRY P RHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +++ TGKR+KCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+ R+TYEIRSIWIS
Sbjct  410  SSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+S GQK+A+RLN+RP++
Sbjct  470  YWSQADRSFGQKLATRLNVRPSI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++Y PSR DP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TGKREK +I KENNFKQPGE YRS++PDRQERF+CRWVDALSDPR T+EIRSIWIS
Sbjct  410  PRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP M
Sbjct  470  YWSQADKSLGQKLASRLNIRPTM  492



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   362 bits (929),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT 
Sbjct  350  DSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              VC+G REKC IGKENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWIS
Sbjct  410  PIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+A+RLN+RPN 
Sbjct  470  YWSQADKSLGQKLATRLNVRPNF  492



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   362 bits (928),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+ YSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V  GKRE+ +I KENNFKQPGERYRS  P RQERFICR VDAL DPRIT+EIRSIW+S
Sbjct  410  SNVINGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALFDPRITHEIRSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW QADKSLG K+ASRLN+RP M
Sbjct  470  YWFQADKSLGMKVASRLNVRPTM  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   362 bits (928),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+
Sbjct  291  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYA  350

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAER+PTP
Sbjct  351  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTP  410

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A  +GKRE+C+  KENNFKQPGERYR+++PDRQ+RF  RW++ALSDPR+T+E+RSIWIS
Sbjct  411  PAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWIS  470

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LNMRP++
Sbjct  471  YWSQADRSLGQKIASHLNMRPSI  493



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   362 bits (928),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPAN+PKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER P P
Sbjct  350  DTQRHRLGPNYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
                 GKREKC+I KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIRSIWIS
Sbjct  410  PRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LN++P++
Sbjct  470  YWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   361 bits (927),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAER+PTP
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A  +GKRE+C+  KENNFKQPGERYR+++PDRQ+RF  RW++ALSDPR+T+E+RSIWIS
Sbjct  410  PAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LNMRP++
Sbjct  470  YWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   361 bits (926),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +GKR K  I KENNFKQPG+RYRS++PDRQERFI RWV+ALSDPR+T+EIRSIW+S
Sbjct  410  PVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LN+RP M
Sbjct  470  YWSQADKSLGQKLASHLNVRPTM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   361 bits (926),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDIIPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RYP P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +   TG+REK VI KENNFKQPGERYRS+ P RQERFI RW+DALSDPR+T+EIRSIW+S
Sbjct  410  SVNLTGRREKTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+ASRL+ +P+M
Sbjct  470  YWSQADRSLGQKLASRLSAKPSM  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   360 bits (925),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPLP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + TG+R++C++ KENNFKQPGERYRSFS DRQERFI R VDALSDPR+T+EIRSIWIS
Sbjct  410  PPMLTGRRDRCMVQKENNFKQPGERYRSFSTDRQERFISRLVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QA KSLGQK+ASRLN++P++
Sbjct  470  YWTQACKSLGQKLASRLNVKPSI  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   359 bits (922),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR DP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TGKREK +I KENNFKQPGE YRS++P RQERF+CRWVDALSD R T+EIRSIWIS
Sbjct  410  PRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN+RP M
Sbjct  470  YWSQADKSLGQKLASRLNIRPTM  492



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   359 bits (921),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+VPLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+S
Sbjct  410  SRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRL+ +P+M
Sbjct  470  YWSQADKSLGQKLASRLSSKPSM  492



>gb|ACN36234.1| unknown [Zea mays]
Length=340

 Score =   353 bits (907),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYS
Sbjct  138  TKTWPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYS  197

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P
Sbjct  198  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIP  257

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S
Sbjct  258  TAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLS  317

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
             WSQAD+SLGQK+ASRL+ +P+M
Sbjct  318  NWSQADRSLGQKLASRLSAKPSM  340



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   358 bits (920),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+++VPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSR+DPVRHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAESHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +AV TG+REK +I KENNFKQ GERYRSF+PDRQER+I RWVDALSDPR T+EIRSIWIS
Sbjct  410  SAVYTGRREKSIIEKENNFKQAGERYRSFAPDRQERYIRRWVDALSDPRCTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+AS LN+RPN 
Sbjct  470  YWSQADKSLGQKLASHLNVRPNF  492



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   358 bits (920),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            A    G+REK  I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+S
Sbjct  410  ARALNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRL+ +P+M
Sbjct  470  YWSQADKSLGQKLASRLSAKPSM  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED+VPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIFSY+
Sbjct  290  TKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+D VRHAE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V  GKR++C+I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T EIRSIWIS
Sbjct  410  PPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQKIAS LN+RP+M
Sbjct  470  YWTQADKSLGQKIASCLNVRPSM  492



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT 
Sbjct  350  DSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              VC+G REKC I KENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWIS
Sbjct  410  PIVCSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+A+RLN+RPN 
Sbjct  470  YWSQADKSLGQKLATRLNVRPNF  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPG+YYS+DK+LQTR+F+YS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGVYYSNDKMLQTRLFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRY P RHAE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKR+KCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+TYEIRSIWIS
Sbjct  410  SNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+S GQK+A+RLN+RP++
Sbjct  470  YWSQADRSFGQKLATRLNVRPSI  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYS
Sbjct  324  TKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYS  383

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP P
Sbjct  384  DTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIP  443

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+S
Sbjct  444  SRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLS  503

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRL+ +P+M
Sbjct  504  YWSQADKSLGQKLASRLSSKPSM  526



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   358 bits (918),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P++VVPGIYY++DKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +   +G REKCVI KENNFKQPGERYRSF PDRQERF+ RWV ALSDPR+T+EI SIWIS
Sbjct  410  SHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ+DKSLGQKIA+RLNM+ NM
Sbjct  470  YWSQSDKSLGQKIAARLNMKANM  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   358 bits (918),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++P P
Sbjct  350  DSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AV +G+REK  I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+WIS
Sbjct  410  PAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LNMRPN+
Sbjct  470  YWSQADRSLGQKIASHLNMRPNI  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P ++VPG+YY++DKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFGPGLIVPGVYYTEDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +   TGKREKCVI KENNFKQPGERYRSF+P+RQERF+ RWV ALSDPR+T+EI SIWIS
Sbjct  410  SHTHTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSLGQKIA+RLNM+ NM
Sbjct  470  YWSQCDKSLGQKIAARLNMKANM  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQ VGR+VLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQAVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH+DG MNF+HRDEE++YFPSRYDPVRHAER P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TG+REKCVI KENNFKQPGERYRS+ PDRQ RFI RWV+ALSDPR+T+EI+SIWIS
Sbjct  410  SRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSLG+KIA+RLN++P+M
Sbjct  470  YWSQCDKSLGRKIATRLNVKPSM  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQ+PANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAER P P
Sbjct  350  DSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +  GKREKC+I KENNFKQPGERYRS++ DRQERF+ RWVDALS+PR+T+EIRSIWIS
Sbjct  410  PRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LN++P++
Sbjct  470  YWSQADRSLGQKIASHLNLKPSI  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +  G REKC I KENNFKQPGE+YRS++PDRQERFI RW+DALSDPR+T+EIR+IWI+
Sbjct  410  PRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWIT  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DK LGQK+ASRLN++P +
Sbjct  470  YWSQCDKFLGQKLASRLNIKPTL  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDKLLQTRIF+YS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGIYYSDDKLLQTRIFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNY+QLP NAPKC  HNNH DG MNFMHRDEE++YFPSRYDPVRHAER+P P
Sbjct  350  DTQRHRLGPNYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKRE+ VI KENNFKQPGERYRS++PDRQERFI R VDALSDPR+++EIRSIWIS
Sbjct  410  SNILTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQKIA+RLN+RP++
Sbjct  470  YWSQADKSLGQKIATRLNVRPSI  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   352 bits (902),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGR+VLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYS
Sbjct  137  TKTWPEDVFPLQPVGRMVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYS  196

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP ++A RYP P
Sbjct  197  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIP  256

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
                TG+R+K VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIRSIW+S
Sbjct  257  TVHITGRRDKTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLS  316

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
             WSQAD+SLGQK+ASRL+ +P+M
Sbjct  317  NWSQADRSLGQKLASRLSAKPSM  339



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   358 bits (919),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYS
Sbjct  331  TKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYS  390

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP P
Sbjct  391  DTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIP  450

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            A    G+REK  I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+S
Sbjct  451  ARALNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLS  510

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRL+ +P+M
Sbjct  511  YWSQADKSLGQKLASRLSAKPSM  533



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   357 bits (915),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++P P
Sbjct  350  DSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+G+REK  I KENNFKQ GER+RS++PDRQ+RF  RWVDALSDPR+T+EIRS+WIS
Sbjct  410  PAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS L+MRPN+
Sbjct  470  YWSQADRSLGQKIASHLSMRPNI  492



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+VPLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+S
Sbjct  410  SRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRP  203
            YWSQADKSLGQK+ASRL+ +P
Sbjct  470  YWSQADKSLGQKLASRLSSKP  490



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   356 bits (914),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQLAF P+ VVPGIYYS+DKLLQ RIF+YS
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFNPAHVVPGIYYSEDKLLQGRIFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DT R+RLGPNYLQLP NAPKC+ HNNHYDG MN MHRDEEIDYFPSRYDPVRHAER+P P
Sbjct  350  DTHRHRLGPNYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG+RE+ VI KENNFKQP ERYRS++PDRQERF+ RWVDALSDPR+T+EIRSIWIS
Sbjct  410  TRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQKIA RLN+RP M
Sbjct  470  YWSQADKSLGQKIAFRLNVRPTM  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKCVI KENNFKQ GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWIS
Sbjct  410  PRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG+MNFMHRDEE++YFPSR+D  RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKCVI KENNFKQ GERYRSF P RQ+RFI RWVDALSDPRIT+E+R IWIS
Sbjct  410  PRVLTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D QR+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++P P
Sbjct  350  DPQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+C+G+REK  I KENNFKQ GER+RS++PDRQ+RF  RWVDALSDPR+T+EIRS+WIS
Sbjct  410  PAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS L+MRPN+
Sbjct  470  YWSQADRSLGQKIASHLSMRPNI  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED+VPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIFSY+
Sbjct  382  TKIWPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYA  441

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+D VRHAE++P P
Sbjct  442  DTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIP  501

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V  GKR++C+I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T EIRSIWIS
Sbjct  502  PPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWIS  561

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQKIAS LN+RP+M
Sbjct  562  YWTQADKSLGQKIASCLNVRPSM  584



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKCVI KENNFKQ GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWIS
Sbjct  410  PRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P++VVPGIYY++DKLLQTRIFSYS
Sbjct  290  TKTWPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +   +G REKCVI KENNFKQPGERYRSF PDRQERF+ RWV ALSDPR+T+EI SIWI 
Sbjct  410  SHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIF  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ+DKSLGQKIA+RLNM+ NM
Sbjct  470  YWSQSDKSLGQKIAARLNMKANM  492



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAE+ P P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A  +  REKC I K+NNFKQPGERYRS++PDRQ+RF+ RWVDALSDPR+T+EIRSIWIS
Sbjct  410  TANFSACREKCNIPKQNNFKQPGERYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQKIAS LNMRP++
Sbjct  470  YWSQADRSLGQKIASHLNMRPSI  492



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   368 bits (945),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVCTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI+
Sbjct  410  PAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWIT  469

Query  265  YWSQADKSLGQKIASRLN  212
            YWSQAD+S+GQK+AS LN
Sbjct  470  YWSQADRSVGQKLASHLN  487


 Score =   359 bits (922),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  771  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  830

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQRYRLGPNYLQLP NAPKC+ HNNH+DG MNFM RDEEI+YFPSR DP RHAERYP P
Sbjct  831  DTQRYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQP  890

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +AV TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+IWIS
Sbjct  891  SAVYTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWIS  950

Query  265  YWSQADKSLGQKIASRLNMRPN  200
            YWSQADKSLG K+AS  N++ N
Sbjct  951  YWSQADKSLGHKLASHFNLKIN  972



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   355 bits (910),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDVLPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSRYDPVRHA++ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKNAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHADKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +   +G+REK  I KENNFKQPGERYRS+ PDRQERFI RWVDALSDPR+T EIRSIWIS
Sbjct  410  SVPFSGRREKVSIEKENNFKQPGERYRSWDPDRQERFIRRWVDALSDPRLTQEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQK+ASRLN+RP M
Sbjct  470  YWTQADKSLGQKLASRLNVRPTM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   354 bits (909),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWIS
Sbjct  410  PRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   354 bits (909),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            +  WPED++PLQPVGRLVLNKNIDN+F E EQLAF P+ VVPGIYY++DKLLQTRIF+Y 
Sbjct  290  SKIWPEDILPLQPVGRLVLNKNIDNYFAETEQLAFNPAFVVPGIYYTEDKLLQTRIFAYG  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNY+QLP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSR+DPVRHA R+P P
Sbjct  350  DTQRHRLGPNYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V  GKR++CVI KENNFKQ GERYRS++PDRQERFICRWVD LSD R+T+EIRSIWIS
Sbjct  410  STVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+A+RLN+RP M
Sbjct  470  YWSQADKSLGQKMATRLNVRPTM  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   354 bits (909),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWIS
Sbjct  410  PRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   354 bits (908),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWIS
Sbjct  410  PRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   347 bits (890),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY+
Sbjct  100  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYA  159

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+YP P
Sbjct  160  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMP  219

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+S
Sbjct  220  PRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVS  279

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRL ++PNM
Sbjct  280  YWSQCDASLGQKLASRLKIKPNM  302



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE+ YFPSRYDPVRHAE+ P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVIYFPSRYDPVRHAEQSPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + +GKR KCVI KENNFKQPGER+RS+ PDRQERFI R V ALSDPR+T+E+ +IW+S
Sbjct  410  PVMLSGKRNKCVIEKENNFKQPGERFRSWDPDRQERFIRRIVGALSDPRVTHEVCTIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPN  200
            YWSQADKSLGQKIASRLN++P+
Sbjct  470  YWSQADKSLGQKIASRLNVKPS  491



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYS
Sbjct  291  TKTWPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYS  350

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P
Sbjct  351  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIP  410

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S
Sbjct  411  TAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLS  470

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
             WSQAD+SLGQK+ASRL+ +P+M
Sbjct  471  NWSQADRSLGQKLASRLSAKPSM  493



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   348 bits (892),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  151  TKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  210

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  211  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  270

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWIS
Sbjct  271  PRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWIS  330

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D +LGQK+ASRLN++P+M
Sbjct  331  YWSQCDAALGQKLASRLNLKPSM  353



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGR+VLNKNIDNFF ENEQLAFCP IVVPGIYYSDDKLLQTRIFSYS
Sbjct  290  TRTWPEDILPLIPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V  G+REK +I KENNF++PG RYRSF P RQERFICRW+ ALSDPR+T EIRSIWIS
Sbjct  410  QNVLNGRREKQIIAKENNFEEPGVRYRSFDPARQERFICRWIGALSDPRVTPEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLG K+A+RLN++P M
Sbjct  470  YWSQADKSLGMKLANRLNVKPTM  492



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDVIPLQPVGRMVLNRNIDNFFTENEQLAFCPGVIVPGIYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYD  ++A RYP P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDAAKNAPRYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +   TG+REK +I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EIRSIW+S
Sbjct  410  SVPLTGRREKTMIKKENNFKQPGERYRSMDPARQERFIKRWIDALSDPRLTHEIRSIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D+SLGQK+ASRL+ +P+M
Sbjct  470  YWSQTDRSLGQKLASRLSAKPSM  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYS
Sbjct  290  TKTWPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP   A RYP P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +    G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+S
Sbjct  410  SRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+A RL+++P+M
Sbjct  470  YWSQADRSLGQKLAGRLSVKPSM  492



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   352 bits (902),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYS
Sbjct  289  TKTWPEDTFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYS  348

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P
Sbjct  349  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIP  408

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S
Sbjct  409  TAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLS  468

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
             WSQAD+SLGQK+ASRL+ +P+M
Sbjct  469  NWSQADRSLGQKLASRLSAKPSM  491



>prf||1803522A catalase
Length=491

 Score =   351 bits (900),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYS
Sbjct  289  TKTWPEDRFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYS  348

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P
Sbjct  349  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIP  408

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S
Sbjct  409  TAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLS  468

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
             WSQAD+SLGQK+ASRL+ +P+M
Sbjct  469  NWSQADRSLGQKLASRLSAKPSM  491



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   351 bits (900),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWIS
Sbjct  410  TRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   351 bits (900),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWIS
Sbjct  410  TRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   347 bits (891),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY+
Sbjct  196  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYA  255

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+YP P
Sbjct  256  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMP  315

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+S
Sbjct  316  PRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVS  375

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRL ++PNM
Sbjct  376  YWSQCDASLGQKLASRLKIKPNM  398



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   351 bits (900),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQ+RIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQSRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHR+EE++YFPSR +PVRHAE+YPT 
Sbjct  350  DSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHREEEVNYFPSRLNPVRHAEKYPTS  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              VC+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWIS
Sbjct  410  PIVCSGNREKCIIKKENNFQQPGERYRSWDSDRQERFVKRFVEALAEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+A+RLN++PN 
Sbjct  470  YWSQADKSLGQKLATRLNVKPNF  492



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYS
Sbjct  289  TKTWPEDRFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYS  348

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P
Sbjct  349  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIP  408

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S
Sbjct  409  TAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLS  468

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
             WSQAD+SLGQK+ASRL+ +P+M
Sbjct  469  NWSQADRSLGQKLASRLSAKPSM  491



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWIS
Sbjct  410  TRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+A CP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIALCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWIS
Sbjct  410  SRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWIS
Sbjct  410  TRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_010105996.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXC51646.1| Catalase isozyme 1 [Morus notabilis]
Length=359

 Score =   345 bits (886),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSYS
Sbjct  162  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYS  221

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHR+EE++YFPSRYDPVRHAERYP P
Sbjct  222  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIP  281

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +A+CTG+RE+ VI KENNFKQPGERYRSFSPDRQERFI RWV+ALSDPR+T+EIRSIWIS
Sbjct  282  SAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWIS  341

Query  265  YWSQA  251
            YWSQ 
Sbjct  342  YWSQV  346



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKN+DNFF ENEQLAF P+ VVPGIYYS+DKLLQ RIF+YS
Sbjct  290  TKEWPEDILPLQPVGRLVLNKNVDNFFAENEQLAFNPAFVVPGIYYSNDKLLQARIFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DT RYRLGPNYLQLP NAPKC+ HNNH+DG MN MHRDEEI+YFPS++DPVRHAERYP P
Sbjct  350  DTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKREK +I KENNFKQPGERYRS++PDRQERFI RW+ AL++PR+T+E RSIWIS
Sbjct  410  SQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQK+ASRL+ RP+M
Sbjct  470  YWTQADKSLGQKLASRLSARPSM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWIS
Sbjct  410  TRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|KHG21219.1| Catalase isozyme 1 [Gossypium arboreum]
Length=432

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 184/203 (91%), Gaps = 6/203 (3%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVV GIYYSDDKLLQTR+FSYS
Sbjct  236  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVRGIYYSDDKLLQTRVFSYS  295

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDE+I+YFPSRYDP  HAER+P P
Sbjct  296  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEQINYFPSRYDPSHHAERFPIP  355

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+CTGKREK      NNFKQPGERYRS++PDRQERFI  WVDALSDPR+T+EI SIWI+
Sbjct  356  PALCTGKREK------NNFKQPGERYRSWAPDRQERFINSWVDALSDPRVTHEICSIWIT  409

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+A RLN+RP++
Sbjct  410  YWSQADKSLGQKLACRLNVRPSI  432



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+ YS+DKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR DP R+AE +P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +A+C+GKREKCVI KENNFKQPGERYRS++PDRQERF+ R V  LSDPRIT+E+R+IWIS
Sbjct  410  SAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW Q DKSLGQK+A+RLN++P++
Sbjct  470  YWIQCDKSLGQKLATRLNVKPSI  492



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++P+QPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQ+RIFSY+
Sbjct  290  TKIWPEDVLPMQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQSRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHR+EE++YFPSR+DPVR+A++YPT 
Sbjct  350  DSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRNEEVNYFPSRFDPVRNAQKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              VC+G REKC+IGKENNFKQPGERYRS+   RQERF+ R+V+AL++PR+T+EIRSIWIS
Sbjct  410  PIVCSGNREKCIIGKENNFKQPGERYRSWDSARQERFVKRFVEALAEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+ASRLN RP+ 
Sbjct  470  YWSQADKSLGQKLASRLNARPSF  492



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPK + HNNH++G MNFMHRDEE++YFPSR+D VRH+E++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHSEKHPLP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG+  + +I KENNFKQPGERYRSF PDRQERFI R VDALSDPR+T+EIRSIWIS
Sbjct  410  PPVLTGRCTRAMIEKENNFKQPGERYRSFPPDRQERFIRRVVDALSDPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLG+KIASRLN+RP++
Sbjct  470  YWSQADKSLGEKIASRLNVRPSI  492



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYS
Sbjct  291  TKTWPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYS  350

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P
Sbjct  351  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIP  410

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A   G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S
Sbjct  411  TAHIAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLS  470

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
             WSQAD+SLGQK+ASRL+ +P++
Sbjct  471  NWSQADRSLGQKLASRLSAKPSI  493



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   347 bits (890),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 182/198 (92%), Gaps = 0/198 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T   PED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+
Sbjct  231  TRICPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYA  290

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQ+PANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAER P P
Sbjct  291  DSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVP  350

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +  GKREKC+I KENNFKQPGERYRS++ DRQERF+ RWVDALS+PR+T+EIRSIWIS
Sbjct  351  PRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWIS  410

Query  265  YWSQADKSLGQKIASRLN  212
            YWSQAD+SLGQKIAS LN
Sbjct  411  YWSQADRSLGQKIASHLN  428



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++YPT 
Sbjct  350  DSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
               C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWIS
Sbjct  410  PVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRP  203
            YW+QADKSLGQK+ASRLN+RP
Sbjct  470  YWTQADKSLGQKLASRLNVRP  490



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWIS
Sbjct  410  PRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D +LGQK+ASRLN++P+M
Sbjct  470  YWSQCDAALGQKLASRLNLKPSM  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWIS
Sbjct  410  PRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D +LGQK+ASRLN++P+M
Sbjct  470  YWSQCDAALGQKLASRLNLKPSM  492



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++YPT 
Sbjct  350  DSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
               C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWIS
Sbjct  410  PVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRP  203
            YW+QADKSLGQK+ASRLN+RP
Sbjct  470  YWTQADKSLGQKLASRLNVRP  490



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   349 bits (895),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDVLPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++YPT 
Sbjct  350  DSQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
               C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWIS
Sbjct  410  PVFCSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRP  203
            YW+QADKSLGQK+ASRLN+RP
Sbjct  470  YWTQADKSLGQKLASRLNVRP  490



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   348 bits (894),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVP I+YSDD +LQTRIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPFIHYSDDNVLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT 
Sbjct  350  DSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              VC+G REKC I KENNFKQPGERYRS+  DRQERF+ R+V+AL +PR+T+EIRSIWIS
Sbjct  410  PIVCSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALWEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+A+RLN+RPN 
Sbjct  470  YWSQADKSLGQKLATRLNVRPNF  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   348 bits (894),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPGI YS+DKLLQTRIFSYS
Sbjct  290  TKTWPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGISYSEDKLLQTRIFSYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLG NYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRH+ER+P P
Sbjct  350  DTQRHRLGSNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + +C+G+R+KCVI KENNF+QPGERYRS++PDRQERF+ R V  LSDPRIT+E+RSIWIS
Sbjct  410  STICSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+Q D+SLGQK+A RLN+RP++
Sbjct  470  YWTQCDRSLGQKLAFRLNVRPSI  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   348 bits (893),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWV ALSDPR+T+E  +IWIS
Sbjct  410  TRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVGALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   348 bits (893),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPTRHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V TG REKC+I KENNFKQ GER+RSF P RQ+RFI RWVDALSDPR+T+E  +IWI+
Sbjct  410  SRVLTGCREKCIIEKENNFKQAGERFRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWIN  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   362 bits (929),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  805   TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
             T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIFSY+
Sbjct  811   TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYA  870

Query  625   DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
             D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT 
Sbjct  871   DSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTT  930

Query  445   AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
               VC+G REKC IGKENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWIS
Sbjct  931   PIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWIS  990

Query  265   YWSQADKSLGQKIASRLNMRPNM  197
             YWSQADKSLGQK+A+RLN+RPN 
Sbjct  991   YWSQADKSLGQKLATRLNVRPNF  1013


 Score =   333 bits (853),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 178/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLN+ IDNFFNE EQLAF P +VVPGIYYSDDKLLQ RIF+Y 
Sbjct  329  TKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYG  388

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+Y+PS++DPVR AE+ PTP
Sbjct  389  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTP  448

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
                TG R KCVI KENNFKQ G+RYRS++PDRQ+RF+ RWV+ LS+PR+T+EIR IWIS
Sbjct  449  TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  508

Query  265  YWSQADKSLGQKIASRLNMRPN  200
            YWSQAD+SLGQK+ASRLN+RP+
Sbjct  509  YWSQADRSLGQKLASRLNVRPS  530



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   348 bits (893),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP +APKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWIS
Sbjct  410  TRVQTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+YP P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+S
Sbjct  410  PRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRL ++PNM
Sbjct  470  YWSQCDASLGQKLASRLKIKPNM  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   348 bits (892),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED+ PLQPVGR+VLN+NIDNFFNENEQLAF P IVVPGIYYSDDK LQ R F+Y 
Sbjct  290  TKEWPEDMFPLQPVGRMVLNRNIDNFFNENEQLAFNPGIVVPGIYYSDDKFLQARTFAYG  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNHYDG MNF HRDEE+DYFPSR+DPVRHAER P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPLP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              + +GKRE+CVI KENNFKQPG+RYRSF+PDRQERF+ R VDALSD R+T+EIRSIWIS
Sbjct  410  PQLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSLGQKIA+RLN++P+M
Sbjct  470  YWSQCDKSLGQKIATRLNIKPHM  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   340 bits (873),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLN+NIDNFFNENEQLAF P +VVPGIYYSDDK+LQ RIF+Y 
Sbjct  89   TKWWPEDIIPLQPVGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYG  148

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC  HNNHYDG MNFMHRDEE+DYFPS++  V +AE++P P
Sbjct  149  DTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIP  208

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              +C+GKREK  I KENNFK PG+RYRS++PDRQERFI R VD LSDPR+T+EIRSIW+S
Sbjct  209  GRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVS  268

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQKIASRLN+RPN+
Sbjct  269  YWSQADKSLGQKIASRLNVRPNI  291



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  345  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  404

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  405  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  464

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI R VDALSDPR+T+E RSIWIS
Sbjct  465  PRVLTGCREKCIIHKENNFKQAGERYRSFDPARQDRFIQRVVDALSDPRVTHEHRSIWIS  524

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  525  YWSQCDASLGQKLASRLNLKPNM  547



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG  EKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWIS
Sbjct  410  TRVLTGCGEKCIIQKENNFKQAGERYRSFDPARQDRFIRRWVDALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHA + P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAGKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IW+S
Sbjct  410  TRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWMS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRLN++PNM
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QRYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT 
Sbjct  350  DSQRYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
               C+G REK +IGKENNFKQPGERYRS+  DRQERF+ R+++ALS+PR+T+EIRSIW+S
Sbjct  410  PITCSGNREKSIIGKENNFKQPGERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQK+A+ LN++ N+
Sbjct  470  YWTQADKSLGQKLATCLNVKANI  492



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+++VPG++YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPK   HNNH++G MNFMHRDEE++YFPSRYDP RHAER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKNGHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERHPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +GKR++  I KENNFK+PG R+RS++ DRQERFI RWVDALSDPR+T+EIR IWIS
Sbjct  410  PVVLSGKRDRICIEKENNFKEPGVRFRSWATDRQERFIRRWVDALSDPRLTHEIRGIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQK+ASRLN+RP M
Sbjct  470  YWTQADKSLGQKLASRLNVRPTM  492



>gb|ADN94253.1| catalase [Puccinellia chinampoensis]
Length=492

 Score =   346 bits (887),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAITVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DPVRHAE+YP P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            +   TG REKC+I KENNFKQ GER+RSF P  Q+RFI  WVDAL+D R+T+EI+ IWIS
Sbjct  410  SRTLTGCREKCIIEKENNFKQAGERFRSFDPAGQDRFIQWWVDALTDTRVTHEIQGIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRL M+PNM
Sbjct  470  YWSQCDASLGQKLASRLKMKPNM  492



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   345 bits (886),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR++LNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMILNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH++G MNF+HRDEE++YFPSR+DP RHA++YP P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRFDPTRHAQKYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSD R+T+EI+ IWIS
Sbjct  410  TRVLTGCREKCIIEKENNFKQAGERYRSFDPARQDRFIQRWVDALSDARVTHEIQGIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ SRL  +PNM
Sbjct  470  YWSQCDTSLGQKLGSRLKAKPNM  492



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QRYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT 
Sbjct  350  DSQRYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
               C+G REK +IGKENNF+QPGERYRS+  DRQERF+ R+++ALS+PR+T+EIRSIW+S
Sbjct  410  PITCSGNREKSIIGKENNFQQPGERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQK+A+ LN++ N+
Sbjct  470  YWTQADKSLGQKLATCLNVKANI  492



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP +APKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P  Q+RFI RWVDALSDPR+T+E  +IWIS
Sbjct  410  TRVLTGCREKCIIQKENNFKQAGERYRSFDPAGQDRFIQRWVDALSDPRVTHEHHTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQ++ASRLN++PNM
Sbjct  470  YWSQCDASLGQELASRLNLKPNM  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   337 bits (864),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED+ PLQ +GRLVLN+NIDN+F ENE LAF P  VVPGI+YS+DKL Q R F+Y+
Sbjct  59   TKIWPEDMFPLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYA  118

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNY  LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER P P
Sbjct  119  DTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLP  178

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+ +G+REKCVI KENNFKQPG+RYRS++PDRQERF+CR V+ALSDPRIT+EIRSIW+S
Sbjct  179  HAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVS  238

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSLGQK+ASRLN+RPN 
Sbjct  239  YWSQCDKSLGQKLASRLNVRPNF  261



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   345 bits (885),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAISVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWIS
Sbjct  410  PRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D +LGQK+ SRLN++P+M
Sbjct  470  YWSQCDAALGQKLPSRLNLKPSM  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   358 bits (919),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNE EQ+AFCP++VVPGI+YSDDKLLQTRIFSY+
Sbjct  779  TKIWPEDILPLQPVGRLVLNKNIDNFFNEYEQIAFCPALVVPGIHYSDDKLLQTRIFSYA  838

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT 
Sbjct  839  DSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTT  898

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              VCTG REKC IGKENNF+QPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWIS
Sbjct  899  PIVCTGNREKCFIGKENNFQQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWIS  958

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQADKSLGQK+A+RLN+RPN 
Sbjct  959  YWSQADKSLGQKLATRLNVRPNF  981


 Score =   330 bits (845),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 177/202 (88%), Gaps = 0/202 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLN+ IDNFFNE EQLAF P +VVPGIYYSDDKLLQ RIF+Y 
Sbjct  297  TKIWPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYG  356

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+Y+PS++DPVR AE+ P P
Sbjct  357  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIP  416

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
                TG R KCVI KENNFKQ G+RYRS++PDRQ+RF+ RWV+ LS+PR+T+EIR IWIS
Sbjct  417  TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  476

Query  265  YWSQADKSLGQKIASRLNMRPN  200
            YWSQAD+SLGQK+ASRLN+RP+
Sbjct  477  YWSQADRSLGQKLASRLNVRPS  498



>ref|XP_010498497.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QRYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT 
Sbjct  350  DSQRYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKYPTT  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
               C+G REK +IGKENNFKQPG+RYRS+  DRQERF+ R+++ALS+PR+T+EIRSIW+S
Sbjct  410  PITCSGNREKSIIGKENNFKQPGDRYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQK+A+ LN++ N+
Sbjct  470  YWTQADKSLGQKLATCLNVKANI  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED+ PLQ +GRLVLN+NIDN+F ENE LAF P  VVPGI+YS+DKL Q R F+Y+
Sbjct  68   TKIWPEDMFPLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYA  127

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNY  LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER P P
Sbjct  128  DTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLP  187

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+ +G+REKCVI KENNFKQPG+RYRS++PDRQERF+CR V+ALSDPRIT+EIRSIW+S
Sbjct  188  HAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVS  247

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ DKSLGQK+ASRLN+RPN 
Sbjct  248  YWSQCDKSLGQKLASRLNVRPNF  270



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED+ PLQP+GRLVLN+NIDN+F ENE LAF P+ VVPGI+YS+DKL Q R F+YS
Sbjct  290  TKIWPEDIFPLQPIGRLVLNRNIDNWFAENEMLAFNPAHVVPGIHYSNDKLFQLRTFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNY+QLP NAPKC  HNNHYDG MNFMHRDEEIDYF SRYDPVRHAERYP P
Sbjct  350  DTQRHRLGPNYMQLPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             A+ +G+REKCVI KENNFKQPGERYRS++PDRQERF+CR V+ALSDPRIT+EIR IW+S
Sbjct  410  NAIISGRREKCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D+SLGQK+ASRLN+RPN+
Sbjct  470  YWSQCDQSLGQKLASRLNVRPNI  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   344 bits (883),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLN+N+DNFF ENEQLAF P+ VVPGIY+S+DKLLQ RIF+YS
Sbjct  290  TKIWPEDILPLQPVGRLVLNQNVDNFFAENEQLAFNPAFVVPGIYFSNDKLLQARIFAYS  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DT RYRLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEEI+YFPS++DPVRHAERYP P
Sbjct  350  DTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKRE+ +I KENNFKQ GERYRS++PDRQERFI RW+ ALS+PR+T+E RSIWIS
Sbjct  410  SQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKS+GQK+AS L+ RP+M
Sbjct  470  YWTQADKSIGQKLASSLSARPSM  492



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   343 bits (881),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFF ENE LAF P IVVPGIYYS+DK+LQ RIF+Y 
Sbjct  275  TKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYG  334

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC   NNHYDG MNFMHRDEE+DYFPSRYDP RHAERYP P
Sbjct  335  DTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIP  394

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V TG+REK  I KENNFKQPGERYRS++PDRQERF+ RW+ AL DPR+T+E+RSIW+S
Sbjct  395  SDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVS  454

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+ASRLN+RP++
Sbjct  455  YWSQADRSLGQKLASRLNVRPSI  477



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   344 bits (882),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFF ENE LAF P IVVPGIYYS+DK+LQ RIF+Y 
Sbjct  291  TKWWPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYG  350

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC   NNHYDG MNFMHRDEE+DYFPSRYDP RHAERYP P
Sbjct  351  DTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIP  410

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + V TG+REK  I KENNFKQPGERYRS++PDRQERF+ RW+ AL DPR+T+E+RSIW+S
Sbjct  411  SDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVS  470

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQAD+SLGQK+ASRLN+RP++
Sbjct  471  YWSQADRSLGQKLASRLNVRPSI  493



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   344 bits (883),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PL PVGRLVLN+N+DNFF ENE LAF PS++VPGIY+S+DK+LQTRIF+Y+
Sbjct  311  TKIWPEDILPLMPVGRLVLNRNVDNFFAENEMLAFSPSMIVPGIYFSNDKMLQTRIFAYA  370

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+R+GPNYLQLP NAPKC  HNNH+DG+MNFMHRDEE++YFPSRYDP RHAE++P P
Sbjct  371  DTQRHRIGPNYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIP  430

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +G+R K VI KENNFKQPG+RYRS++PDRQERFI RW+DALSDPR+T EIRSIW+S
Sbjct  431  PVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVS  490

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YW+QADKSLGQK+ASRLN+RP M
Sbjct  491  YWTQADKSLGQKLASRLNVRPAM  513



>sp|P55313.1|CATA2_WHEAT RecName: Full=Catalase [Triticum aestivum]
 emb|CAA64077.1| catalase [Triticum aestivum]
Length=492

 Score =   343 bits (879),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR DP RHAE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRVDPTRHAEKDPMP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
              V +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+S
Sbjct  410  PRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
            YWSQ D SLGQK+ASRL ++PNM
Sbjct  470  YWSQCDASLGQKLASRLKIKPNM  492



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -1

Query  745  KNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQRYRLGPNYLQLPANAPK  566
            +NIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTR+FSY+DTQR+RLGPNYLQLP N+PK
Sbjct  267  RNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNSPK  326

Query  565  CSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAVCTGKREKCVIGKENNFK  386
            CS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AVC+GKRE+CVI KENNFK
Sbjct  327  CSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFK  386

Query  385  QPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWSQADKSLGQKIASRLNMR  206
            +PGERYRSF+P+R ERFI RW+DALSDPRIT+EIRSIWISYWSQADKSLGQK+ASRLN+R
Sbjct  387  EPGERYRSFTPERLERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVR  446

Query  205  PNM  197
            PN+
Sbjct  447  PNI  449



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+
Sbjct  290  TKTWPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
            + + TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWIS
Sbjct  410  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  469

Query  265  YWSQA  251
            YWSQ 
Sbjct  470  YWSQV  474



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   341 bits (875),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+CVI KENNFK+PG RYRSF+PDRQERFI RW++ALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGGRYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  265  YWSQA  251
            YWSQ 
Sbjct  470  YWSQV  474



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   341 bits (874),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T  WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCP+IVVPG +YSDDKLLQ+RIFSY+
Sbjct  290  TKIWPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            D+QR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHAE+YP  
Sbjct  350  DSQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQN  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
               C G REKC+I KENNFKQPGERYRS+  DRQERF+ R+VDAL++PR+T+EIRSIWIS
Sbjct  410  PIACAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWIS  469

Query  265  YWSQADKSLGQKIASRLNMRPNM  197
             W++AD+SLGQK+A+RLN+ PN 
Sbjct  470  NWTKADESLGQKLATRLNVSPNF  492



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   340 bits (873),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -1

Query  805  TXTWPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYS  626
            T TWPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+
Sbjct  290  TKTWPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYA  349

Query  625  DTQRYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTP  446
            DTQR+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  445  AAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWIS  266
             AVC+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  265  YWSQA  251
            YWSQ 
Sbjct  470  YWSQV  474



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1606838546005