BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020A20

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004247610.1|  PREDICTED: transmembrane emp24 domain-contai...    310   4e-103   Solanum lycopersicum
ref|XP_009773202.1|  PREDICTED: transmembrane emp24 domain-contai...    310   5e-103   Nicotiana sylvestris
ref|XP_009631810.1|  PREDICTED: transmembrane emp24 domain-contai...    309   8e-103   Nicotiana tomentosiformis
gb|KDP40237.1|  hypothetical protein JCGZ_02235                         309   9e-103   Jatropha curcas
ref|XP_006363461.1|  PREDICTED: transmembrane emp24 domain-contai...    309   1e-102   Solanum tuberosum [potatoes]
ref|XP_002283487.1|  PREDICTED: transmembrane emp24 domain-contai...    308   2e-102   Vitis vinifera
ref|XP_010107717.1|  Transmembrane emp24 domain-containing protein A    308   2e-102   Morus notabilis
ref|XP_009145255.1|  PREDICTED: transmembrane emp24 domain-contai...    308   3e-102   Brassica rapa
emb|CDY10314.1|  BnaC05g29650D                                          308   3e-102   Brassica napus [oilseed rape]
ref|XP_007034875.1|  Emp24/gp25L/p24 family/GOLD family protein i...    307   4e-102   Theobroma cacao [chocolate]
ref|XP_011090665.1|  PREDICTED: transmembrane emp24 domain-contai...    307   4e-102   Sesamum indicum [beniseed]
ref|XP_002517064.1|  coated vesicle membrane protein, putative          306   8e-102   Ricinus communis
ref|XP_008438614.1|  PREDICTED: transmembrane emp24 domain-contai...    306   1e-101   Cucumis melo [Oriental melon]
ref|XP_004134119.1|  PREDICTED: transmembrane emp24 domain-contai...    306   1e-101   Cucumis sativus [cucumbers]
ref|XP_006406122.1|  hypothetical protein EUTSA_v10021495mg             305   3e-101   Eutrema salsugineum [saltwater cress]
ref|XP_010693774.1|  PREDICTED: transmembrane emp24 domain-contai...    305   4e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011030626.1|  PREDICTED: transmembrane emp24 domain-contai...    305   4e-101   Populus euphratica
gb|AFK37006.1|  unknown                                                 305   5e-101   Lotus japonicus
gb|KDO74439.1|  hypothetical protein CISIN_1g028009mg                   305   5e-101   Citrus sinensis [apfelsine]
ref|XP_009135831.1|  PREDICTED: transmembrane emp24 domain-contai...    305   6e-101   Brassica rapa
ref|XP_010511795.1|  PREDICTED: transmembrane emp24 domain-contai...    304   9e-101   Camelina sativa [gold-of-pleasure]
gb|KFK39568.1|  hypothetical protein AALP_AA3G261200                    304   9e-101   Arabis alpina [alpine rockcress]
emb|CDY61077.1|  BnaCnng37320D                                          304   1e-100   Brassica napus [oilseed rape]
ref|XP_010466578.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    304   1e-100   Camelina sativa [gold-of-pleasure]
ref|NP_188924.3|  transmembrane emp24 domain-containing protein p...    303   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006489467.1|  PREDICTED: transmembrane emp24 domain-contai...    303   1e-100   Citrus sinensis [apfelsine]
ref|XP_006299601.1|  hypothetical protein CARUB_v10015779mg             303   2e-100   Capsella rubella
ref|XP_002883380.1|  hypothetical protein ARALYDRAFT_479795             303   2e-100   
gb|KHN02756.1|  Transmembrane emp24 domain-containing protein A         303   2e-100   Glycine soja [wild soybean]
ref|NP_001238453.1|  uncharacterized protein LOC100306668 precursor     303   2e-100   Glycine max [soybeans]
emb|CDY46609.1|  BnaCnng14310D                                          303   2e-100   Brassica napus [oilseed rape]
ref|XP_010532582.1|  PREDICTED: transmembrane emp24 domain-contai...    303   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_006420043.1|  hypothetical protein CICLE_v10005664mg             304   3e-100   
ref|XP_010279262.1|  PREDICTED: transmembrane emp24 domain-contai...    302   3e-100   Nelumbo nucifera [Indian lotus]
gb|EYU41435.1|  hypothetical protein MIMGU_mgv1a013526mg                302   5e-100   Erythranthe guttata [common monkey flower]
ref|XP_010259153.1|  PREDICTED: transmembrane emp24 domain-contai...    302   5e-100   Nelumbo nucifera [Indian lotus]
ref|NP_001238171.1|  uncharacterized protein LOC100499675 precursor     301   9e-100   Glycine max [soybeans]
ref|XP_009108603.1|  PREDICTED: transmembrane emp24 domain-contai...    301   9e-100   Brassica rapa
emb|CDY34226.1|  BnaA01g24430D                                          301   1e-99    Brassica napus [oilseed rape]
gb|KEH43778.1|  emp24/gp25L/p24 family protein                          301   1e-99    Medicago truncatula
ref|XP_007143318.1|  hypothetical protein PHAVU_007G062200g             301   2e-99    Phaseolus vulgaris [French bean]
ref|XP_004496668.1|  PREDICTED: transmembrane emp24 domain-contai...    297   4e-98    Cicer arietinum [garbanzo]
gb|KHG26199.1|  Transmembrane emp24 domain-containing A                 297   5e-98    Gossypium arboreum [tree cotton]
ref|XP_007223416.1|  hypothetical protein PRUPE_ppa011292mg             297   6e-98    Prunus persica
ref|XP_008224230.1|  PREDICTED: transmembrane emp24 domain-contai...    296   7e-98    Prunus mume [ume]
ref|XP_010034397.1|  PREDICTED: transmembrane emp24 domain-contai...    296   1e-97    Eucalyptus grandis [rose gum]
ref|XP_004296587.1|  PREDICTED: transmembrane emp24 domain-contai...    295   2e-97    Fragaria vesca subsp. vesca
gb|KJB38216.1|  hypothetical protein B456_006G242900                    293   1e-96    Gossypium raimondii
ref|XP_003559757.1|  PREDICTED: transmembrane emp24 domain-contai...    293   2e-96    Brachypodium distachyon [annual false brome]
gb|AFP87418.1|  putative EMP24-domain containing protein                292   3e-96    Triticum turgidum subsp. durum
ref|XP_004981806.1|  PREDICTED: transmembrane emp24 domain-contai...    292   3e-96    Setaria italica
ref|XP_002463892.1|  hypothetical protein SORBIDRAFT_01g008390          291   5e-96    Sorghum bicolor [broomcorn]
ref|XP_009778405.1|  PREDICTED: transmembrane emp24 domain-contai...    292   6e-96    Nicotiana sylvestris
gb|EAY91831.1|  hypothetical protein OsI_13477                          291   6e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_009590337.1|  PREDICTED: transmembrane emp24 domain-contai...    291   9e-96    
dbj|BAJ97536.1|  predicted protein                                      291   1e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001051240.1|  Os03g0744800                                       290   1e-95    
ref|XP_010525219.1|  PREDICTED: transmembrane emp24 domain-contai...    291   1e-95    Tarenaya hassleriana [spider flower]
emb|CDO99114.1|  unnamed protein product                                291   2e-95    Coffea canephora [robusta coffee]
ref|NP_001136501.1|  uncharacterized protein LOC100216616 precursor     290   3e-95    Zea mays [maize]
ref|XP_009399353.1|  PREDICTED: transmembrane emp24 domain-contai...    289   8e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010923517.1|  PREDICTED: transmembrane emp24 domain-contai...    288   1e-94    Elaeis guineensis
ref|XP_010917620.1|  PREDICTED: transmembrane emp24 domain-contai...    288   1e-94    Elaeis guineensis
ref|XP_010551705.1|  PREDICTED: transmembrane emp24 domain-contai...    288   2e-94    Tarenaya hassleriana [spider flower]
ref|NP_001141300.1|  Suppressor/enhancer of lin-12 protein 9 prec...    287   3e-94    Zea mays [maize]
ref|XP_009398371.1|  PREDICTED: transmembrane emp24 domain-contai...    287   3e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006838935.1|  hypothetical protein AMTR_s00002p00270370          288   3e-94    Amborella trichopoda
ref|XP_008776017.1|  PREDICTED: transmembrane emp24 domain-contai...    287   5e-94    Phoenix dactylifera
ref|XP_009343969.1|  PREDICTED: transmembrane emp24 domain-contai...    286   9e-94    Pyrus x bretschneideri [bai li]
ref|XP_004493724.1|  PREDICTED: transmembrane emp24 domain-contai...    285   2e-93    
ref|XP_003553473.1|  PREDICTED: transmembrane emp24 domain-contai...    285   2e-93    Glycine max [soybeans]
ref|XP_010317396.1|  PREDICTED: transmembrane emp24 domain-contai...    285   2e-93    Solanum lycopersicum
ref|XP_006356044.1|  PREDICTED: transmembrane emp24 domain-contai...    285   3e-93    Solanum tuberosum [potatoes]
emb|CBI25047.3|  unnamed protein product                                283   4e-93    Vitis vinifera
ref|XP_002274733.1|  PREDICTED: transmembrane emp24 domain-contai...    284   5e-93    Vitis vinifera
gb|KJB12566.1|  hypothetical protein B456_002G024500                    283   9e-93    Gossypium raimondii
ref|XP_008391009.1|  PREDICTED: transmembrane emp24 domain-contai...    283   1e-92    
ref|XP_009375992.1|  PREDICTED: transmembrane emp24 domain-contai...    281   5e-92    Pyrus x bretschneideri [bai li]
emb|CAN65862.1|  hypothetical protein VITISV_007728                     281   5e-92    Vitis vinifera
ref|XP_009371933.1|  PREDICTED: transmembrane emp24 domain-contai...    281   6e-92    Pyrus x bretschneideri [bai li]
gb|KEH23828.1|  emp24/gp25L/p24 family/GOLD protein                     280   2e-91    Medicago truncatula
ref|XP_009370753.1|  PREDICTED: transmembrane emp24 domain-contai...    278   1e-90    Pyrus x bretschneideri [bai li]
ref|XP_008351862.1|  PREDICTED: transmembrane emp24 domain-contai...    276   5e-90    Malus domestica [apple tree]
gb|ABK22222.1|  unknown                                                 275   1e-89    Picea sitchensis
ref|XP_011073468.1|  PREDICTED: transmembrane emp24 domain-contai...    275   2e-89    Sesamum indicum [beniseed]
ref|XP_006651809.1|  PREDICTED: transmembrane emp24 domain-contai...    275   3e-89    
ref|XP_009350369.1|  PREDICTED: transmembrane emp24 domain-contai...    274   5e-89    Pyrus x bretschneideri [bai li]
ref|XP_008235354.1|  PREDICTED: transmembrane emp24 domain-contai...    274   6e-89    Prunus mume [ume]
ref|XP_007162469.1|  hypothetical protein PHAVU_001G155000g             273   8e-89    Phaseolus vulgaris [French bean]
gb|EPS65381.1|  hypothetical protein M569_09395                         271   7e-88    Genlisea aurea
ref|XP_007200451.1|  hypothetical protein PRUPE_ppa011262mg             270   3e-87    
ref|XP_006443971.1|  hypothetical protein CICLE_v10024247mg             269   4e-87    Citrus clementina [clementine]
ref|XP_004292584.1|  PREDICTED: transmembrane emp24 domain-contai...    268   1e-86    Fragaria vesca subsp. vesca
gb|EYU23694.1|  hypothetical protein MIMGU_mgv1a013689mg                267   3e-86    Erythranthe guttata [common monkey flower]
gb|EEE59914.1|  hypothetical protein OsJ_12539                          258   9e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010490045.1|  PREDICTED: transmembrane emp24 domain-contai...    256   3e-82    
ref|XP_002315749.2|  emp24/gp25L/p24 family protein                     255   5e-82    
ref|XP_007050472.1|  Emp24/gp25L/p24 family/GOLD family protein         255   2e-81    
ref|XP_010646131.1|  PREDICTED: transmembrane emp24 domain-contai...    253   6e-81    Vitis vinifera
ref|XP_010935726.1|  PREDICTED: transmembrane emp24 domain-contai...    250   1e-79    Elaeis guineensis
gb|EMS56815.1|  Transmembrane emp24 domain-containing protein A         244   2e-78    Triticum urartu
emb|CAN73344.1|  hypothetical protein VITISV_007239                     245   7e-78    Vitis vinifera
ref|XP_007034876.1|  Emp24/gp25L/p24 family/GOLD family protein i...    230   2e-72    
gb|KJB72278.1|  hypothetical protein B456_011G168300                    226   9e-71    Gossypium raimondii
gb|KHG16537.1|  Transmembrane emp24 domain-containing 2                 224   5e-70    Gossypium arboreum [tree cotton]
ref|XP_008390949.1|  PREDICTED: transmembrane emp24 domain-contai...    224   1e-69    
ref|XP_008343630.1|  PREDICTED: transmembrane emp24 domain-contai...    222   9e-69    
ref|XP_008786160.1|  PREDICTED: transmembrane emp24 domain-contai...    218   2e-67    
ref|XP_002987714.1|  hypothetical protein SELMODRAFT_126578             216   2e-66    
ref|XP_002983175.1|  hypothetical protein SELMODRAFT_268686             216   2e-66    
ref|XP_001752961.1|  predicted protein                                  201   1e-60    
gb|KHN15723.1|  Endoplasmic reticulum vesicle protein 25                189   1e-56    Glycine soja [wild soybean]
ref|XP_001771034.1|  predicted protein                                  187   2e-55    
ref|XP_010527604.1|  PREDICTED: transmembrane emp24 domain-contai...    181   3e-54    Tarenaya hassleriana [spider flower]
ref|XP_010535328.1|  PREDICTED: transmembrane emp24 domain-contai...    145   6e-40    Tarenaya hassleriana [spider flower]
gb|KHG09153.1|  Transmembrane emp24 domain-containing 7                 145   8e-40    Gossypium arboreum [tree cotton]
ref|XP_008363663.1|  PREDICTED: transmembrane emp24 domain-contai...    142   8e-39    
ref|XP_008368791.1|  PREDICTED: transmembrane emp24 domain-contai...    142   9e-39    
ref|XP_002982857.1|  hypothetical protein SELMODRAFT_116990             122   3e-30    Selaginella moellendorffii
ref|XP_001766849.1|  predicted protein                                  122   4e-30    
ref|XP_002990957.1|  hypothetical protein SELMODRAFT_132599             121   6e-30    
ref|XP_001780055.1|  predicted protein                                  117   3e-28    
ref|XP_006474870.1|  PREDICTED: transmembrane emp24 domain-contai...    114   6e-27    Citrus sinensis [apfelsine]
gb|EYU42779.1|  hypothetical protein MIMGU_mgv1a013547mg                114   8e-27    Erythranthe guttata [common monkey flower]
ref|XP_005839577.1|  hypothetical protein GUITHDRAFT_157078             111   1e-26    Guillardia theta CCMP2712
ref|XP_007142524.1|  hypothetical protein PHAVU_008G288000g             113   1e-26    Phaseolus vulgaris [French bean]
gb|ABG66965.1|  LRR resistance protein-like protein                     108   2e-26    Gossypium arboreum [tree cotton]
dbj|BAK04640.1|  predicted protein                                      112   3e-26    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002265305.1|  PREDICTED: transmembrane emp24 domain-contai...    111   4e-26    Vitis vinifera
gb|KHN46897.1|  Transmembrane emp24 domain-containing protein 2         110   8e-26    Glycine soja [wild soybean]
gb|AFK47679.1|  unknown                                                 110   9e-26    Lotus japonicus
ref|XP_010243958.1|  PREDICTED: transmembrane emp24 domain-contai...    110   1e-25    Nelumbo nucifera [Indian lotus]
ref|XP_010238339.1|  PREDICTED: transmembrane emp24 domain-contai...    110   1e-25    Brachypodium distachyon [annual false brome]
gb|KDP39307.1|  hypothetical protein JCGZ_01064                         110   1e-25    Jatropha curcas
ref|XP_009394560.1|  PREDICTED: transmembrane emp24 domain-contai...    109   2e-25    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004491612.1|  PREDICTED: transmembrane emp24 domain-contai...    109   2e-25    Cicer arietinum [garbanzo]
ref|XP_003618033.1|  Transmembrane emp24 domain-containing protein      109   3e-25    Medicago truncatula
ref|XP_003618034.1|  Transmembrane emp24 domain-containing protein      109   3e-25    Medicago truncatula
ref|XP_006857765.1|  hypothetical protein AMTR_s00061p00199890          109   3e-25    
ref|XP_010942595.1|  PREDICTED: transmembrane emp24 domain-contai...    108   6e-25    Elaeis guineensis
ref|XP_003545588.1|  PREDICTED: transmembrane emp24 domain-contai...    108   8e-25    Glycine max [soybeans]
ref|XP_006574367.1|  PREDICTED: uncharacterized protein LOC100527...    108   8e-25    
ref|XP_010675969.1|  PREDICTED: transmembrane emp24 domain-contai...    108   9e-25    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004957295.1|  PREDICTED: transmembrane emp24 domain-contai...    107   1e-24    Setaria italica
ref|NP_001235792.1|  uncharacterized protein LOC100527418               107   1e-24    
ref|XP_008219687.1|  PREDICTED: transmembrane emp24 domain-contai...    107   2e-24    Prunus mume [ume]
ref|XP_007205899.1|  hypothetical protein PRUPE_ppa011405mg             107   2e-24    Prunus persica
ref|XP_008349392.1|  PREDICTED: transmembrane emp24 domain-contai...    106   2e-24    
ref|XP_006474871.1|  PREDICTED: transmembrane emp24 domain-contai...    112   3e-24    
ref|XP_010252793.1|  PREDICTED: transmembrane emp24 domain-contai...    107   3e-24    Nelumbo nucifera [Indian lotus]
ref|XP_008811267.1|  PREDICTED: transmembrane emp24 domain-contai...    107   3e-24    Phoenix dactylifera
ref|XP_010088435.1|  Transmembrane emp24 domain-containing protein      108   3e-24    
ref|XP_003574832.1|  PREDICTED: transmembrane emp24 domain-contai...    106   3e-24    Brachypodium distachyon [annual false brome]
gb|KJB10764.1|  hypothetical protein B456_001G223000                    106   4e-24    Gossypium raimondii
ref|XP_008358798.1|  PREDICTED: transmembrane emp24 domain-contai...    106   4e-24    
ref|XP_010644591.1|  PREDICTED: transmembrane emp24 domain-contai...    106   5e-24    Vitis vinifera
emb|CDP13706.1|  unnamed protein product                                106   5e-24    Coffea canephora [robusta coffee]
ref|XP_010061440.1|  PREDICTED: transmembrane emp24 domain-contai...    105   9e-24    Eucalyptus grandis [rose gum]
ref|XP_011095562.1|  PREDICTED: transmembrane emp24 domain-contai...    105   9e-24    Sesamum indicum [beniseed]
gb|KHG15887.1|  Transmembrane emp24 domain-containing 2                 105   1e-23    Gossypium arboreum [tree cotton]
gb|KJB13907.1|  hypothetical protein B456_002G101200                    104   1e-23    Gossypium raimondii
ref|NP_001132648.1|  hypothetical protein precursor                     104   2e-23    Zea mays [maize]
ref|XP_009759544.1|  PREDICTED: transmembrane emp24 domain-contai...    104   2e-23    Nicotiana sylvestris
ref|XP_010524625.1|  PREDICTED: transmembrane emp24 domain-contai...    104   2e-23    Tarenaya hassleriana [spider flower]
ref|XP_010927754.1|  PREDICTED: transmembrane emp24 domain-contai...    104   2e-23    Elaeis guineensis
gb|EYU27447.1|  hypothetical protein MIMGU_mgv1a013853mg                103   3e-23    Erythranthe guttata [common monkey flower]
ref|XP_002444693.1|  hypothetical protein SORBIDRAFT_07g026110          104   3e-23    Sorghum bicolor [broomcorn]
ref|XP_008790745.1|  PREDICTED: transmembrane emp24 domain-contai...    103   4e-23    Phoenix dactylifera
ref|XP_004974010.1|  PREDICTED: transmembrane emp24 domain-contai...    103   4e-23    Setaria italica
dbj|BAK05986.1|  predicted protein                                      103   4e-23    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010551965.1|  PREDICTED: transmembrane emp24 domain-contai...    103   4e-23    Tarenaya hassleriana [spider flower]
ref|XP_006659626.1|  PREDICTED: transmembrane emp24 domain-contai...    103   4e-23    Oryza brachyantha
ref|XP_002300382.1|  emp24/gp25L/p24 family protein                     103   5e-23    Populus trichocarpa [western balsam poplar]
ref|NP_001062344.1|  Os08g0532900                                       103   5e-23    
ref|XP_004144551.1|  PREDICTED: transmembrane emp24 domain-contai...    103   5e-23    Cucumis sativus [cucumbers]
ref|XP_009408352.1|  PREDICTED: transmembrane emp24 domain-contai...    103   5e-23    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006407808.1|  hypothetical protein EUTSA_v10021526mg             103   5e-23    Eutrema salsugineum [saltwater cress]
ref|XP_011461874.1|  PREDICTED: transmembrane emp24 domain-contai...    103   6e-23    Fragaria vesca subsp. vesca
emb|CDY28027.1|  BnaC05g44290D                                          103   6e-23    Brassica napus [oilseed rape]
emb|CDY35954.1|  BnaA05g29960D                                          103   6e-23    Brassica napus [oilseed rape]
ref|XP_009147043.1|  PREDICTED: transmembrane emp24 domain-contai...    103   6e-23    Brassica rapa
ref|XP_009134990.1|  PREDICTED: transmembrane emp24 domain-contai...    102   9e-23    Brassica rapa
ref|XP_009124202.1|  PREDICTED: transmembrane emp24 domain-contai...    102   9e-23    Brassica rapa
emb|CDY07978.1|  BnaC03g35450D                                          102   9e-23    Brassica napus [oilseed rape]
emb|CDX74033.1|  BnaA03g30140D                                          102   9e-23    
ref|XP_006452612.1|  hypothetical protein CICLE_v100094662mg            100   9e-23    
ref|XP_006298554.1|  hypothetical protein CARUB_v10014637mg             102   1e-22    Capsella rubella
ref|XP_010456670.1|  PREDICTED: transmembrane emp24 domain-contai...    102   1e-22    Camelina sativa [gold-of-pleasure]
ref|NP_001147761.1|  LOC100281371 precursor                             102   1e-22    Zea mays [maize]
gb|EMS66095.1|  Transmembrane emp24 domain-containing protein           102   1e-22    Triticum urartu
ref|XP_010464406.1|  PREDICTED: transmembrane emp24 domain-contai...    102   1e-22    Camelina sativa [gold-of-pleasure]
ref|XP_002676871.1|  predicted protein                                  102   1e-22    Naegleria gruberi strain NEG-M
ref|XP_007049383.1|  Emp24/gp25L/p24 family/GOLD family protein i...    102   1e-22    
ref|XP_009590973.1|  PREDICTED: transmembrane emp24 domain-contai...    101   1e-22    
ref|XP_002882543.1|  hypothetical protein ARALYDRAFT_478100             102   1e-22    
gb|EMT09288.1|  Transmembrane emp24 domain-containing protein 7         103   1e-22    
ref|XP_010486337.1|  PREDICTED: transmembrane emp24 domain-contai...    102   1e-22    Camelina sativa [gold-of-pleasure]
ref|NP_187425.1|  p24 subfamily beta 2                                  102   2e-22    Arabidopsis thaliana [mouse-ear cress]
gb|AAM66112.1|  putative coated vesicle membrane protein                102   2e-22    Arabidopsis thaliana [mouse-ear cress]
gb|ACG35396.1|  transmembrane emp24 domain-containing protein 3 p...    102   2e-22    Zea mays [maize]
emb|CDY22128.1|  BnaC01g39730D                                          102   2e-22    Brassica napus [oilseed rape]
gb|AGT16036.1|  transmembrane emp24 domain-containing protein           102   3e-22    Saccharum hybrid cultivar R570
ref|XP_010689227.1|  PREDICTED: transmembrane emp24 domain-contai...    101   3e-22    Beta vulgaris subsp. vulgaris [field beet]
gb|EMS53833.1|  Transmembrane emp24 domain-containing protein 7         101   4e-22    Triticum urartu
ref|XP_011100513.1|  PREDICTED: transmembrane emp24 domain-contai...    100   4e-22    Sesamum indicum [beniseed]
ref|XP_008380011.1|  PREDICTED: transmembrane emp24 domain-contai...    100   5e-22    
gb|ABB90548.1|  coated vesicle membrane protein-like                    100   5e-22    Triticum aestivum [Canadian hard winter wheat]
gb|KDO50955.1|  hypothetical protein CISIN_1g040712mg                 99.8    5e-22    Citrus sinensis [apfelsine]
ref|XP_010063252.1|  PREDICTED: transmembrane emp24 domain-contai...    100   6e-22    
ref|XP_009616557.1|  PREDICTED: transmembrane emp24 domain-contai...    100   9e-22    Nicotiana tomentosiformis
ref|XP_009361538.1|  PREDICTED: transmembrane emp24 domain-contai...    100   1e-21    Pyrus x bretschneideri [bai li]
ref|XP_636960.1|  hypothetical protein DDB_G0288053                   99.8    1e-21    Dictyostelium discoideum AX4
dbj|BAM20109.1|  transmembrane emp24 domain-containing protein        99.4    1e-21    Papilio xuthus [Chinese swallowtail]
ref|XP_009787783.1|  PREDICTED: transmembrane emp24 domain-contai...  99.4    1e-21    Nicotiana sylvestris
ref|XP_008362318.1|  PREDICTED: transmembrane emp24 domain-contai...  99.0    2e-21    
ref|XP_004172188.1|  PREDICTED: transmembrane emp24 domain-contai...  98.6    3e-21    
ref|XP_006586144.1|  PREDICTED: transmembrane emp24 domain-contai...  98.6    3e-21    Glycine max [soybeans]
ref|XP_010313948.1|  PREDICTED: transmembrane emp24 domain-contai...  98.6    3e-21    Solanum lycopersicum
ref|XP_006660817.1|  PREDICTED: transmembrane emp24 domain-contai...  98.2    4e-21    Oryza brachyantha
ref|XP_002522778.1|  coated vesicle membrane protein, putative          102   5e-21    
emb|CDP20746.1|  unnamed protein product                              97.1    5e-21    Coffea canephora [robusta coffee]
ref|XP_011095564.1|  PREDICTED: cellulose synthase-like protein E6      102   6e-21    Sesamum indicum [beniseed]
dbj|GAM18347.1|  hypothetical protein SAMD00019534_015220             97.4    8e-21    Acytostelium subglobosum LB1
ref|XP_008229935.1|  PREDICTED: transmembrane emp24 domain-contai...  97.1    1e-20    Prunus mume [ume]
ref|XP_010926811.1|  PREDICTED: transmembrane emp24 domain-contai...  97.1    1e-20    Elaeis guineensis
ref|XP_004295183.1|  PREDICTED: cellulose synthase-like protein E...    101   1e-20    Fragaria vesca subsp. vesca
ref|XP_009606341.1|  PREDICTED: transmembrane emp24 domain-contai...  96.7    1e-20    Nicotiana tomentosiformis
ref|XP_007215846.1|  hypothetical protein PRUPE_ppa010256mg           97.4    1e-20    
ref|XP_009793108.1|  PREDICTED: transmembrane emp24 domain-contai...  96.7    2e-20    Nicotiana sylvestris
ref|XP_006344897.1|  PREDICTED: transmembrane emp24 domain-contai...  96.7    2e-20    Solanum tuberosum [potatoes]
ref|XP_007020468.1|  Emp24/gp25L/p24 family/GOLD family protein       95.9    3e-20    
ref|XP_002737710.1|  PREDICTED: transmembrane emp24 domain-contai...  95.5    3e-20    Saccoglossus kowalevskii
dbj|GAA94318.1|  hypothetical protein E5Q_00967                       95.9    3e-20    Mixia osmundae IAM 14324
ref|XP_003286220.1|  hypothetical protein DICPUDRAFT_150161           95.5    3e-20    Dictyostelium purpureum
gb|EAZ45308.1|  hypothetical protein OsJ_29951                        95.5    4e-20    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003600347.1|  Transmembrane emp24 domain-containing protein    94.7    6e-20    
ref|XP_002532207.1|  coated vesicle membrane protein, putative        94.7    7e-20    Ricinus communis
gb|KFM70595.1|  Transmembrane emp24 domain-containing protein 2       94.0    1e-19    Stegodyphus mimosarum
ref|XP_009624028.1|  PREDICTED: transmembrane emp24 domain-contai...  94.0    1e-19    Nicotiana tomentosiformis
ref|XP_008462127.1|  PREDICTED: transmembrane emp24 domain-contai...  93.2    1e-19    Cucumis melo [Oriental melon]
dbj|BAA75463.1|  COP-coated vesicle membrane protein P24 homolog      93.6    2e-19    Heterostelium pallidum
ref|XP_010063253.1|  PREDICTED: cellulose synthase-like protein E...  98.2    2e-19    Eucalyptus grandis [rose gum]
ref|XP_002737711.1|  PREDICTED: transmembrane emp24 domain-contai...  93.6    2e-19    Saccoglossus kowalevskii
ref|XP_010033500.1|  PREDICTED: transmembrane emp24 domain-contai...  92.0    2e-19    Eucalyptus grandis [rose gum]
ref|XP_006352045.1|  PREDICTED: transmembrane emp24 domain-contai...  93.6    2e-19    
ref|XP_004303575.1|  PREDICTED: transmembrane emp24 domain-contai...  93.2    2e-19    Fragaria vesca subsp. vesca
dbj|BAK05139.1|  predicted protein                                    92.8    2e-19    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008357987.1|  PREDICTED: transmembrane emp24 domain-contai...  91.3    4e-19    
gb|EAZ09689.1|  hypothetical protein OsI_31972                        92.4    5e-19    Oryza sativa Indica Group [Indian rice]
ref|XP_004252039.2|  PREDICTED: transmembrane emp24 domain-contai...  93.6    5e-19    
ref|XP_002612119.1|  hypothetical protein BRAFLDRAFT_127851           92.0    6e-19    Branchiostoma floridae
ref|XP_004516094.1|  PREDICTED: transmembrane emp24 domain-contai...  92.0    6e-19    
gb|KCW85245.1|  hypothetical protein EUGRSUZ_B02092                   90.1    7e-19    Eucalyptus grandis [rose gum]
gb|KCW77065.1|  hypothetical protein EUGRSUZ_D01406                   90.1    8e-19    Eucalyptus grandis [rose gum]
ref|XP_009054024.1|  hypothetical protein LOTGIDRAFT_203874           91.3    1e-18    Lottia gigantea
gb|EMS24745.1|  COPII-coated vesicle protein                          91.3    1e-18    Rhodotorula toruloides NP11
ref|XP_007049384.1|  Emp24/gp25L/p24 family/GOLD family protein i...  91.3    1e-18    
gb|KDR20117.1|  Transmembrane emp24 domain-containing protein         90.9    1e-18    Zootermopsis nevadensis
gb|KDE02371.1|  hypothetical protein MVLG_07073                       90.9    1e-18    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_004345536.1|  transmembrane emp24 domain-containing protein    90.9    1e-18    Capsaspora owczarzaki ATCC 30864
emb|CCG82900.1|  Endosomal protein P24B                               90.5    2e-18    Taphrina deformans PYCC 5710
ref|XP_002059491.1|  GJ14798                                          90.9    2e-18    Drosophila virilis
ref|XP_003745531.1|  PREDICTED: transmembrane emp24 domain-contai...  90.5    2e-18    
ref|XP_010052924.1|  PREDICTED: transmembrane emp24 domain-contai...  89.4    2e-18    Eucalyptus grandis [rose gum]
ref|XP_005491563.1|  PREDICTED: transmembrane emp24 domain-contai...  90.1    2e-18    Zonotrichia albicollis
gb|ESA01197.1|  hypothetical protein GLOINDRAFT_38705                 90.1    2e-18    
gb|EHJ79123.1|  hypothetical protein KGM_15587                        90.1    3e-18    
ref|NP_001039241.1|  transmembrane emp24 domain trafficking prote...  90.1    3e-18    Xenopus tropicalis [western clawed frog]
ref|XP_002075543.1|  GK14515                                          91.3    3e-18    
ref|XP_010039587.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    3e-18    
ref|XP_003222786.2|  PREDICTED: transmembrane emp24 domain-contai...  90.9    3e-18    Anolis carolinensis [Carolina anole]
ref|XP_007905987.1|  PREDICTED: transmembrane emp24 domain-contai...  90.1    3e-18    Callorhinchus milii [Australian ghost shark]
ref|XP_009606342.1|  PREDICTED: cellulose synthase-like protein E...  94.4    3e-18    Nicotiana tomentosiformis
ref|XP_002037009.1|  GM12348                                          90.1    3e-18    Drosophila sechellia
ref|XP_003552993.2|  PREDICTED: transmembrane emp24 domain-contai...  89.7    4e-18    
gb|ABQ42005.1|  putative cop-coated vesicle membrane protein          85.9    4e-18    Sonneratia alba
ref|XP_009793109.1|  PREDICTED: cellulose synthase-like protein E...  94.0    4e-18    Nicotiana sylvestris
gb|EXX57732.1|  Emp24p                                                90.1    4e-18    Rhizophagus irregularis DAOM 197198w
ref|XP_002156614.1|  PREDICTED: transmembrane emp24 domain-contai...  89.4    4e-18    Hydra vulgaris
ref|XP_006123002.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    5e-18    
gb|KHN31673.1|  Transmembrane emp24 domain-containing protein A       89.4    5e-18    
ref|XP_007646592.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    5e-18    
ref|XP_004531150.1|  PREDICTED: transmembrane emp24 domain-contai...  89.4    6e-18    
ref|XP_001992720.1|  GH24063                                          89.4    6e-18    
ref|XP_006209543.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    7e-18    
gb|EFA82777.1|  emp24/gp25L/p24 family protein                        87.4    7e-18    
ref|XP_006894695.1|  PREDICTED: transmembrane emp24 domain-contai...  89.0    7e-18    
emb|CCA74063.1|  related to EMP24 protein precursor                   89.0    7e-18    
dbj|BAG60439.1|  unnamed protein product                              88.2    8e-18    
ref|XP_004385048.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    8e-18    
ref|XP_004531149.1|  PREDICTED: transmembrane emp24 domain-contai...  89.4    9e-18    
ref|XP_001976884.1|  GG18710                                          88.6    9e-18    
ref|XP_001966179.1|  GF19355                                          88.6    9e-18    
ref|XP_003462952.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    1e-17    
ref|XP_001364919.1|  PREDICTED: transmembrane emp24 domain-contai...  88.6    1e-17    
sp|P49020.1|TMED2_CRIGR  RecName: Full=Transmembrane emp24 domain...  88.2    1e-17    
ref|XP_003385187.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_005403088.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_002009519.1|  GI15191                                          88.2    1e-17    
ref|XP_006209542.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|NP_062744.1|  transmembrane emp24 domain-containing protein 2...  88.2    1e-17    
ref|XP_008155442.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_006865431.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
gb|KGL89388.1|  hypothetical protein N301_08401                       87.8    1e-17    
gb|AAX37039.1|  coated vesicle membrane protein                       88.2    1e-17    
ref|XP_002023732.1|  GL19967                                          88.2    1e-17    
ref|XP_007509107.1|  predicted protein                                88.6    1e-17    
ref|XP_011354010.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_008837511.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|NP_113910.1|  transmembrane emp24 domain-containing protein 2...  88.2    1e-17    
ref|NP_006806.1|  transmembrane emp24 domain-containing protein 2...  88.2    1e-17    
ref|XP_003420330.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_005524293.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_004595402.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|NP_001080619.1|  transmembrane emp24 domain trafficking prote...  88.2    1e-17    
ref|XP_006266671.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_006015176.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
ref|XP_005298778.1|  PREDICTED: transmembrane emp24 domain-contai...  88.2    1e-17    
gb|KFO95756.1|  hypothetical protein N300_10241                       87.0    1e-17    
ref|XP_009569586.1|  PREDICTED: transmembrane emp24 domain-contai...  87.8    2e-17    
ref|XP_005145179.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  87.8    2e-17    
ref|NP_001006186.1|  transmembrane emp24 domain-containing protei...  87.8    2e-17    
emb|CDQ74942.1|  unnamed protein product                              87.8    2e-17    
gb|EKC18010.1|  Transmembrane emp24 domain-containing protein 2       87.0    2e-17    
ref|XP_005988996.1|  PREDICTED: transmembrane emp24 domain-contai...  87.8    2e-17    
ref|XP_004360412.1|  emp24/gp25L/p24 family protein                   87.8    2e-17    
ref|XP_001354670.1|  GA28584                                          87.8    2e-17    
ref|XP_011506255.1|  PREDICTED: transmembrane emp24 domain-contai...  87.8    2e-17    
ref|XP_007146652.1|  hypothetical protein PHAVU_006G058200g           87.8    2e-17    
ref|XP_010060577.1|  PREDICTED: transmembrane emp24 domain-contai...  86.3    2e-17    
ref|XP_006910125.1|  PREDICTED: transmembrane emp24 domain-contai...  87.0    2e-17    
dbj|BAN20504.1|  copii-coated vesicle membrane protein P24            87.4    2e-17    
ref|XP_006346126.1|  PREDICTED: cellulose synthase-like protein E...  91.7    2e-17    
ref|XP_010324247.1|  PREDICTED: cellulose synthase-like protein E1    91.7    3e-17    
ref|XP_004753164.1|  PREDICTED: transmembrane emp24 domain-contai...  87.0    3e-17    
ref|XP_002100096.1|  GE16348                                          87.0    3e-17    
dbj|GAN05424.1|  supeRNAtant protein factor C-terminal domain-con...  86.7    3e-17    
ref|XP_004668547.1|  PREDICTED: transmembrane emp24 domain-contai...  87.0    3e-17    
ref|NP_572165.1|  CHOp24, isoform A                                   87.0    4e-17    
ref|XP_005231235.1|  PREDICTED: transmembrane emp24 domain-contai...  85.9    4e-17    
emb|CDS10876.1|  hypothetical protein LRAMOSA11362                    87.0    4e-17    
ref|XP_011183078.1|  PREDICTED: transmembrane emp24 domain-contai...  87.0    4e-17    
emb|CDH57757.1|  supernatant protein factor c-terminal domain-con...  87.0    4e-17    
ref|XP_010718385.1|  PREDICTED: transmembrane emp24 domain-contai...  87.4    4e-17    
ref|XP_011414195.1|  PREDICTED: transmembrane emp24 domain-contai...  86.7    4e-17    
ref|XP_002405324.1|  cargo transport protein EMP24, putative          86.7    5e-17    
gb|KFV02427.1|  hypothetical protein N340_00145                       85.5    5e-17    
gb|ERE76026.1|  transmembrane emp24 domain-containing protein 2       85.9    6e-17    
gb|KFP38893.1|  Transmembrane emp24 domain-containing protein 2       84.7    7e-17    
ref|XP_008481507.1|  PREDICTED: transmembrane emp24 domain-contai...  86.3    7e-17    
gb|KFM10700.1|  Transmembrane emp24 domain-containing protein 2       84.7    7e-17    
gb|EHH21305.1|  hypothetical protein EGK_04326                        84.7    7e-17    
ref|XP_004017616.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    7e-17    
ref|XP_001507202.2|  PREDICTED: transmembrane emp24 domain-contai...  85.1    7e-17    
gb|KFO59400.1|  Transmembrane emp24 domain-containing protein 2       84.7    7e-17    
gb|KFP97602.1|  Transmembrane emp24 domain-containing protein 2       84.7    7e-17    
ref|XP_006178280.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    7e-17    
emb|CEG76918.1|  hypothetical protein RMATCC62417_11745               85.9    8e-17    
ref|XP_005434642.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    8e-17    
ref|XP_008687187.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    8e-17    
emb|CBY21054.1|  unnamed protein product                              85.9    8e-17    
gb|KFO04223.1|  hypothetical protein N312_08485                       84.7    8e-17    
gb|KFU89559.1|  hypothetical protein M959_10146                       84.7    8e-17    
ref|XP_008516732.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    8e-17    
ref|XP_005955356.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    8e-17    
gb|EOB03713.1|  Transmembrane emp24 domain-containing protein 2       84.7    9e-17    
ref|NP_001290614.1|  transmembrane emp24 domain trafficking prote...  85.9    9e-17    
ref|XP_005812072.1|  PREDICTED: transmembrane emp24 domain-contai...  85.9    9e-17    
ref|XP_009694827.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    9e-17    
emb|CDQ79100.1|  unnamed protein product                              85.9    9e-17    
gb|EPB82387.1|  hypothetical protein HMPREF1544_10888                 85.5    9e-17    
ref|XP_007577369.1|  PREDICTED: transmembrane emp24 domain-contai...  85.9    9e-17    
ref|XP_008323850.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|XP_010795826.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|XP_010748994.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|NP_955842.1|  transmembrane emp24 domain-containing protein 2...  85.5    1e-16    
ref|XP_006640298.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|XP_003455198.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|XP_003965392.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
gb|EFX80363.1|  hypothetical protein DAPPUDRAFT_304000                85.5    1e-16    
ref|XP_005603321.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|XP_004074497.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|XP_791284.2|  PREDICTED: transmembrane emp24 domain-containin...  85.5    1e-16    
ref|XP_005491562.1|  PREDICTED: transmembrane emp24 domain-contai...  85.5    1e-16    
ref|XP_004928888.1|  PREDICTED: transmembrane emp24 domain-contai...  85.1    2e-16    
ref|XP_010345963.1|  PREDICTED: transmembrane emp24 domain-contai...  84.3    2e-16    
ref|XP_008111893.1|  PREDICTED: transmembrane emp24 domain-contai...  85.9    2e-16    
gb|EHH66821.1|  hypothetical protein EGM_03877                        84.7    2e-16    
ref|XP_007905986.1|  PREDICTED: transmembrane emp24 domain-contai...  85.1    2e-16    
ref|XP_005691415.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    2e-16    
ref|XP_005183552.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    2e-16    
ref|XP_009930828.1|  PREDICTED: transmembrane emp24 domain-contai...  84.0    2e-16    
ref|XP_006108599.1|  PREDICTED: transmembrane emp24 domain-contai...  84.7    3e-16    
ref|NP_001134180.1|  transmembrane emp24 domain-containing protei...  84.3    3e-16    
emb|CDQ76905.1|  unnamed protein product                              84.3    3e-16    
ref|XP_010895612.1|  PREDICTED: transmembrane emp24 domain-contai...  84.3    3e-16    
ref|XP_007238328.1|  PREDICTED: transmembrane emp24 domain-contai...  84.3    3e-16    
ref|XP_011209479.1|  PREDICTED: transmembrane emp24 domain-contai...  84.3    3e-16    
ref|XP_009878561.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    3e-16    
gb|KIM29619.1|  hypothetical protein M408DRAFT_328836                 83.2    3e-16    
ref|XP_006768845.1|  PREDICTED: transmembrane emp24 domain-contai...  84.3    4e-16    
ref|XP_003733921.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  84.0    4e-16    
ref|XP_010046023.1|  PREDICTED: transmembrane emp24 domain-contai...  82.8    4e-16    
ref|XP_001623647.1|  predicted protein                                84.0    4e-16    
ref|XP_007414390.1|  hypothetical protein MELLADRAFT_57165            83.6    4e-16    
ref|XP_005016383.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    5e-16    
ref|XP_007489989.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    5e-16    
tpg|DAA34063.1|  TPA: putative cargo transport protein EMP24          83.2    5e-16    
emb|CDJ84137.1|  emp24 gp25L p24 domain containing protein            83.6    6e-16    
ref|XP_010602839.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    6e-16    
gb|AGM32196.1|  transmembrane emp24 domain-containing protein 2 p...  82.8    6e-16    
ref|XP_005344433.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    6e-16    
ref|XP_005403087.1|  PREDICTED: transmembrane emp24 domain-contai...  83.6    6e-16    
tpg|DAA33463.1|  TPA: coated vesicle membrane protein-like            83.2    6e-16    
ref|XP_003359136.1|  PREDICTED: transmembrane emp24 domain-contai...  83.2    7e-16    
ref|XP_005253601.1|  PREDICTED: transmembrane emp24 domain-contai...  83.2    7e-16    
ref|XP_001604135.1|  PREDICTED: transmembrane emp24 domain-contai...  83.2    7e-16    
ref|XP_004317416.1|  PREDICTED: transmembrane emp24 domain-contai...  84.3    7e-16    
ref|XP_005904546.1|  PREDICTED: transmembrane emp24 domain-contai...  83.2    7e-16    
ref|XP_971914.1|  PREDICTED: transmembrane emp24 domain-containin...  83.2    7e-16    
ref|XP_005524292.1|  PREDICTED: transmembrane emp24 domain-contai...  83.2    7e-16    
ref|XP_010580534.1|  PREDICTED: transmembrane emp24 domain-contai...  83.2    7e-16    
ref|XP_009569585.1|  PREDICTED: transmembrane emp24 domain-contai...  83.2    7e-16    
gb|AHD24743.1|  EMP24                                                 83.2    7e-16    
gb|ACO09937.1|  Transmembrane emp24 domain-containing protein 2 p...  83.2    8e-16    
ref|XP_006970894.1|  PREDICTED: transmembrane emp24 domain-contai...  82.0    8e-16    
ref|XP_004284089.1|  PREDICTED: transmembrane emp24 domain-contai...  82.8    9e-16    
ref|XP_005988995.1|  PREDICTED: transmembrane emp24 domain-contai...  82.8    9e-16    
ref|XP_003745530.1|  PREDICTED: transmembrane emp24 domain-contai...  82.8    1e-15    
gb|ACO12735.1|  Transmembrane emp24 domain-containing protein 2 p...  82.4    1e-15    
emb|CEI89044.1|  hypothetical protein RMCBS344292_03417               82.4    1e-15    
ref|XP_006149398.1|  PREDICTED: transmembrane emp24 domain-contai...  83.2    1e-15    
ref|XP_004753162.1|  PREDICTED: transmembrane emp24 domain-contai...  82.4    1e-15    
emb|CAG05307.1|  unnamed protein product                              85.1    2e-15    
emb|CDJ89798.1|  emp24 gp25L p24 domain containing protein            82.8    2e-15    
gb|AFR92202.2|  COPII-coated vesicle protein                          82.0    2e-15    
ref|XP_002125525.1|  PREDICTED: transmembrane emp24 domain-contai...  82.0    2e-15    
ref|XP_003329764.2|  hypothetical protein PGTG_11514                  82.0    2e-15    
gb|KFR08300.1|  Transmembrane emp24 domain-containing protein 2       80.9    2e-15    
gb|KDN42297.1|  supernatant protein factor, C-terminal domain-con...  82.0    2e-15    
ref|XP_010718384.1|  PREDICTED: transmembrane emp24 domain-contai...  82.4    2e-15    
ref|XP_003174373.1|  lin-12 protein 9 suppressor/enhancer             82.0    2e-15    
ref|XP_001842296.1|  suppressor/enhancer of lin-12 protein 9          81.6    2e-15    
ref|XP_006959836.1|  supernatant protein factor, C-terminal domai...  81.6    2e-15    
ref|XP_002559296.1|  Pc13g08710                                       81.6    3e-15    
ref|XP_002618026.1|  hypothetical protein CLUG_01485                  81.6    3e-15    
ref|XP_007577367.1|  PREDICTED: transmembrane emp24 domain-contai...  81.6    3e-15    
gb|ERL85904.1|  hypothetical protein D910_03319                       81.3    3e-15    
ref|XP_001098453.2|  PREDICTED: ATP-dependent RNA helicase DDX55-...  85.1    3e-15    
gb|AEE63001.1|  unknown                                               81.3    3e-15    
emb|CEG73085.1|  hypothetical protein RMATCC62417_08531               81.3    3e-15    
gb|KFH64814.1|  hypothetical protein MVEG_09544                       81.3    3e-15    
ref|XP_004566996.1|  PREDICTED: transmembrane emp24 domain-contai...  81.3    3e-15    
ref|XP_008323849.1|  PREDICTED: transmembrane emp24 domain-contai...  81.3    3e-15    
ref|XP_006626920.1|  PREDICTED: transmembrane emp24 domain-contai...  81.3    3e-15    
ref|XP_010795825.1|  PREDICTED: transmembrane emp24 domain-contai...  81.3    3e-15    
ref|XP_001658907.1|  AAEL000208-PA                                    81.3    4e-15    
ref|XP_005172484.1|  PREDICTED: transmembrane emp24 domain-contai...  81.3    4e-15    
ref|XP_008516731.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    4e-15    
ref|XP_010839588.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    4e-15    
gb|KGO67798.1|  Uncharacterized protein PITC_048840                   80.9    4e-15    
ref|NP_998077.1|  transmembrane emp24 domain-containing protein 7...  81.3    4e-15    
ref|XP_003023954.1|  endosomal cargo receptor (Erv25), putative       81.3    4e-15    
gb|KFH66635.1|  hypothetical protein MVEG_07160                       80.9    5e-15    
emb|CDM30485.1|  Endosomal protein P24B                               80.9    5e-15    
ref|XP_001264618.1|  endosomal cargo receptor (P24), putative         81.3    5e-15    
ref|XP_007113418.1|  PREDICTED: transmembrane emp24 domain-contai...  81.3    5e-15    
ref|XP_003010897.1|  endosomal cargo receptor (Erv25), putative       80.9    5e-15    
ref|XP_003288892.1|  emp24/gp25L/p24 family protein                   80.9    5e-15    
gb|ACO11764.1|  Transmembrane emp24 domain-containing protein 2 p...  80.9    5e-15    
gb|EPQ20304.1|  ATP-dependent RNA helicase DDX55                      84.3    5e-15    
ref|XP_008492311.1|  PREDICTED: transmembrane emp24 domain-contai...  79.7    5e-15    
ref|XP_007058425.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    6e-15    
dbj|GAM87761.1|  hypothetical protein ANO11243_057880                 80.5    6e-15    
ref|XP_008632365.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    6e-15    
gb|ENN72079.1|  hypothetical protein YQE_11265                        81.3    6e-15    
emb|CEP14534.1|  hypothetical protein                                 80.1    7e-15    
ref|XP_004996422.1|  transmembrane emp24 domain-containing protein 2  80.5    7e-15    
gb|EKV17382.1|  Endosomal cargo receptor (P24), putative              80.1    8e-15    
ref|XP_007260848.1|  PREDICTED: transmembrane emp24 domain-contai...  80.5    8e-15    
ref|XP_005714632.1|  unnamed protein product                          80.1    8e-15    
ref|XP_008334528.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    8e-15    
ref|XP_002151457.1|  endosomal cargo receptor (P24), putative         80.1    9e-15    
ref|XP_004547317.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    1e-14    
ref|XP_003231662.1|  Emp24/gp25L/p24 membrane trafficking protein     80.1    1e-14    
ref|XP_003191889.1|  COPII-coated vesicle protein                     79.7    1e-14    
ref|XP_004992607.1|  hypothetical protein PTSG_07187                  80.1    1e-14    
gb|EPB90773.1|  hypothetical protein HMPREF1544_02351                 79.7    1e-14    
ref|XP_010668975.1|  PREDICTED: transmembrane emp24 domain-contai...  78.2    1e-14    
ref|XP_566482.1|  COPII-coated vesicle protein                        79.7    1e-14    
ref|XP_002151458.1|  endosomal cargo receptor (P24), putative         79.7    1e-14    
ref|XP_005722082.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    1e-14    
ref|XP_003378465.1|  suppressor/enhancer of lin-12 protein 9          80.5    1e-14    
ref|XP_008335949.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    1e-14    
ref|XP_003446109.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    1e-14    
emb|CEF65354.1|  Transmembrane emp24 domain trafficking protein 2     79.7    1e-14    
gb|KGB74652.1|  COPII-coated vesicle protein                          79.7    1e-14    
emb|CAF90460.1|  unnamed protein product                              79.7    1e-14    
ref|XP_004312272.1|  PREDICTED: transmembrane emp24 domain-contai...  80.1    1e-14    
gb|KGO36873.1|  Uncharacterized protein PEXP_006720                   79.7    1e-14    



>ref|XP_004247610.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Solanum lycopersicum]
Length=218

 Score =   310 bits (794),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVT+PG+NVVH+MKGTSG+KF+FKAPRSGMYKFCF NPYSTPET
Sbjct  60   VDHDIFWSSDHPGIDFTVTAPGENVVHTMKGTSGNKFEFKAPRSGMYKFCFKNPYSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIH+GHIPNEH+LAKDEHLDPINVKIAELREALESVTSEQKYL+ARDARHRHTNEST
Sbjct  120  VSFYIHIGHIPNEHDLAKDEHLDPINVKIAELREALESVTSEQKYLRARDARHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R RVIFYT+GEY+LL LAS LQVVYIRRLFSKSV YNRV
Sbjct  180  RNRVIFYTIGEYMLLILASGLQVVYIRRLFSKSVGYNRV  218



>ref|XP_009773202.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nicotiana sylvestris]
Length=218

 Score =   310 bits (793),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDF VT+PG+NVVH+MKGTSGDKF+FKAPRSGMYKFCF NPYSTPET
Sbjct  60   VDHDIFWSSDHPGIDFVVTAPGENVVHTMKGTSGDKFEFKAPRSGMYKFCFKNPYSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIH+GHIPNEH+LAKDEHLDPINVKIAELREALESVTSEQKYL+ARDARHRHTNEST
Sbjct  120  VSFYIHIGHIPNEHDLAKDEHLDPINVKIAELREALESVTSEQKYLRARDARHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYT+GEY+LL LAS LQV+YIR+LFSKSV YNRV
Sbjct  180  RKRVIFYTIGEYLLLILASGLQVLYIRQLFSKSVGYNRV  218



>ref|XP_009631810.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nicotiana tomentosiformis]
Length=218

 Score =   309 bits (792),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDF VT+PG+NVVH+MKGTSGDKF+FKAPRSGMYKFCF NPYSTPET
Sbjct  60   VDHDIFWSSDHPGIDFVVTAPGENVVHTMKGTSGDKFEFKAPRSGMYKFCFKNPYSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIH+GHIPNEH+LAKDEHLDPINVKIAELREALESVTSEQKYL+ARD RHRHTNEST
Sbjct  120  VSFYIHIGHIPNEHDLAKDEHLDPINVKIAELREALESVTSEQKYLRARDVRHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYT+GEY+LL LAS LQVVYIR+LFSKSV YNRV
Sbjct  180  RKRVIFYTIGEYLLLILASGLQVVYIRQLFSKSVGYNRV  218



>gb|KDP40237.1| hypothetical protein JCGZ_02235 [Jatropha curcas]
Length=209

 Score =   309 bits (791),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSP DNVVH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  51   VDHDIFWSSDHPGIDLTVTSPADNVVHTVKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  110

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHL+PINVKIAELREALESVT+EQKYLKARDARHR TNEST
Sbjct  111  VSFYIHVGHIPNEHDLAKDEHLNPINVKIAELREALESVTAEQKYLKARDARHRLTNEST  170

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVI YTVGEYILLAL S+LQVVYIRRLFSKSVAYNRV
Sbjct  171  RKRVIGYTVGEYILLALISALQVVYIRRLFSKSVAYNRV  209



>ref|XP_006363461.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Solanum tuberosum]
Length=218

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVT+PG+NVVH+MKGTSG+KF+FKAPRSGMYKFCF NPYSTPET
Sbjct  60   VDHDIFWSSDHPGIDFTVTAPGENVVHTMKGTSGNKFEFKAPRSGMYKFCFKNPYSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIH+GHIPNEH+LAKDEHLDPINVKIAELREALESVTSEQKYL+ARD+RHRHTNEST
Sbjct  120  VSFYIHIGHIPNEHDLAKDEHLDPINVKIAELREALESVTSEQKYLRARDSRHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R RVIFYT+GEY+LL LAS LQVVYIRRLFSKSV YNRV
Sbjct  180  RNRVIFYTIGEYLLLILASGLQVVYIRRLFSKSVGYNRV  218



>ref|XP_002283487.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Vitis vinifera]
 emb|CBI26315.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGIDFTVTSP  N VH++KGTSGDKF+FKAPRSGMYKFCF N Y+TPET
Sbjct  57   VDHDIFWGSDHPGIDFTVTSPAGNTVHTLKGTSGDKFEFKAPRSGMYKFCFQNSYATPET  116

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVT+EQKYLKARD RHRHTNEST
Sbjct  117  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTAEQKYLKARDTRHRHTNEST  176

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYT+GEY+LLALAS LQVVYIRRLFSKSVAYNRV
Sbjct  177  RKRVIFYTLGEYLLLALASGLQVVYIRRLFSKSVAYNRV  215



>ref|XP_010107717.1| Transmembrane emp24 domain-containing protein A [Morus notabilis]
 gb|EXC16752.1| Transmembrane emp24 domain-containing protein A [Morus notabilis]
Length=217

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFWNSDHPGID TVTSPG N VH++KGTSGDKF+FKAP SGMYKFCFHNPYSTPET
Sbjct  59   VDHDIFWNSDHPGIDLTVTSPGGNTVHTLKGTSGDKFEFKAPHSGMYKFCFHNPYSTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHL+PINVKIAELREALESVT+EQKYLKARD RHRHTNEST
Sbjct  119  VSFYIHVGHIPNEHDLAKDEHLNPINVKIAELREALESVTAEQKYLKARDTRHRHTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  179  RKRVIFYTVGEYFLLAAVSALQVIYIRRLFSKSVAYNRV  217



>ref|XP_009145255.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Brassica rapa]
 emb|CDY10677.1| BnaA05g16850D [Brassica napus]
Length=217

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+VH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  59   VDHDIFWGSDHPGLDFTVTSPAGNIVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV SEQKYLKARD RHRHTNEST
Sbjct  119  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVSEQKYLKARDTRHRHTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  179  RKRVIFYTVGEYIFLAAASGLQVLYIRKLFSKSVAYNRV  217



>emb|CDY10314.1| BnaC05g29650D [Brassica napus]
Length=217

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+VH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  59   VDHDIFWGSDHPGLDFTVTSPAGNIVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV SEQKYLKARD RHRHTNEST
Sbjct  119  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVSEQKYLKARDTRHRHTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  179  RKRVIFYTVGEYIFLAAASGLQVLYIRKLFSKSVAYNRV  217



>ref|XP_007034875.1| Emp24/gp25L/p24 family/GOLD family protein isoform 1 [Theobroma 
cacao]
 gb|EOY05801.1| Emp24/gp25L/p24 family/GOLD family protein isoform 1 [Theobroma 
cacao]
Length=212

 Score =   307 bits (787),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVTSPG N V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  54   VDHDIFWSSDHPGIDFTVTSPGGNTVQNLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP EH+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHR+TNEST
Sbjct  114  VSFYIHVGHIPTEHDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRNTNEST  173

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVI YTVGEY+LLALAS+LQV+YIR+LFSKSVAYNRV
Sbjct  174  RKRVIGYTVGEYVLLALASALQVIYIRQLFSKSVAYNRV  212



>ref|XP_011090665.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Sesamum indicum]
Length=218

 Score =   307 bits (787),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVTSP  N VH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  60   VDHDIFWSSDHPGIDFTVTSPAGNTVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP EH+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNEST
Sbjct  120  VSFYIHVGHIPTEHDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RVIFYTV EYILLAL S LQVVYIR+LFSKSVAYNRV
Sbjct  180  RRRVIFYTVAEYILLALVSGLQVVYIRKLFSKSVAYNRV  218



>ref|XP_002517064.1| coated vesicle membrane protein, putative [Ricinus communis]
 gb|EEF45227.1| coated vesicle membrane protein, putative [Ricinus communis]
Length=210

 Score =   306 bits (785),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSP DNVVH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  52   VDHDIFWSSDHPGIDLTVTSPADNVVHTVKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPN H+LAKDEHL+PINVKIAELREALESVT+EQKYLKARDARHR TNEST
Sbjct  112  VSFYIHVGHIPNAHDLAKDEHLNPINVKIAELREALESVTAEQKYLKARDARHRRTNEST  171

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVI YTVGEYILL L S+LQVVYIRRLFSKSVAYNRV
Sbjct  172  RKRVIGYTVGEYILLGLVSTLQVVYIRRLFSKSVAYNRV  210



>ref|XP_008438614.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Cucumis melo]
Length=215

 Score =   306 bits (784),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW +DHPGIDFTVTSP  NVVHS+K TSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  57   VDHDIFWGADHPGIDFTVTSPAGNVVHSLKETSGDKFEFKAPRSGMYKFCFHNPYSTPET  116

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNE++ AKDEHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNEST
Sbjct  117  VSFYIHVGHIPNENDHAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNEST  176

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY+LLA+AS LQV+YIRRLFSKSVAYNRV
Sbjct  177  RKRVIFYTVGEYLLLAVASGLQVIYIRRLFSKSVAYNRV  215



>ref|XP_004134119.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Cucumis sativus]
 ref|XP_004162266.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Cucumis sativus]
 gb|KGN56940.1| hypothetical protein Csa_3G145770 [Cucumis sativus]
Length=215

 Score =   306 bits (784),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW +DHPGI+FTVTSP  NVVHS+K TSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  57   VDHDIFWGADHPGIEFTVTSPAGNVVHSLKETSGDKFEFKAPRSGMYKFCFHNPYSTPET  116

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+ AKDEHLDPINVKIAELREALESV SEQKYLKARDARHRHTNEST
Sbjct  117  VSFYIHVGHIPNEHDHAKDEHLDPINVKIAELREALESVISEQKYLKARDARHRHTNEST  176

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY+LLA+AS LQV+YIRRLFSKSVAYNRV
Sbjct  177  RKRVIFYTVGEYLLLAVASGLQVIYIRRLFSKSVAYNRV  215



>ref|XP_006406122.1| hypothetical protein EUTSA_v10021495mg [Eutrema salsugineum]
 gb|ESQ47575.1| hypothetical protein EUTSA_v10021495mg [Eutrema salsugineum]
Length=217

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  59   VDHDIFWGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  119  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  179  RKRVIFYTVGEYIFLAAASGLQVLYIRKLFSKSVAYNRV  217



>ref|XP_010693774.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Beta vulgaris subsp. vulgaris]
Length=217

 Score =   305 bits (781),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVTSP  NVVH++KGT+GDKF+ KAPRSGMYKFCFHNPYS PET
Sbjct  59   VDHDIFWSSDHPGIDFTVTSPAGNVVHTLKGTAGDKFELKAPRSGMYKFCFHNPYSAPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP+EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST
Sbjct  119  VSFYIHVGHIPSEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYT+ EY++L +AS LQVVYIR+LFSKSV YNRV
Sbjct  179  RKRVIFYTLAEYMMLIVASGLQVVYIRKLFSKSVGYNRV  217



>ref|XP_011030626.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Populus euphratica]
Length=211

 Score =   305 bits (780),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGIDFT TSPGDN VH++KGTSGDKF+FKAPRSGMYKFCFHNPY+TPET
Sbjct  53   VDHDIFWGSDHPGIDFTATSPGDNTVHTVKGTSGDKFEFKAPRSGMYKFCFHNPYATPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP+EH+LAKDEHL+P+NVKIAELREALESVT+EQ+YLKARD RHRHTNEST
Sbjct  113  VSFYIHVGHIPSEHDLAKDEHLNPVNVKIAELREALESVTAEQRYLKARDIRHRHTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RVI YTVGEY+LLA AS+LQVVYIRRLFSKSVAYNRV
Sbjct  173  RRRVIAYTVGEYLLLAAASTLQVVYIRRLFSKSVAYNRV  211



>gb|AFK37006.1| unknown [Lotus japonicus]
Length=215

 Score =   305 bits (780),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGID TVTSP  N VH +KGTSGDKF FKAP SGMYKFCFHNPYSTPET
Sbjct  57   VDHDIFWGSDHPGIDLTVTSPAGNTVHDIKGTSGDKFQFKAPASGMYKFCFHNPYSTPET  116

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVT+EQKYLKARD RHRHTNEST
Sbjct  117  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTAEQKYLKARDTRHRHTNEST  176

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R RVIFYTVGEY+LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  177  RSRVIFYTVGEYLLLAAVSTLQVIYIRRLFSKSVAYNRV  215



>gb|KDO74439.1| hypothetical protein CISIN_1g028009mg [Citrus sinensis]
Length=215

 Score =   305 bits (780),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW++DHPGIDFTVTSP  NVVH++KGTSGDKF+FKAPRSGMYKFCF+NPYSTPET
Sbjct  57   VDHDIFWSTDHPGIDFTVTSPAGNVVHTVKGTSGDKFEFKAPRSGMYKFCFNNPYSTPET  116

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESV SEQKYL+ARD RHRHTNEST
Sbjct  117  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVVSEQKYLRARDTRHRHTNEST  176

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKR++ YT+GEY+LLA+AS+LQV+YIR+LFSKSVAYNRV
Sbjct  177  RKRLLGYTIGEYVLLAMASALQVLYIRKLFSKSVAYNRV  215



>ref|XP_009135831.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Brassica rapa]
 emb|CDX92961.1| BnaA03g36830D [Brassica napus]
Length=219

 Score =   305 bits (780),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDH+IFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  61   VDHEIFWGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  120

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  121  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  180

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  181  RKRVIFYTVGEYIFLAAASGLQVLYIRKLFSKSVAYNRV  219



>ref|XP_010511795.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Camelina sativa]
Length=214

 Score =   304 bits (778),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  56   VDHDIFWGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  116  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  175

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY+ LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  176  RKRVIFYTVGEYMFLAAASGLQVLYIRKLFSKSVAYNRV  214



>gb|KFK39568.1| hypothetical protein AALP_AA3G261200 [Arabis alpina]
Length=214

 Score =   304 bits (778),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  56   VDHDIFWGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  116  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  175

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY+ LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  176  RKRVIFYTVGEYMFLAAASGLQVLYIRKLFSKSVAYNRV  214



>emb|CDY61077.1| BnaCnng37320D [Brassica napus]
Length=219

 Score =   304 bits (778),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDH+IFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  61   VDHEIFWGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  120

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  121  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  180

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  181  RKRVIFYTVGEYIFLAAASGLQVLYIRKLFSKSVAYNRV  219



>ref|XP_010466578.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane emp24 domain-containing 
protein p24beta3 [Camelina sativa]
Length=218

 Score =   304 bits (778),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  60   VDHDIFWGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  120  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY+ LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  180  RKRVIFYTVGEYMFLAAASGLQVLYIRKLFSKSVAYNRV  218



>ref|NP_188924.3| transmembrane emp24 domain-containing protein p24beta3 [Arabidopsis 
thaliana]
 sp|Q9LIL4.1|P24B3_ARATH RecName: Full=Transmembrane emp24 domain-containing protein p24beta3; 
AltName: Full=p24 family protein beta2; Short=p24beta2; 
AltName: Full=p24 family protein beta3; Short=p24beta3; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03029.1| coated vesicle membrane protein-like [Arabidopsis thaliana]
 gb|AAL50082.1| AT3g22845/MWI23_22 [Arabidopsis thaliana]
 gb|AAM10366.1| AT3g22845/MWI23_22 [Arabidopsis thaliana]
 gb|AEE76683.1| transmembrane emp24 domain-containing protein p24beta3 [Arabidopsis 
thaliana]
Length=214

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAP+SGMYKFCFHNPYSTPET
Sbjct  56   VDHDIFWGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPKSGMYKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  116  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  175

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  176  RKRVIFYTVGEYIFLAAASGLQVLYIRKLFSKSVAYNRV  214



>ref|XP_006489467.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Citrus sinensis]
Length=215

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW++DHPGIDFTVTSP  NVVH++KGTSGDKF+FKAPRSGMYKFCF+NPYSTPET
Sbjct  57   VDHDIFWSTDHPGIDFTVTSPAGNVVHTVKGTSGDKFEFKAPRSGMYKFCFNNPYSTPET  116

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESV SEQKYL+ARD RHRHTNEST
Sbjct  117  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVVSEQKYLRARDTRHRHTNEST  176

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKR++ YT+GEY+LLA+AS+LQ++YIR+LFSKSVAYNRV
Sbjct  177  RKRLLGYTIGEYVLLAMASALQMLYIRKLFSKSVAYNRV  215



>ref|XP_006299601.1| hypothetical protein CARUB_v10015779mg [Capsella rubella]
 gb|EOA32499.1| hypothetical protein CARUB_v10015779mg [Capsella rubella]
Length=214

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  56   VDHDIFWGSDHPGLDFTVTSPAGNIVQTVKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  116  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  175

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY+ LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  176  RKRVIFYTVGEYMFLAAASGLQVLYIRKLFSKSVAYNRV  214



>ref|XP_002883380.1| hypothetical protein ARALYDRAFT_479795 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59639.1| hypothetical protein ARALYDRAFT_479795 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  56   VDHDIFWGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  116  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  175

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVI YTVGEYI LA AS LQV+YIR+LFSKSVAYNRV
Sbjct  176  RKRVILYTVGEYIFLAAASGLQVLYIRKLFSKSVAYNRV  214



>gb|KHN02756.1| Transmembrane emp24 domain-containing protein A [Glycine soja]
Length=210

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFWNSDHPGIDFTVTS   N VH++KGTSGDKF FKAP  GMYKFCFHNPYSTPET
Sbjct  52   VDHDIFWNSDHPGIDFTVTSAAGNTVHNIKGTSGDKFSFKAPTHGMYKFCFHNPYSTPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP+EH+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNEST
Sbjct  112  VSFYIHVGHIPSEHDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNEST  171

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYTVGEY+LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  172  RKRVVFYTVGEYLLLAAVSALQVIYIRRLFSKSVAYNRV  210



>ref|NP_001238453.1| uncharacterized protein LOC100306668 precursor [Glycine max]
 gb|ACU14958.1| unknown [Glycine max]
Length=210

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFWNSDHPGIDFTVTS   N VH++KGTSGDKF FKAP  GMYKFCFHNPYSTPET
Sbjct  52   VDHDIFWNSDHPGIDFTVTSAAGNTVHNIKGTSGDKFSFKAPTHGMYKFCFHNPYSTPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP+EH+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNEST
Sbjct  112  VSFYIHVGHIPSEHDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNEST  171

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYTVGEY+LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  172  RKRVVFYTVGEYLLLAAVSALQVIYIRRLFSKSVAYNRV  210



>emb|CDY46609.1| BnaCnng14310D [Brassica napus]
Length=218

 Score =   303 bits (776),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHD+FW  DHPGIDFTVTSP  N+V +MKGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  60   VDHDVFWGPDHPGIDFTVTSPAGNIVQTMKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELRE+LESV +EQKYLKARD RHRHTNEST
Sbjct  120  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELRESLESVVAEQKYLKARDTRHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEYI LA AS LQ++YIR+LFSKSVAYNRV
Sbjct  180  RKRVIFYTVGEYIFLAAASGLQILYIRKLFSKSVAYNRV  218



>ref|XP_010532582.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Tarenaya hassleriana]
Length=217

 Score =   303 bits (775),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DF V+SP  N+VHS+KGTSGDKF+FKAPRSGMYKFCFHNP+STPET
Sbjct  59   VDHDIFWGSDHPGLDFDVSSPAGNIVHSLKGTSGDKFEFKAPRSGMYKFCFHNPHSTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH++AKDEHLDPINVKIAELREALESV SEQKYLKARD RHRHTNEST
Sbjct  119  VSFYIHVGHIPNEHDVAKDEHLDPINVKIAELREALESVISEQKYLKARDTRHRHTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY+LLA AS LQV+YIR+LFSKSVAYNRV
Sbjct  179  RKRVIFYTVGEYLLLAAASGLQVLYIRKLFSKSVAYNRV  217



>ref|XP_006420043.1| hypothetical protein CICLE_v10005664mg [Citrus clementina]
 gb|ESR33283.1| hypothetical protein CICLE_v10005664mg [Citrus clementina]
Length=261

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW++DHPGIDFTVTSP  NVVH++KGTSGDKF+FKAPRSGMYKFCF+NPYSTPET
Sbjct  103  VDHDIFWSTDHPGIDFTVTSPAGNVVHTVKGTSGDKFEFKAPRSGMYKFCFNNPYSTPET  162

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESV SEQKYL+ARD RHRHTNEST
Sbjct  163  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVVSEQKYLRARDTRHRHTNEST  222

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKR++ YT+GEY+LLA+AS+LQV+YIR+LFSKSVAYNRV
Sbjct  223  RKRLLGYTIGEYVLLAMASALQVLYIRKLFSKSVAYNRV  261



>ref|XP_010279262.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Nelumbo nucifera]
Length=214

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSP  N VH++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  56   VDHDIFWSSDHPGIDLTVTSPAGNTVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESV +EQKYLKARDARHRHTNEST
Sbjct  116  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVMAEQKYLKARDARHRHTNEST  175

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            ++RVIFYT+ EY++L  AS LQVVYIRRLFSKSVAYNRV
Sbjct  176  QRRVIFYTLAEYLMLFCASGLQVVYIRRLFSKSVAYNRV  214



>gb|EYU41435.1| hypothetical protein MIMGU_mgv1a013526mg [Erythranthe guttata]
Length=218

 Score =   302 bits (774),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFWNSDHPGIDFTVTSP  + VH+MKGT+GDKF+FKAP+SGMYKFCFHNP+STPET
Sbjct  60   VDHDIFWNSDHPGIDFTVTSPAGDTVHNMKGTAGDKFEFKAPKSGMYKFCFHNPFSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP EH+LAKDEHLDPINVKIAELREALESVT+EQ YLKARD RHRHTNEST
Sbjct  120  VSFYIHVGHIPTEHDLAKDEHLDPINVKIAELREALESVTAEQNYLKARDTRHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTV EYILLAL S LQV YIRRLFSKSVAYNRV
Sbjct  180  RKRVIFYTVAEYILLALVSGLQVAYIRRLFSKSVAYNRV  218



>ref|XP_010259153.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nelumbo nucifera]
Length=214

 Score =   302 bits (773),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDH+IFW+SDHPGIDFTVT+PG NVVH++KGTSGDKF+FKAPR+GM+KFCFHNPYSTPET
Sbjct  56   VDHEIFWSSDHPGIDFTVTAPGGNVVHTLKGTSGDKFEFKAPRNGMFKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF+IHVGHIPNEH+LAKDEHLDPINVKIAELREALE+VT+EQKYLKARDARHRHTNEST
Sbjct  116  VSFHIHVGHIPNEHDLAKDEHLDPINVKIAELREALEAVTAEQKYLKARDARHRHTNEST  175

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RVIFYT+ EY+LL  AS LQVVYIRRLFSKSVAYNRV
Sbjct  176  RRRVIFYTLAEYLLLICASGLQVVYIRRLFSKSVAYNRV  214



>ref|NP_001238171.1| uncharacterized protein LOC100499675 precursor [Glycine max]
 ref|XP_006605302.1| PREDICTED: uncharacterized protein LOC100499675 isoform X1 [Glycine 
max]
 gb|ACU13193.1| unknown [Glycine max]
Length=210

 Score =   301 bits (771),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVT+   N VHS+KGTSGDKF FKAP  GMYKFCFHNPYSTPET
Sbjct  52   VDHDIFWSSDHPGIDFTVTTAAGNTVHSIKGTSGDKFSFKAPSHGMYKFCFHNPYSTPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP+EH+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNEST
Sbjct  112  VSFYIHVGHIPSEHDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNEST  171

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYTVGEY+LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  172  RKRVVFYTVGEYLLLAAVSALQVIYIRRLFSKSVAYNRV  210



>ref|XP_009108603.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Brassica rapa]
Length=218

 Score =   301 bits (772),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHD+FW  DHPGIDFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  60   VDHDVFWGPDHPGIDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELRE+LESV +EQKYLKARD RHRHTNEST
Sbjct  120  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELRESLESVVAEQKYLKARDTRHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEYI LA AS LQ++YIR+LFSKSVAYNRV
Sbjct  180  RKRVIFYTVGEYIFLAAASGLQILYIRKLFSKSVAYNRV  218



>emb|CDY34226.1| BnaA01g24430D [Brassica napus]
Length=218

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHD+FW  DHPGIDFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  60   VDHDVFWGPDHPGIDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELRE+LESV +EQKYLKARD RHRHTNEST
Sbjct  120  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELRESLESVVAEQKYLKARDTRHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEYI LA AS LQ++YIR+LFSKSVAYNRV
Sbjct  180  RKRVIFYTVGEYIFLAAASGLQILYIRKLFSKSVAYNRV  218



>gb|KEH43778.1| emp24/gp25L/p24 family protein [Medicago truncatula]
Length=213

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVTSPG NVV  +KGTSGDKF FKAP  GMYKFCFHNPYSTPET
Sbjct  55   VDHDIFWSSDHPGIDFTVTSPGGNVVQDIKGTSGDKFQFKAPVHGMYKFCFHNPYSTPET  114

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP+EH+LAKDEHLDPINVKIAELREALESVT+EQKYL+ARDARHRHTNEST
Sbjct  115  VSFYIHVGHIPSEHDLAKDEHLDPINVKIAELREALESVTAEQKYLRARDARHRHTNEST  174

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KRVIFYTVGEY+LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  175  HKRVIFYTVGEYLLLAAVSALQVIYIRRLFSKSVAYNRV  213



>ref|XP_007143318.1| hypothetical protein PHAVU_007G062200g [Phaseolus vulgaris]
 gb|ESW15312.1| hypothetical protein PHAVU_007G062200g [Phaseolus vulgaris]
Length=210

 Score =   301 bits (770),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVTSPG N V ++KGTSGDKFDFKAP+ GMYKFCFHNP STPET
Sbjct  52   VDHDIFWSSDHPGIDFTVTSPGGNTVTNIKGTSGDKFDFKAPKHGMYKFCFHNPQSTPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP+EH+LAKDEHLDP+NVKIAELREALESVT+EQKYLKARDARHRHTNEST
Sbjct  112  VSFYIHVGHIPSEHDLAKDEHLDPVNVKIAELREALESVTAEQKYLKARDARHRHTNEST  171

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYTVGEY LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  172  RKRVVFYTVGEYFLLAAVSALQVLYIRRLFSKSVAYNRV  210



>ref|XP_004496668.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Cicer arietinum]
Length=216

 Score =   297 bits (761),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFT TSPG NVV  +KGTSGDKF FKAP  GMYKFCFHNPYSTPET
Sbjct  58   VDHDIFWSSDHPGIDFTATSPGGNVVQDIKGTSGDKFQFKAPVHGMYKFCFHNPYSTPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP+EH+LAKDEHLDPINVKIAELREALESVT+EQKYL+ARDARHRHTNEST
Sbjct  118  VSFYIHVGHIPSEHDLAKDEHLDPINVKIAELREALESVTAEQKYLRARDARHRHTNEST  177

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              RVIFYTVGEY+LLA  S LQV+YIRRLFSKSVAYNRV
Sbjct  178  HTRVIFYTVGEYLLLAAVSVLQVIYIRRLFSKSVAYNRV  216



>gb|KHG26199.1| Transmembrane emp24 domain-containing A [Gossypium arboreum]
Length=212

 Score =   297 bits (760),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGIDFTVTSP  N VH +KGTSGDKF+FKAPRSGMYKFCFHNP+S PET
Sbjct  54   VDHDIFWGSDHPGIDFTVTSPAGNTVHELKGTSGDKFEFKAPRSGMYKFCFHNPHSAPET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF+IH+GHIP EH+LAKDEHLDPINVKIAELREALESVT+EQKYLKARD RHRHTNEST
Sbjct  114  VSFHIHIGHIPTEHDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDTRHRHTNEST  173

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVI YTVGEYILL L S+LQV+YIR+LFSKSVAYNRV
Sbjct  174  RKRVIGYTVGEYILLTLVSALQVIYIRQLFSKSVAYNRV  212



>ref|XP_007223416.1| hypothetical protein PRUPE_ppa011292mg [Prunus persica]
 gb|EMJ24615.1| hypothetical protein PRUPE_ppa011292mg [Prunus persica]
Length=216

 Score =   297 bits (760),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  58   VDHDIFWGSDHPGLDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF IHVGHIPNEHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNEST
Sbjct  118  VSFNIHVGHIPNEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNEST  177

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+ YTVGEYI LA AS+LQVVYIR+LFSKSV YNRV
Sbjct  178  RRRVVMYTVGEYIALAAASALQVVYIRKLFSKSVGYNRV  216



>ref|XP_008224230.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Prunus mume]
Length=216

 Score =   296 bits (759),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  58   VDHDIFWGSDHPGLDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF IHVGHIPNEHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNEST
Sbjct  118  VSFNIHVGHIPNEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNEST  177

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+ YTVGEYI LA AS+LQVVYIR+LFSKSV YNRV
Sbjct  178  RRRVVMYTVGEYIALAAASALQVVYIRKLFSKSVGYNRV  216



>ref|XP_010034397.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Eucalyptus grandis]
 gb|KCW84120.1| hypothetical protein EUGRSUZ_B01001 [Eucalyptus grandis]
Length=216

 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDF VTSPG NVV ++KGTSGDKF FKAPRSGMYKFCFHNPYSTPET
Sbjct  58   VDHDIFWSSDHPGIDFIVTSPGGNVVQTLKGTSGDKFKFKAPRSGMYKFCFHNPYSTPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF IH GHIPN+H+LAKDEHLDPINVKIAELREALESVT EQKYLKARD+RHRHTNEST
Sbjct  118  VSFNIHAGHIPNDHDLAKDEHLDPINVKIAELREALESVTLEQKYLKARDSRHRHTNEST  177

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVI+YTV EY+LLA  S+LQVVYIRRLFSKSV YNRV
Sbjct  178  RKRVIYYTVAEYLLLACVSTLQVVYIRRLFSKSVGYNRV  216



>ref|XP_004296587.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Fragaria vesca subsp. vesca]
Length=217

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW++DHPG+D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  59   VDHDIFWSNDHPGLDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF+IHVGHIP+EHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNEST
Sbjct  119  VSFHIHVGHIPSEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDTRHRHTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYT+GEY++L  AS LQ+VYIRRLFSKS+ YNRV
Sbjct  179  RKRVVFYTLGEYLMLVAASGLQIVYIRRLFSKSIGYNRV  217



>gb|KJB38216.1| hypothetical protein B456_006G242900 [Gossypium raimondii]
Length=212

 Score =   293 bits (751),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGIDFTVTSP  N VH +KGTSGDKF+ KAPRSGMYKFCFHNP+S PET
Sbjct  54   VDHDIFWGSDHPGIDFTVTSPLGNTVHELKGTSGDKFEVKAPRSGMYKFCFHNPHSAPET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF+IHVGHIP EH+LAKDEHLDPINVKIAELREALESVT+EQKYLKARD RHRHTNEST
Sbjct  114  VSFHIHVGHIPTEHDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDTRHRHTNEST  173

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVI YTVGEYILL L S+LQV+YIR+LFSKSVAYNRV
Sbjct  174  RKRVIGYTVGEYILLTLVSALQVIYIRQLFSKSVAYNRV  212



>ref|XP_003559757.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Brachypodium distachyon]
Length=213

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSPG N V+S+KG SGDKFDFKAPR GMYKFCFHNPY  PET
Sbjct  55   VDHDIFWSSDHPGIDLTVTSPGGNTVYSLKGKSGDKFDFKAPRGGMYKFCFHNPYGAPET  114

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDPINVKIAEL+EALESVTSEQKYLKAR+ARHRHTNEST
Sbjct  115  VSFYIHVGHIPNEHDLAKDEHLDPINVKIAELKEALESVTSEQKYLKAREARHRHTNEST  174

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+FYT+ EY+    AS+LQVVYIRRLFSK+VAYNRV
Sbjct  175  RRRVMFYTMAEYLAFMAASALQVVYIRRLFSKNVAYNRV  213



>gb|AFP87418.1| putative EMP24-domain containing protein [Triticum turgidum subsp. 
durum]
Length=213

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSPG N V++MKG SGDKFDFKAPR GMYKFCFHNPY  PET
Sbjct  55   VDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGKSGDKFDFKAPRGGMYKFCFHNPYGAPET  114

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKARDARHRHTNEST
Sbjct  115  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKARDARHRHTNEST  174

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+FYT+ EY     AS+LQVVYIRRLFSK+V YNRV
Sbjct  175  RRRVMFYTMAEYAAFMAASALQVVYIRRLFSKNVGYNRV  213



>ref|XP_004981806.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Setaria italica]
Length=215

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSPG N VH++KG SG+KF+FKAPR GMYKFCFHNPY  PET
Sbjct  57   VDHDIFWSSDHPGIDLTVTSPGGNTVHTLKGKSGEKFEFKAPRGGMYKFCFHNPYGAPET  116

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNEST
Sbjct  117  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNEST  176

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYT+ EY+    AS+LQVVYIRRLFSK+VAYNRV
Sbjct  177  RKRVMFYTMAEYLAFMAASALQVVYIRRLFSKNVAYNRV  215



>ref|XP_002463892.1| hypothetical protein SORBIDRAFT_01g008390 [Sorghum bicolor]
 gb|EER90890.1| hypothetical protein SORBIDRAFT_01g008390 [Sorghum bicolor]
Length=213

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSPG N VH++KG SGDKF+FKAPR GMYKFCFHNPY  PET
Sbjct  55   VDHDIFWSSDHPGIDLTVTSPGGNTVHTLKGKSGDKFEFKAPRGGMYKFCFHNPYGAPET  114

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNEST
Sbjct  115  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNEST  174

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYT+ EYI    AS+LQV+YIRRLFSK+V YNRV
Sbjct  175  RKRVMFYTMAEYIAFMAASALQVLYIRRLFSKNVGYNRV  213



>ref|XP_009778405.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nicotiana sylvestris]
Length=220

 Score =   292 bits (747),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDH+IFW+SDHPGIDFTVTSP  NVVH+MKGT+ DKF+ KAPRSGM+KFCFHNP+STPET
Sbjct  62   VDHEIFWSSDHPGIDFTVTSPAGNVVHTMKGTAEDKFELKAPRSGMFKFCFHNPHSTPET  121

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDPINVKIAEL EALESVT+EQKYL+ARDARHRHTNEST
Sbjct  122  VSFYIHVGHIPNEHDLAKDEHLDPINVKIAELGEALESVTAEQKYLRARDARHRHTNEST  181

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KRV+FYTV EY+LL LAS LQV+YIR LFSKS+ YNRV
Sbjct  182  SKRVLFYTVAEYVLLILASGLQVLYIRSLFSKSIGYNRV  220



>gb|EAY91831.1| hypothetical protein OsI_13477 [Oryza sativa Indica Group]
Length=210

 Score =   291 bits (746),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSPG N V+++KG SGDKF+FKAPR GMYKFCFHNPY  PET
Sbjct  52   VDHDIFWSSDHPGIDLTVTSPGGNTVYTLKGKSGDKFEFKAPRGGMYKFCFHNPYGAPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNEST
Sbjct  112  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNEST  171

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+FYT+ EY+    AS+LQVVYIRRLFSK+VAYNRV
Sbjct  172  RRRVMFYTIAEYLAFMGASALQVVYIRRLFSKNVAYNRV  210



>ref|XP_009590337.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Nicotiana tomentosiformis]
Length=218

 Score =   291 bits (745),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDH+IFW+SDHPGIDFTVTSP  NVVH+MKGT+ DKF+ KAPRSGM+KFCFHNP+STPET
Sbjct  60   VDHEIFWSSDHPGIDFTVTSPAGNVVHTMKGTAEDKFELKAPRSGMFKFCFHNPHSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDPINVKIAEL EALESVT+EQKYL+ARDARHRHTNEST
Sbjct  120  VSFYIHVGHIPNEHDLAKDEHLDPINVKIAELGEALESVTAEQKYLRARDARHRHTNEST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KRV+FYTV EY+LL LAS LQV+YIR LFSKS+ YNR+
Sbjct  180  SKRVLFYTVAEYVLLILASGLQVLYIRSLFSKSIGYNRI  218



>dbj|BAJ97536.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSPG N V++MKG SGDKF+FKAPR GMYKFCFHNPY  PET
Sbjct  55   VDHDIFWSSDHPGIDLTVTSPGGNTVYTMKGKSGDKFEFKAPRGGMYKFCFHNPYGAPET  114

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKARDARHRHTNEST
Sbjct  115  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKARDARHRHTNEST  174

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+FYT+ EY     AS+LQVVYIRRLFSK+V YNRV
Sbjct  175  RRRVMFYTMAEYAAFMAASALQVVYIRRLFSKNVGYNRV  213



>ref|NP_001051240.1| Os03g0744800 [Oryza sativa Japonica Group]
 gb|AAP13000.1| putative cop-coated vesicle membrane protein [Oryza sativa Japonica 
Group]
 gb|ABF98827.1| emp24/gp25L/p24 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13154.1| Os03g0744800 [Oryza sativa Japonica Group]
 dbj|BAG87251.1| unnamed protein product [Oryza sativa Japonica Group]
Length=210

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSPG N V+++KG SGDKF+FKAPR GMYKFCFHNPY  PET
Sbjct  52   VDHDIFWSSDHPGIDLTVTSPGGNTVYTLKGKSGDKFEFKAPRGGMYKFCFHNPYGAPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNEST
Sbjct  112  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNEST  171

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+FYT+ EY+    AS+LQVVYIRRLFSK+VAYNRV
Sbjct  172  RRRVMFYTIAEYLAFMGASALQVVYIRRLFSKNVAYNRV  210



>ref|XP_010525219.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Tarenaya hassleriana]
Length=214

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DF V+SP  NVVHS+KGTSGDKF+FKAP+SGMYKFCFHNPYSTPET
Sbjct  56   VDHDIFWGSDHPGLDFEVSSPAGNVVHSLKGTSGDKFEFKAPKSGMYKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH++AKDEHLDPINVKIAELREALESV SEQKYLKARDARHRHTNEST
Sbjct  116  VSFYIHVGHIPNEHDVAKDEHLDPINVKIAELREALESVISEQKYLKARDARHRHTNEST  175

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY+LLA AS+LQV+YIR+LFSKSVAYNRV
Sbjct  176  RKRVIFYTVGEYLLLAAASALQVLYIRKLFSKSVAYNRV  214



>emb|CDO99114.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   291 bits (744),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVT+PG N VHS++GTSGDKFDFKAPRSGMYKFCFHNPYSTPET
Sbjct  61   VDHDIFWSSDHPGIDLTVTAPGGNQVHSVRGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  120

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP EH+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNEST
Sbjct  121  VSFYIHVGHIPTEHDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNEST  180

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYT  EY+LLALASSLQV+YIRRLFSKSVAYNRV
Sbjct  181  RKRVIFYTATEYLLLALASSLQVLYIRRLFSKSVAYNRV  219



>ref|NP_001136501.1| uncharacterized protein LOC100216616 precursor [Zea mays]
 gb|ACF82060.1| unknown [Zea mays]
 tpg|DAA51293.1| TPA: hypothetical protein ZEAMMB73_334057 [Zea mays]
Length=213

 Score =   290 bits (742),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSPG N VH++KG SGDKF+FKAP+ GMYKFCFHNPY  PET
Sbjct  55   VDHDIFWSSDHPGIDLTVTSPGGNTVHTLKGKSGDKFEFKAPKGGMYKFCFHNPYGAPET  114

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL+E LESVT+EQKYLKAR+ARHRHTNEST
Sbjct  115  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEVLESVTAEQKYLKAREARHRHTNEST  174

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYT+ EYI    AS+LQV+YIRR+FSK+V YNRV
Sbjct  175  RKRVMFYTMAEYIAFVAASTLQVLYIRRMFSKNVGYNRV  213



>ref|XP_009399353.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Musa acuminata subsp. malaccensis]
Length=216

 Score =   289 bits (739),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFWNSDHPGID  VTSP  N VHS+KGTSGDKF+FKAPR GMYKFCFHNP  TPET
Sbjct  58   VDHDIFWNSDHPGIDLVVTSPAGNTVHSLKGTSGDKFEFKAPRGGMYKFCFHNPNRTPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHL+PINVKIAELREALESVT+EQ+YLKAR+ARHRHTNEST
Sbjct  118  VSFYIHVGHIPNEHDLAKDEHLNPINVKIAELREALESVTAEQRYLKAREARHRHTNEST  177

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+R+  YT+ EY++LA AS LQVVYIRRLF+KSVAYNRV
Sbjct  178  RRRLTVYTLTEYLVLACASGLQVVYIRRLFNKSVAYNRV  216



>ref|XP_010923517.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Elaeis guineensis]
Length=216

 Score =   288 bits (738),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHD+FW+SDHPGID  VTSPG N VHSMKGTSGDKF+FKAP++GMYKFCFHNP  TPET
Sbjct  58   VDHDLFWSSDHPGIDLVVTSPGGNTVHSMKGTSGDKFEFKAPQAGMYKFCFHNPDRTPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFY+HVGHIPNEH+LAKDEHLDPINVKIA+LREALESVT+EQ+YL+AR+ARHRHTNEST
Sbjct  118  VSFYVHVGHIPNEHDLAKDEHLDPINVKIAQLREALESVTAEQRYLRAREARHRHTNEST  177

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+R+IFYT+ EY++LA AS LQVVYI RLF+KSVAYNRV
Sbjct  178  RRRLIFYTIMEYLVLACASGLQVVYIHRLFNKSVAYNRV  216



>ref|XP_010917620.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Elaeis guineensis]
Length=217

 Score =   288 bits (738),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGID  VTSPG N VH++KGTSGDKF+FKAPR+GMYKFCFHNP  TPET
Sbjct  59   VDHDIFWGSDHPGIDLVVTSPGGNTVHTLKGTSGDKFEFKAPRAGMYKFCFHNPQRTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVT EQ+YLKAR++RHR TNEST
Sbjct  119  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTGEQRYLKARESRHRRTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R R+IFYTV EY+ L  AS LQVVYIRRLFSK+VAYNRV
Sbjct  179  RSRLIFYTVVEYLTLVCASVLQVVYIRRLFSKTVAYNRV  217



>ref|XP_010551705.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010551706.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
isoform X2 [Tarenaya hassleriana]
Length=217

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW +DHPG+DF V+SP  NVVHS+KGTSGDKF+FKAP+SGMYKFCFHNPYS+PET
Sbjct  59   VDHDIFWGADHPGLDFEVSSPAGNVVHSLKGTSGDKFEFKAPKSGMYKFCFHNPYSSPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH++AKDEHLDPINVKIAELREALESV SEQKYLKARDARHRHTNEST
Sbjct  119  VSFYIHVGHIPNEHDIAKDEHLDPINVKIAELREALESVISEQKYLKARDARHRHTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYTVGEY+LLA AS+LQV+YIR+LFSKSVAYNRV
Sbjct  179  RKRVIFYTVGEYLLLAAASALQVLYIRKLFSKSVAYNRV  217



>ref|NP_001141300.1| Suppressor/enhancer of lin-12 protein 9 precursor [Zea mays]
 gb|ACF86022.1| unknown [Zea mays]
 gb|ACG34453.1| suppressor/enhancer of lin-12 protein 9 precursor [Zea mays]
 gb|ACN34583.1| unknown [Zea mays]
 gb|AFW67650.1| Suppressor/enhancer of lin-12 protein 9 [Zea mays]
Length=213

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGID TVTSPG N V+++KG SG+KF+FKAPR GMYKFCFHNPY  PET
Sbjct  55   VDHDIFWSSDHPGIDLTVTSPGGNTVYTLKGKSGEKFEFKAPRGGMYKFCFHNPYGAPET  114

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNEST
Sbjct  115  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNEST  174

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYT+ EY+    AS+LQV+YIRRLFSK+V YNRV
Sbjct  175  RKRVMFYTMAEYLAFMAASALQVLYIRRLFSKNVGYNRV  213



>ref|XP_009398371.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Musa acuminata subsp. malaccensis]
Length=216

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGID  VTSP  N VH+MKGTSGDKFDFKAPR+GMYKFCFHN    PET
Sbjct  58   VDHDIFWGSDHPGIDLIVTSPAGNTVHTMKGTSGDKFDFKAPRAGMYKFCFHNANRAPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDPINVKIA+LREALESVT+EQ+YLKAR+ARHRHTNEST
Sbjct  118  VSFYIHVGHIPNEHDLAKDEHLDPINVKIAQLREALESVTAEQRYLKAREARHRHTNEST  177

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKR+ FYTV EY++LA AS LQVVYIRRLF++SVAYNRV
Sbjct  178  RKRLTFYTVMEYLVLACASGLQVVYIRRLFNRSVAYNRV  216



>ref|XP_006838935.1| hypothetical protein AMTR_s00002p00270370 [Amborella trichopoda]
 gb|ERN01504.1| hypothetical protein AMTR_s00002p00270370 [Amborella trichopoda]
Length=222

 Score =   288 bits (736),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVT+P  NVV+++KGTSGDKF FKAPRSGMYKFCFHN YSTPET
Sbjct  64   VDHDIFWSSDHPGIDFTVTAPAGNVVYTLKGTSGDKFGFKAPRSGMYKFCFHNSYSTPET  123

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHL+P+NVKIA+LREALESVT+EQ+YLKARDARHRHTNEST
Sbjct  124  VSFYIHVGHIPNEHDLAKDEHLNPVNVKIAQLREALESVTAEQRYLKARDARHRHTNEST  183

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +R+IFYT+GEY  L  AS LQ+ YIRRLF+KSVAYNRV
Sbjct  184  HRRLIFYTLGEYAALLAASGLQIYYIRRLFNKSVAYNRV  222



>ref|XP_008776017.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Phoenix dactylifera]
Length=218

 Score =   287 bits (734),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHD+FW+SDHPGID  VTSPG N+VHS++GTSGDKF+FK P +GMYKFCFHNP  TPET
Sbjct  59   VDHDVFWSSDHPGIDLVVTSPGGNIVHSLQGTSGDKFEFKVPGAGMYKFCFHNPQGTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEHNLAKDEH+DPINVKIAELREALESVT EQ+YLKAR+ARHRHTNEST
Sbjct  119  VSFYIHVGHIPNEHNLAKDEHVDPINVKIAELREALESVTGEQRYLKAREARHRHTNEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+R++FYTV EY+ L  AS LQVVYIRRLFSK+VAYNR+
Sbjct  179  RRRLVFYTVLEYLTLVCASVLQVVYIRRLFSKTVAYNRL  217



>ref|XP_009343969.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=211

 Score =   286 bits (731),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW +DHPG+D  VTSPGDN VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  53   VDHDIFWGADHPGLDLIVTSPGDNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF IHVGHIPNEHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNEST
Sbjct  113  VSFNIHVGHIPNEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+ YTVGEY+ LA AS+LQVVYIR+LFSKSVAYNRV
Sbjct  173  RRRVVLYTVGEYLALAAASALQVVYIRKLFSKSVAYNRV  211



>ref|XP_004493724.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Cicer arietinum]
Length=211

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+SDHPGIDFTVTSPG NV+ S+KGTSGDKF+FKA +SG++KFCFHNP+STPET
Sbjct  53   MDHDIFWSSDHPGIDFTVTSPGGNVIQSLKGTSGDKFEFKATQSGIHKFCFHNPFSTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFY+HVGHIPNEH+LAKDEHLDPINVKIAELREALES+ +EQKYLKARDARHRHTNEST
Sbjct  113  VSFYVHVGHIPNEHDLAKDEHLDPINVKIAELREALESIITEQKYLKARDARHRHTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+ YT+ EYIL    S LQVVYIRRLFSKS AYNRV
Sbjct  173  RKRVVVYTLLEYILFVTTSILQVVYIRRLFSKSFAYNRV  211



>ref|XP_003553473.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Glycine max]
 gb|KHN02550.1| Transmembrane emp24 domain-containing protein A [Glycine soja]
Length=211

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +D+DIFW+SDHPGIDFTVTSPG N+ +S+ GTSGDKF FKA ++G+YKFCFHNP STPET
Sbjct  53   IDYDIFWSSDHPGIDFTVTSPGGNLAYSLNGTSGDKFQFKASQNGIYKFCFHNPASTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDPINVKIAELREALES+ SEQKYLKARDARHRHTNEST
Sbjct  113  VSFYIHVGHIPNEHDLAKDEHLDPINVKIAELREALESIISEQKYLKARDARHRHTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYT+ EY+L A  S LQVVYIRRLFSKS AYNRV
Sbjct  173  RKRVVFYTILEYVLFAATSLLQVVYIRRLFSKSFAYNRV  211



>ref|XP_010317396.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Solanum lycopersicum]
Length=216

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFWNSDHPGIDFTV SP  NVVH+MKGT+GDKF+ KAPRSGMY FCFHNP+S+PET
Sbjct  58   VDHDIFWNSDHPGIDFTVASPSGNVVHTMKGTAGDKFELKAPRSGMYNFCFHNPHSSPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIH+GHI NEH+LAKDEHLDP+NVKIAELREALESVT+EQ YLKARD+RHR TN+ST
Sbjct  118  VSFYIHIGHISNEHDLAKDEHLDPVNVKIAELREALESVTAEQHYLKARDSRHRRTNQST  177

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R RVIFYTV EY+LL LAS LQ +YIR LFSKS+ YNR+
Sbjct  178  RDRVIFYTVAEYLLLILASGLQAMYIRSLFSKSIGYNRI  216



>ref|XP_006356044.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Solanum tuberosum]
Length=216

 Score =   285 bits (729),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVTSP  NVVH+MKGT+GDKF+FKAPRSGM+ FCFHNP+S+PET
Sbjct  58   VDHDIFWSSDHPGIDFTVTSPSGNVVHTMKGTAGDKFEFKAPRSGMFNFCFHNPHSSPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIH+GHI NEH+LAKDEHLDP+NVKIAELREALES+T+EQ YLKARD+RHR TN+ST
Sbjct  118  VSFYIHIGHISNEHDLAKDEHLDPVNVKIAELREALESITTEQHYLKARDSRHRRTNQST  177

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R RVIFYTV EY+LL LAS LQ +YIR LFSKS+ YNR+
Sbjct  178  RDRVIFYTVAEYLLLILASGLQAMYIRSLFSKSIGYNRI  216



>emb|CBI25047.3| unnamed protein product [Vitis vinifera]
Length=180

 Score =   283 bits (725),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFWNSDHPGI+FTVTSPG  +VH++KGTSG+KF+FKAP+SG YKFCF+NP +TPET
Sbjct  22   IDHDIFWNSDHPGIEFTVTSPGGAIVHALKGTSGEKFEFKAPQSGTYKFCFNNPVATPET  81

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNE++LAKDEHLDP+NV+I ELREAL SV +EQKYLKARDARHR TNEST
Sbjct  82   VSFYIHVGHIPNEYDLAKDEHLDPVNVRITELREALLSVAAEQKYLKARDARHRATNEST  141

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+FYT+ EYILLA  S LQVVYIRRLFSKSVAYNRV
Sbjct  142  RRRVVFYTLAEYILLAATSGLQVVYIRRLFSKSVAYNRV  180



>ref|XP_002274733.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
isoform X1 [Vitis vinifera]
Length=210

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFWNSDHPGI+FTVTSPG  +VH++KGTSG+KF+FKAP+SG YKFCF+NP +TPET
Sbjct  52   IDHDIFWNSDHPGIEFTVTSPGGAIVHALKGTSGEKFEFKAPQSGTYKFCFNNPVATPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNE++LAKDEHLDP+NV+I ELREAL SV +EQKYLKARDARHR TNEST
Sbjct  112  VSFYIHVGHIPNEYDLAKDEHLDPVNVRITELREALLSVAAEQKYLKARDARHRATNEST  171

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+FYT+ EYILLA  S LQVVYIRRLFSKSVAYNRV
Sbjct  172  RRRVVFYTLAEYILLAATSGLQVVYIRRLFSKSVAYNRV  210



>gb|KJB12566.1| hypothetical protein B456_002G024500 [Gossypium raimondii]
Length=212

 Score =   283 bits (725),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDH IFW+SDHPGIDF++TSPG +++H++KGTSGDKF FKAPRSG+Y+FCFHNP STPET
Sbjct  54   VDHHIFWSSDHPGIDFSITSPGGDILHNLKGTSGDKFSFKAPRSGLYQFCFHNPLSTPET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            ++FYIH+GHIPNEHNLAK+EHLDPINVKIAELREALE+VT+EQKYLKARDA HR TNEST
Sbjct  114  IAFYIHIGHIPNEHNLAKNEHLDPINVKIAELREALEAVTTEQKYLKARDAVHRRTNEST  173

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            + RVI YTVG+YILL +AS LQ+VYIRRLFSKSV YNR+
Sbjct  174  KTRVIGYTVGQYILLTIASVLQIVYIRRLFSKSVGYNRI  212



>ref|XP_008391009.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=211

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW +DHPG+D  VTSPGDN VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  53   VDHDIFWGADHPGLDLIVTSPGDNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF IHVGHIPNEHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNEST
Sbjct  113  VSFNIHVGHIPNEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+ YTV EY+ LA AS+LQVVYIR+LFSKSVAYNRV
Sbjct  173  RRRVVLYTVAEYLALAAASALQVVYIRKLFSKSVAYNRV  211



>ref|XP_009375992.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=211

 Score =   281 bits (720),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW +DHPG+D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  53   VDHDIFWGADHPGLDLVVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF IHVGHIPNEHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNEST
Sbjct  113  VSFNIHVGHIPNEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+ YTV EY+ LA AS+LQVVYIR+LFSKSVAYNRV
Sbjct  173  RRRVVLYTVAEYLALAAASALQVVYIRKLFSKSVAYNRV  211



>emb|CAN65862.1| hypothetical protein VITISV_007728 [Vitis vinifera]
Length=195

 Score =   281 bits (718),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFWNSDHPGI+FTVTSP   +VH++KGTSG+KF+FKAP+SG YKFCF+NP +TPET
Sbjct  37   IDHDIFWNSDHPGIEFTVTSPEGAIVHALKGTSGEKFEFKAPQSGTYKFCFNNPVATPET  96

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNE++LAKDEHLDP+NV+I ELREAL SV +EQKYLKARDARHR TNEST
Sbjct  97   VSFYIHVGHIPNEYDLAKDEHLDPVNVRITELREALLSVAAEQKYLKARDARHRATNEST  156

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+FYT+ EYILLA  S LQVVYIRRLFSKSVAYNRV
Sbjct  157  RRRVVFYTLAEYILLAATSGLQVVYIRRLFSKSVAYNRV  195



>ref|XP_009371933.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=211

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW +DHPG+D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  53   VDHDIFWGADHPGLDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF IHVGHIPNEHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRHTNEST
Sbjct  113  VSFNIHVGHIPNEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RV+ YTV EY+ LA AS+LQVVYIR+LFSKSVAYNRV
Sbjct  173  RRRVVLYTVAEYLALAAASALQVVYIRKLFSKSVAYNRV  211



>gb|KEH23828.1| emp24/gp25L/p24 family/GOLD protein [Medicago truncatula]
Length=211

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+SDHPGIDFTVTSPG NVVHS+KGTSGDKF+ KA   G+YKFCFHNP STPET
Sbjct  53   MDHDIFWSSDHPGIDFTVTSPGGNVVHSLKGTSGDKFELKAIHGGIYKFCFHNPISTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFY+HVGHIPN HNLAKDEH DPINVKIAELREALES+ +EQKYLKARD RHR+TNEST
Sbjct  113  VSFYVHVGHIPNVHNLAKDEHFDPINVKIAELREALESIITEQKYLKARDTRHRNTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRVIFYT+ EYIL    S LQVVYIRRLFSKS AYNRV
Sbjct  173  RKRVIFYTLLEYILFVGTSLLQVVYIRRLFSKSFAYNRV  211



>ref|XP_009370753.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=218

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+SDHPGIDFT T+PG   V S+KGTSGDKF FKAP+SG+YKFCF NP STPET
Sbjct  60   IDHDIFWSSDHPGIDFTATAPGGTTVFSLKGTSGDKFAFKAPKSGLYKFCFRNPVSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH LAKDEH+DP+N+KIAELREALE+VT+EQKYLKARDARHR+TN ST
Sbjct  120  VSFYIHVGHIPNEHGLAKDEHMDPLNIKIAELREALEAVTTEQKYLKARDARHRYTNVST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KRVI++T+ EY++ A AS+LQV+YIR LFSKSVAYNRV
Sbjct  180  NKRVIYFTLAEYLVFAGASALQVLYIRNLFSKSVAYNRV  218



>ref|XP_008351862.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=218

 Score =   276 bits (707),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+SDHPGIDFT T+PG ++V S+KGTSGDKF FKAP+SG+YKFCF NP STPET
Sbjct  60   IDHDIFWSSDHPGIDFTATAPGGSIVSSLKGTSGDKFKFKAPKSGIYKFCFRNPASTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH LAKDEH+DP+N+KIAELREALE++T+EQK+LKARDARHR+TN ST
Sbjct  120  VSFYIHVGHIPNEHELAKDEHMDPLNIKIAELREALEAITTEQKFLKARDARHRYTNVST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KRVI++T+ EY++ A AS+LQV+YIR LFSKSVAYNRV
Sbjct  180  NKRVIYFTLAEYLVFAGASALQVLYIRNLFSKSVAYNRV  218



>gb|ABK22222.1| unknown [Picea sitchensis]
Length=208

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGID TVT+P  NVV+S+KGTSGDKF F APRSGMYKFCFHN +S PET
Sbjct  50   VDHDIFWASDHPGIDLTVTAPAGNVVYSLKGTSGDKFQFVAPRSGMYKFCFHNSFSAPET  109

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            +SFY+HVGHIPNEH+LAKDEHL+P+NV+IAELREA+ESVT+EQ+YLKARDARHR TNEST
Sbjct  110  ISFYVHVGHIPNEHDLAKDEHLNPVNVRIAELREAMESVTAEQQYLKARDARHRRTNEST  169

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+R+I YT+ EY+ L +AS LQV +IRRLFS+SVAYNRV
Sbjct  170  RRRLIGYTLAEYLALIVASGLQVYFIRRLFSRSVAYNRV  208



>ref|XP_011073468.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Sesamum indicum]
Length=216

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D +W+SDH G+DFTVT+PG + VH++KGTS DKF+FKAP +GMYKFCFHNP STPETVSF
Sbjct  61   DAYWSSDHSGVDFTVTAPGGSTVHTLKGTSEDKFEFKAPTNGMYKFCFHNPSSTPETVSF  120

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             IH GHIP EH+LAKDEHLDPINVKIAELREALE+VT EQ+YLKARDARHRHTNESTR+R
Sbjct  121  NIHTGHIPREHDLAKDEHLDPINVKIAELREALETVTLEQRYLKARDARHRHTNESTRRR  180

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            VIFYTVGEY+LL L S LQVV+IRRLFSKSVAYNRV
Sbjct  181  VIFYTVGEYLLLGLVSGLQVVFIRRLFSKSVAYNRV  216



>ref|XP_006651809.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Oryza brachyantha]
Length=217

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  695  SDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG  516
            SDHPGID TVTSPG N V+++KG SGDKF+FKAPR GMYKFCFHNPY  PETVSFYIHVG
Sbjct  67   SDHPGIDLTVTSPGGNTVYTLKGKSGDKFEFKAPRGGMYKFCFHNPYGAPETVSFYIHVG  126

Query  515  HIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT  336
            HIPNEHNLAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNESTR+RV+FYT
Sbjct  127  HIPNEHNLAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNESTRRRVMFYT  186

Query  335  VGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            + EY+    AS+LQVVYIRRLFSK+VAYNRV
Sbjct  187  IAEYLAFMGASALQVVYIRRLFSKNVAYNRV  217



>ref|XP_009350369.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Pyrus x bretschneideri]
Length=218

 Score =   274 bits (701),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+SDHPGIDFT T+PG ++V S+KGTSGDKF FKA +SG+YKFCF NP STPET
Sbjct  60   IDHDIFWSSDHPGIDFTATAPGGSIVSSLKGTSGDKFKFKAQKSGIYKFCFRNPASTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEH+DP+N+KIAELREALE++T+EQK+LKARDARHR+TN ST
Sbjct  120  VSFYIHVGHIPNEHDLAKDEHMDPLNIKIAELREALEAITTEQKFLKARDARHRYTNVST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KRVI++T+ EY++ A AS+LQV+YIR LFSKSVAYNRV
Sbjct  180  NKRVIYFTLAEYLVFAGASALQVLYIRNLFSKSVAYNRV  218



>ref|XP_008235354.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Prunus mume]
Length=218

 Score =   274 bits (700),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+SDHPGIDFT  +P   +V S+KGTSGDKF+FKAP+SG+YKFCF NP STPET
Sbjct  60   IDHDIFWSSDHPGIDFTAMTPRGTIVFSLKGTSGDKFEFKAPQSGIYKFCFRNPVSTPET  119

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LA+DEH+DP+N+KIAELREALES+T+EQKYLKARDARHR+TN ST
Sbjct  120  VSFYIHVGHIPNEHDLARDEHIDPLNIKIAELREALESITTEQKYLKARDARHRYTNVST  179

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            +KRVI++T+ EYI+ A AS+LQVVYIR LFSK+V YNRV
Sbjct  180  KKRVIYFTLAEYIVFAAASALQVVYIRNLFSKTVGYNRV  218



>ref|XP_007162469.1| hypothetical protein PHAVU_001G155000g [Phaseolus vulgaris]
 gb|ESW34463.1| hypothetical protein PHAVU_001G155000g [Phaseolus vulgaris]
Length=211

 Score =   273 bits (699),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +D+DIFWNSDHPGIDF+VTSPG ++V+S+KGTSGDKF FKA   G+YKFCF NP STPET
Sbjct  53   IDYDIFWNSDHPGIDFSVTSPGGSLVYSLKGTSGDKFQFKAALHGIYKFCFQNPASTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALES+  EQKYLKARD RHRHTNEST
Sbjct  113  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESIIIEQKYLKARDTRHRHTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+ YT+ EY+L A  S  QVVYIRRLFSKS AYNRV
Sbjct  173  RKRVVLYTILEYVLFAATSISQVVYIRRLFSKSFAYNRV  211



>gb|EPS65381.1| hypothetical protein M569_09395, partial [Genlisea aurea]
Length=203

 Score =   271 bits (692),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGI+F VTSP  N V S+KGTSG+KF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  45   VDHDIFWGSDHPGIEFIVTSPAGNNVQSLKGTSGEKFEFKAPRSGMYKFCFHNPYSTPET  104

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF+IHVGHIP+E++LAKDEHLDPINVKIA LREALESV SEQKYLKARDARHR TNEST
Sbjct  105  VSFHIHVGHIPSENDLAKDEHLDPINVKIARLREALESVISEQKYLKARDARHRLTNEST  164

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              RV+ Y++ EY+LLA  S+LQ VYIR LFSKS+AYNRV
Sbjct  165  ASRVLGYSIFEYVLLAGLSTLQAVYIRHLFSKSIAYNRV  203



>ref|XP_007200451.1| hypothetical protein PRUPE_ppa011262mg [Prunus persica]
 gb|EMJ01650.1| hypothetical protein PRUPE_ppa011262mg [Prunus persica]
Length=217

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+SDHPGIDFTV+  G  +V S+KGTSGDKF+FKAP+SG+YKFCF NP STPET
Sbjct  60   IDHDIFWSSDHPGIDFTVSFLGI-IVFSLKGTSGDKFEFKAPQSGIYKFCFRNPVSTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LA+DEH+DP+N+KIAELREALES+T+EQKYLKARDARHR+TN ST
Sbjct  119  VSFYIHVGHIPNEHDLARDEHMDPLNIKIAELREALESITTEQKYLKARDARHRYTNVST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            +KRVI++T+ EYI+ A AS+LQVVYIR LFSK+V YNRV
Sbjct  179  KKRVIYFTLAEYIVFAAASALQVVYIRNLFSKTVGYNRV  217



>ref|XP_006443971.1| hypothetical protein CICLE_v10024247mg [Citrus clementina]
 ref|XP_006479641.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Citrus sinensis]
 gb|ESR57211.1| hypothetical protein CICLE_v10024247mg [Citrus clementina]
 gb|KDO68622.1| hypothetical protein CISIN_1g028178mg [Citrus sinensis]
Length=212

 Score =   269 bits (687),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  716  DHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETV  537
            DH++FWNSDHPGIDFTVT P  ++V ++KGTSGDKF FKAPRSGMY+FCFHNP STPE V
Sbjct  55   DHELFWNSDHPGIDFTVTCPDGSIVRALKGTSGDKFVFKAPRSGMYQFCFHNPTSTPEEV  114

Query  536  SFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTR  357
            SFYIH+GHIPNEH+LAKDEHLDPI V+IAELREALE+V++EQ+YLKA ++RHR TNESTR
Sbjct  115  SFYIHIGHIPNEHDLAKDEHLDPIYVRIAELREALETVSAEQRYLKALESRHRSTNESTR  174

Query  356  KRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            KRV+FYTV EY+LLA A +LQV+YIRRLF K+ AY RV
Sbjct  175  KRVVFYTVSEYLLLAGAGALQVMYIRRLFGKTAAYGRV  212



>ref|XP_004292584.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Fragaria vesca subsp. vesca]
Length=217

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+ DHPGI+FTVTSPG + V S+KGTSGDKF+ KAP+ G+YKFCF NP S+PET
Sbjct  59   IDHDIFWSHDHPGIEFTVTSPGGSTVFSLKGTSGDKFELKAPQKGIYKFCFRNPSSSPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNE +LA+DEH+DP+N+KIAELREALES+T+EQKYLKARDARHR+TN  T
Sbjct  119  VSFYIHVGHIPNELDLAQDEHMDPLNIKIAELREALESITAEQKYLKARDARHRYTNVGT  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            +KRVI++T+ EY+L A+AS+LQVVYIR LFSK+V YNRV
Sbjct  179  KKRVIYFTLAEYLLFAVASALQVVYIRNLFSKTVGYNRV  217



>gb|EYU23694.1| hypothetical protein MIMGU_mgv1a013689mg [Erythranthe guttata]
Length=213

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            V  D  WNSD PG+DFTVTSPG +VVH +KG+SGDKF+FKA + GMYKFCFHN +STPET
Sbjct  55   VVEDYHWNSDPPGVDFTVTSPGGSVVHDLKGSSGDKFEFKATKLGMYKFCFHNTHSTPET  114

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSF IH GHIP EH+LAKDEHLDP+NVKIAELREALESVT EQKYL+ARDARHRHTNEST
Sbjct  115  VSFNIHTGHIPTEHDLAKDEHLDPVNVKIAELREALESVTLEQKYLRARDARHRHTNEST  174

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R+RVI+YTV EY+LLA  S LQV YIRRLFSKSVAY RV
Sbjct  175  RRRVIYYTVAEYLLLAAVSGLQVFYIRRLFSKSVAYGRV  213



>gb|EEE59914.1| hypothetical protein OsJ_12539 [Oryza sativa Japonica Group]
Length=221

 Score =   258 bits (660),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  674  FTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHN  495
            F VTSPG N V+++KG SGDKF+FKAPR GMYKFCFHNPY  PETVSFYIHVGHIPNEHN
Sbjct  78   FVVTSPGGNTVYTLKGKSGDKFEFKAPRGGMYKFCFHNPYGAPETVSFYIHVGHIPNEHN  137

Query  494  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  315
            LAKDEHLDPINVKIAEL+EALESVT+EQKYLKAR+ARHRHTNESTR+RV+FYT+ EY+  
Sbjct  138  LAKDEHLDPINVKIAELKEALESVTAEQKYLKAREARHRHTNESTRRRVMFYTIAEYLAF  197

Query  314  ALASSLQVVYIRRLFSKSVAYNRV  243
              AS+LQVVYIRRLFSK+VAYNRV
Sbjct  198  MGASALQVVYIRRLFSKNVAYNRV  221



>ref|XP_010490045.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Camelina sativa]
Length=196

 Score =   256 bits (654),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DFTVTSP  N+V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  56   VDHDIFWGSDHPGLDFTVTSPAGNIVQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDP+NVKIAELREALESV +EQKYLKARD RHRHTNEST
Sbjct  116  VSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNEST  175

Query  359  RKRVIFYTVG  330
            RKRVIFYTVG
Sbjct  176  RKRVIFYTVG  185



>ref|XP_002315749.2| emp24/gp25L/p24 family protein [Populus trichocarpa]
 gb|EEF01920.2| emp24/gp25L/p24 family protein [Populus trichocarpa]
Length=194

 Score =   255 bits (652),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 131/144 (91%), Gaps = 5/144 (3%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPGIDFT TSPGDN VH++KGTSGDKF+FKAPRSGMYKFCFHNPY+TPET
Sbjct  53   VDHDIFWGSDHPGIDFTATSPGDNTVHTVKGTSGDKFEFKAPRSGMYKFCFHNPYATPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIP+EH+LAKDEHL+P+NVKIAELREALESVT+EQ+YLKARD RHRHTNEST
Sbjct  113  VSFYIHVGHIPSEHDLAKDEHLNPVNVKIAELREALESVTAEQRYLKARDIRHRHTNEST  172

Query  359  RKRVIFYTVGEYILLALASSLQVV  288
            R+RVI YTVG Y      SSLQ V
Sbjct  173  RRRVIAYTVGVY-----PSSLQQV  191



>ref|XP_007050472.1| Emp24/gp25L/p24 family/GOLD family protein [Theobroma cacao]
 gb|EOX94629.1| Emp24/gp25L/p24 family/GOLD family protein [Theobroma cacao]
Length=217

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DH+IFWNS+HPGI+FTVTSPG  +V+ +KGTSGDKF+FKAPR G+YKFCFHNP +TPET
Sbjct  59   MDHEIFWNSEHPGIEFTVTSPGGKLVYFLKGTSGDKFEFKAPRRGIYKFCFHNPLTTPET  118

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            V+FY+HVGHIP  +++A +EH  P +VKIAELRE LESVT+EQKYLKARDARHR+T+EST
Sbjct  119  VAFYLHVGHIPETNDVAINEHFHPTHVKIAELREVLESVTAEQKYLKARDARHRYTSEST  178

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYT+ EY  LA +S LQ+VYIRRLFS S AYNRV
Sbjct  179  RKRVVFYTLVEYFALAASSVLQIVYIRRLFSSSPAYNRV  217



>ref|XP_010646131.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
isoform X2 [Vitis vinifera]
Length=195

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFWNSDHPGI+FTVTSPG  +VH++KGTSG+KF+FKAP+SG YKFCF+NP +TPET
Sbjct  52   IDHDIFWNSDHPGIEFTVTSPGGAIVHALKGTSGEKFEFKAPQSGTYKFCFNNPVATPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNE++LAKDEHLDP+NV+I ELREAL SV +EQKYLKARDARHR TNEST
Sbjct  112  VSFYIHVGHIPNEYDLAKDEHLDPVNVRITELREALLSVAAEQKYLKARDARHRATNEST  171

Query  359  RKRVIFYTVGEYILLALASSLQV  291
            R+RV+FYT+ EYILLA  S LQV
Sbjct  172  RRRVVFYTLAEYILLAATSGLQV  194



>ref|XP_010935726.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Elaeis guineensis]
Length=214

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  698  NSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHV  519
            +SDHPGID  V +   + VHS+KGTSGDKF+FKAPR+GMYKFCFHNP  TPETVSFYIHV
Sbjct  63   SSDHPGIDMVVQTSRGDTVHSLKGTSGDKFEFKAPRAGMYKFCFHNPSRTPETVSFYIHV  122

Query  518  GHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFY  339
            GHIPNEH+LAKDEHLDP+ V++A+LREALESVTSEQ+YLKAR+ARHR T+E TRKR+IF 
Sbjct  123  GHIPNEHDLAKDEHLDPVKVRVAQLREALESVTSEQRYLKAREARHRWTSEGTRKRLIFC  182

Query  338  TVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            T+ EY++L  AS LQVVYIRRLF+KSVAYN +
Sbjct  183  TMMEYLVLVCASGLQVVYIRRLFNKSVAYNTI  214



>gb|EMS56815.1| Transmembrane emp24 domain-containing protein A [Triticum urartu]
Length=131

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  635  MKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVK  456
            MKG SGDKFDFKAPR GMYKFCFHNPY  PETVSFYIHVGHIPNEHNLAKDEHLDPINVK
Sbjct  1    MKGKSGDKFDFKAPRGGMYKFCFHNPYGAPETVSFYIHVGHIPNEHNLAKDEHLDPINVK  60

Query  455  IAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRR  276
            IAEL+EALESVT+EQKYLKARDARHRHTNESTR+RV+FYT+ EY     AS+LQVVYIRR
Sbjct  61   IAELKEALESVTAEQKYLKARDARHRHTNESTRRRVMFYTMAEYAAFMAASALQVVYIRR  120

Query  275  LFSKSVAYNRV  243
            LFSK+V YNRV
Sbjct  121  LFSKNVGYNRV  131



>emb|CAN73344.1| hypothetical protein VITISV_007239 [Vitis vinifera]
Length=203

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFWNSDHPGI+FTVTSPG  +VH++KGTSG+KF+FKAP+SG YKFCF+NP +TPET
Sbjct  52   IDHDIFWNSDHPGIEFTVTSPGGAIVHALKGTSGEKFEFKAPQSGTYKFCFNNPVATPET  111

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNE++LAKDEHLDP+NV+I ELREAL SV +EQKYLKARDARHR TNEST
Sbjct  112  VSFYIHVGHIPNEYDLAKDEHLDPVNVRITELREALLSVAAEQKYLKARDARHRATNEST  171

Query  359  RKRVIFYTVGEYILLA  312
            R+RV+FYT+ EYILLA
Sbjct  172  RRRVVFYTLAEYILLA  187



>ref|XP_007034876.1| Emp24/gp25L/p24 family/GOLD family protein isoform 2 [Theobroma 
cacao]
 gb|EOY05802.1| Emp24/gp25L/p24 family/GOLD family protein isoform 2 [Theobroma 
cacao]
Length=171

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVTSPG N V ++KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  54   VDHDIFWSSDHPGIDFTVTSPGGNTVQNLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNE  366
            VSFYIHVGHIP EH+LAKDEHLDPINVKIAELREALESVT+EQKYLKARDARHR++N+
Sbjct  114  VSFYIHVGHIPTEHDLAKDEHLDPINVKIAELREALESVTAEQKYLKARDARHRNSNK  171



>gb|KJB72278.1| hypothetical protein B456_011G168300 [Gossypium raimondii]
Length=180

 Score =   226 bits (576),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVTSPG N VHS+KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  54   VDHDIFWSSDHPGIDFTVTSPGGNTVHSLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHT  372
            ++FYIHVGHIP +H+LAKDEHL+PINVKIAELREALESVT+EQKYLKARD RHRH+
Sbjct  114  IAFYIHVGHIPTDHDLAKDEHLNPINVKIAELREALESVTAEQKYLKARDTRHRHS  169



>gb|KHG16537.1| Transmembrane emp24 domain-containing 2 [Gossypium arboreum]
Length=180

 Score =   224 bits (571),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVTSPG N VHS+KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  54   VDHDIFWSSDHPGIDFTVTSPGGNTVHSLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHT  372
            ++FYIHVGHIP +H+LAKDEHL+PINVKIAELREALESVT+EQKYLKARD RHR +
Sbjct  114  IAFYIHVGHIPTDHDLAKDEHLNPINVKIAELREALESVTAEQKYLKARDTRHRQS  169



>ref|XP_008390949.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3 
[Malus domestica]
Length=200

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW +DHPG+D  VTSPGDN VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  53   VDHDIFWGADHPGLDLIVTSPGDNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNES  363
            VSF IHVGHIPNEHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRH+  S
Sbjct  113  VSFNIHVGHIPNEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHSKFS  171



>ref|XP_008343630.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
 ref|XP_008362011.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=199

 Score =   222 bits (565),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW +DHPG+D  VTSPG N VH+ KGTSGDKF+FKAPRSGMYKFCFHNPYSTPET
Sbjct  53   VDHDIFWGADHPGLDLIVTSPGGNTVHTSKGTSGDKFEFKAPRSGMYKFCFHNPYSTPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHT  372
            VSF IHVGHIPNEHN+AKDEHLDPINVKIAELREALESVT EQKYLKARD RHRH+
Sbjct  113  VSFNIHVGHIPNEHNIAKDEHLDPINVKIAELREALESVTLEQKYLKARDVRHRHS  168



>ref|XP_008786160.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Phoenix dactylifera]
Length=184

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHD+FW+SDHPGID  VTSPG N VHS+KGTSGDKF+F+APR+GMYKFCFHNP  TPET
Sbjct  58   VDHDLFWSSDHPGIDLVVTSPGGNTVHSLKGTSGDKFEFQAPRAGMYKFCFHNPNRTPET  117

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            VSFYIHVGHIPNEH+LAKDEHLDPINVKIA+LREALESVTSEQ+YLKAR+ RHRH     
Sbjct  118  VSFYIHVGHIPNEHDLAKDEHLDPINVKIAQLREALESVTSEQRYLKAREVRHRHKYRLA  177

Query  359  RKRVIFY  339
              R + Y
Sbjct  178  GVRPLHY  184



>ref|XP_002987714.1| hypothetical protein SELMODRAFT_126578 [Selaginella moellendorffii]
 gb|EFJ11289.1| hypothetical protein SELMODRAFT_126578 [Selaginella moellendorffii]
Length=211

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDH+IFW SDHPGIDF  TSP   +V S++G++GDKF F A   G+YKFCFHN   +PET
Sbjct  53   VDHEIFWASDHPGIDFVATSPAGVIVSSIRGSAGDKFSFTAAMPGLYKFCFHNTAPSPET  112

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            V FYIHVGHI NEHNLAKDEHL+P++VKI++L+EALES+ ++Q YL++R  RH +TN ST
Sbjct  113  VDFYIHVGHILNEHNLAKDEHLNPVHVKISQLKEALESLMADQHYLRSRVERHHNTNRST  172

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            +KR++FYT+GEY+ LA AS  QV+ ++ LF++ + Y ++
Sbjct  173  QKRLLFYTIGEYLALAAASVTQVLVLKHLFNRKIGYTKL  211



>ref|XP_002983175.1| hypothetical protein SELMODRAFT_268686 [Selaginella moellendorffii]
 gb|EFJ15517.1| hypothetical protein SELMODRAFT_268686 [Selaginella moellendorffii]
Length=209

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDH+IFW SDHPGIDF  TSP   +V S++G++GDKF F A   G+YKFCFHN   +PET
Sbjct  51   VDHEIFWASDHPGIDFVATSPAGVIVSSIRGSAGDKFSFTAAMPGLYKFCFHNTAPSPET  110

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            V FYIHVGHI NEHNLAKDEHL+P++VKI++L+EALES+ ++Q YL++R  RH +TN ST
Sbjct  111  VDFYIHVGHILNEHNLAKDEHLNPVHVKISQLKEALESLMADQHYLRSRVERHHNTNRST  170

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            +KR++FYT+GEY+ LA AS  QV+ ++ LF++ + Y ++
Sbjct  171  QKRLLFYTIGEYLALAAASVTQVLVLKHLFNRKIGYTKL  209



>ref|XP_001752961.1| predicted protein [Physcomitrella patens]
 gb|EDQ82002.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +D ++FW S+HPGI+  VT P    VH+     G+KF+F A R G YKFCFHNP S PE 
Sbjct  51   LDQEVFWGSEHPGIELIVTGPDGRAVHTTNTIDGEKFEFIAHRRGRYKFCFHNPLSAPEQ  110

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            ++FYIHVGH+     LA+DEHL P++VKI++L EALE V++E +YL+ RD RHR TNEST
Sbjct  111  LTFYIHVGHVIGVEELARDEHLKPVDVKISQLSEALELVSAEIRYLQNRDLRHRKTNEST  170

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            ++R++FYTV EY+LL  AS  QVV IR LFSK + YNRV
Sbjct  171  QRRLLFYTVSEYLLLIAASVGQVVMIRHLFSKRIGYNRV  209



>gb|KHN15723.1| Endoplasmic reticulum vesicle protein 25 [Glycine soja]
Length=164

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 107/159 (67%), Gaps = 46/159 (29%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW+SDHPGIDFTVT+   N VHS+KGTS                           
Sbjct  52   VDHDIFWSSDHPGIDFTVTTAAGNTVHSIKGTS---------------------------  84

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
                               EHLDPINVKIAELREALESVT+EQKYLKARDARHRHTNEST
Sbjct  85   -------------------EHLDPINVKIAELREALESVTAEQKYLKARDARHRHTNEST  125

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            RKRV+FYTVGEY+LLA  S+LQV+YIRRLFSKSVAYNRV
Sbjct  126  RKRVVFYTVGEYLLLAAVSALQVIYIRRLFSKSVAYNRV  164



>ref|XP_001771034.1| predicted protein [Physcomitrella patens]
 gb|EDQ64189.1| predicted protein [Physcomitrella patens]
Length=185

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 113/159 (71%), Gaps = 1/159 (1%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DH + W +D PG++  VTSP    V  +    G+KF+F A + GMYKFCF+NP  TPET
Sbjct  28   IDHGLAW-ADEPGVELVVTSPIGAKVIGITAKEGEKFEFVAHQRGMYKFCFNNPGPTPET  86

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            +SFYIHVGHI    +LAKDEHL P+NV IA +REAL +V+ E  YLKARD RHR TNEST
Sbjct  87   ISFYIHVGHIYGLMDLAKDEHLKPLNVNIARVREALAAVSGELIYLKARDRRHRITNEST  146

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            ++R+I YTVGEYI L   S  QV  IR+LF K + YNRV
Sbjct  147  QRRLISYTVGEYICLIGVSLGQVYLIRKLFDKRLGYNRV  185



>ref|XP_010527604.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3, 
partial [Tarenaya hassleriana]
Length=103

 Score =   181 bits (460),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = -3

Query  551  TPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHT  372
            TPETVSFYIHVGHIPNEH++AKDEHLDPINVKIAELREALESV SEQKYLKARDARHRHT
Sbjct  1    TPETVSFYIHVGHIPNEHDVAKDEHLDPINVKIAELREALESVISEQKYLKARDARHRHT  60

Query  371  NESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            NESTRKRVIFYTVGEY+LLA AS+LQV+YIR+LFSKSVAYNRV
Sbjct  61   NESTRKRVIFYTVGEYLLLAAASALQVLYIRKLFSKSVAYNRV  103



>ref|XP_010535328.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like, 
partial [Tarenaya hassleriana]
Length=128

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDHDIFW SDHPG+DF V+SP  NVVHS+KGTSGDKF+FKAP+SGMYKFCFHNPYSTPET
Sbjct  56   VDHDIFWGSDHPGLDFEVSSPAGNVVHSLKGTSGDKFEFKAPKSGMYKFCFHNPYSTPET  115

Query  539  VSFYIHVGHIPNE  501
            VSFYIHVGHIPNE
Sbjct  116  VSFYIHVGHIPNE  128



>gb|KHG09153.1| Transmembrane emp24 domain-containing 7 [Gossypium arboreum]
 gb|KHG24118.1| Transmembrane emp24 domain-containing 7 [Gossypium arboreum]
Length=146

 Score =   145 bits (367),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            VDH IFW+SDHPGIDF++TSPG +++H++KGTSGDKF FKAPRSG+Y+FCFHNP STPET
Sbjct  54   VDHHIFWSSDHPGIDFSITSPGGDILHNLKGTSGDKFSFKAPRSGLYQFCFHNPLSTPET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHL  474
            ++ YIH+GHIPNEHNLAK+  L
Sbjct  114  IALYIHIGHIPNEHNLAKNGSL  135



>ref|XP_008363663.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=139

 Score =   142 bits (359),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+SDHPGIDFT T+PG  +V S+KGTSGDKF FKAP+SGMYKFCF NP ST ET
Sbjct  60   IDHDIFWSSDHPGIDFTATAPGGGIVFSLKGTSGDKFAFKAPKSGMYKFCFRNPVSTHET  119

Query  539  VSFYIHVGHIPNEHNLAKD  483
            VSFYIHVGHIPN H+LAKD
Sbjct  120  VSFYIHVGHIPNXHDLAKD  138



>ref|XP_008368791.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta3-like 
[Malus domestica]
Length=139

 Score =   142 bits (359),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +DHDIFW+SDHPGIDFT T+PG  +V S+KGTSGDKF FKAP+SGMYKFCF NP ST ET
Sbjct  60   IDHDIFWSSDHPGIDFTATAPGGXIVFSLKGTSGDKFAFKAPKSGMYKFCFRNPVSTHET  119

Query  539  VSFYIHVGHIPNEHNLAKD  483
            VSFYIHVGHIPN H+LAKD
Sbjct  120  VSFYIHVGHIPNXHDLAKD  138



>ref|XP_002982857.1| hypothetical protein SELMODRAFT_116990 [Selaginella moellendorffii]
 gb|EFJ16102.1| hypothetical protein SELMODRAFT_116990 [Selaginella moellendorffii]
Length=209

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 90/159 (57%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            V  D  W  +  G+D  V  PG    + ++    +K  F A   G+YKFCFHN     ET
Sbjct  51   VKSDSTWGFEQAGVDLVVEGPGGIQAYDVRNKPEEKSQFVAHSKGLYKFCFHNLSPVHET  110

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            ++F ++VGH P   + AKD+H+DP+  +IA L EAL SV+ EQ +L+A+  R    N + 
Sbjct  111  IAFDVYVGHFPPPDDHAKDDHIDPLMGQIARLEEALYSVSFEQHWLQAQTERQSVLNNAM  170

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KRV++  V E   L  AS LQV  +RRLF K  A +RV
Sbjct  171  SKRVVYKAVVESAALISASLLQVYLLRRLFEKRFASSRV  209



>ref|XP_001766849.1| predicted protein [Physcomitrella patens]
 gb|EDQ68251.1| predicted protein [Physcomitrella patens]
Length=219

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 94/159 (59%), Gaps = 8/159 (5%)
 Frame = -3

Query  701  WNSDHP--GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFY  528
            W+ +H   G+D  V  P  + VHS K    DKFDF A R G+YKFCF N  S  ETV F 
Sbjct  63   WSFEHTPVGLDLIVEGPAGHQVHSSKALVEDKFDFTAARKGLYKFCFFNRNSMHETVDFD  122

Query  527  IHVG-HIPN---EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            +HVG HI N   EH   KDEH++P+ ++I  L E+L S+  EQ +L A+  +    N++ 
Sbjct  123  VHVGYHILNADEEH--VKDEHIEPLMMQIESLEESLYSIQFEQHWLLAQTDQQEIVNKAM  180

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +RV++  + E + L   S LQVV +RRLF K +  +RV
Sbjct  181  SRRVVYKAMLEALALMGCSVLQVVLLRRLFEKKLGQSRV  219



>ref|XP_002990957.1| hypothetical protein SELMODRAFT_132599 [Selaginella moellendorffii]
 gb|EFJ08001.1| hypothetical protein SELMODRAFT_132599 [Selaginella moellendorffii]
Length=209

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 90/159 (57%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            V  D  W  +  G+D  V  PG    + ++    +K  F A   G+YKFCFHN     ET
Sbjct  51   VKSDSTWAFEQAGVDLVVEGPGGIQAYDVRNKPEEKGQFVAHSKGLYKFCFHNLSPVHET  110

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            ++F ++VGH P   + AKD+H+DP+  +IA L EAL SV+ EQ +L+A+  R    N + 
Sbjct  111  IAFDVYVGHFPPPDDHAKDDHIDPLMGQIARLEEALYSVSFEQHWLQAQTERQSVLNNAM  170

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KRV++  V E   L  AS LQV  +RRLF K  A +RV
Sbjct  171  SKRVVYKAVVESAALISASLLQVYLLRRLFEKRFASSRV  209



>ref|XP_001780055.1| predicted protein [Physcomitrella patens]
 gb|EDQ55158.1| predicted protein [Physcomitrella patens]
Length=219

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 86/153 (56%), Gaps = 4/153 (3%)
 Frame = -3

Query  701  WNSDHP--GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFY  528
            W  DH   G+D  V +P    VHS K    DKF+F A R G+YKFCF+N     E V F 
Sbjct  62   WTFDHASVGVDLIVEAPAGYQVHSSKSKVEDKFNFIAVRRGLYKFCFYNRNYVHENVDFD  121

Query  527  IHVGH--IPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRK  354
            +HVGH     +  L KDEH+DP+  +I  L E+L S+  EQ +L A+  R    N++  K
Sbjct  122  VHVGHHITDIDVQLVKDEHIDPLIWQIERLEESLYSIQFEQHWLLAQTDRQEIVNDAMSK  181

Query  353  RVIFYTVGEYILLALASSLQVVYIRRLFSKSVA  255
            R+I+  + E + L   S +QVV +RRLF K + 
Sbjct  182  RLIYKAILEALALVGCSVVQVVLLRRLFEKKLG  214



>ref|XP_006474870.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Citrus sinensis]
Length=212

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 85/153 (56%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W S H G+D  V  P  + +H  +    +KF+F A   G+++FCF N     ET+ F +H
Sbjct  60   WYSSHDGVDLVVKGPASDQIHDFRDKISEKFEFVAHHKGVHRFCFTNKSPYHETIDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R ++
Sbjct  120  VGHFSYYDEHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRRAVY  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                E   L  AS LQV  +RRLF + +  +RV
Sbjct  180  KAFWESTALVGASVLQVYLLRRLFERKLGMSRV  212



>gb|EYU42779.1| hypothetical protein MIMGU_mgv1a013547mg [Erythranthe guttata]
Length=217

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 88/156 (56%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D+ W+    G+D  +  P    +H     + DK++F A   G+Y+FCF N     ET+ F
Sbjct  62   DVSWHYADDGVDLLIKGPDGKKIHEFHDKTSDKYEFMAQMRGVYRFCFTNKSPFHETIDF  121

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             IHVGH  +    AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  122  DIHVGHFMHFDQHAKDEHFNPMLEQISKLEEALYNIQFEQHWLEAQTDRQALVNEAMSQR  181

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             I+  + E + L   SSLQV  ++RLF + +  +RV
Sbjct  182  AIYKAIFESLALVGVSSLQVYLLQRLFDRKLGTSRV  217



>ref|XP_005839577.1| hypothetical protein GUITHDRAFT_157078 [Guillardia theta CCMP2712]
 gb|EKX52597.1| hypothetical protein GUITHDRAFT_157078 [Guillardia theta CCMP2712]
Length=146

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = -3

Query  668  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYST--PETVSFYIHVGHIPNEHN  495
            VT P +  ++S++  +  +F F +  +G Y+FCF N  ST  P+TVSF + VG    +  
Sbjct  2    VTGPDEKTIYSVQKETEGRFTFMSHETGTYRFCFGNSMSTVTPKTVSFSLLVGEDTQQAR  61

Query  494  LAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILL  315
            +AK EH+ P+   +  L E L+ + +EQ+Y++ R+  HR+T+EST  RV+++ + E   L
Sbjct  62   VAKSEHVTPLEKSVMALAEGLQQIQTEQEYMRMRERAHRNTSESTNARVLWWALIEAGAL  121

Query  314  ALASSLQVVYIRRLFSKSVAYNR  246
             L S +Q+VY+R  F    A NR
Sbjct  122  LLMSVIQIVYLRNFFENKRASNR  144



>ref|XP_007142524.1| hypothetical protein PHAVU_008G288000g [Phaseolus vulgaris]
 gb|ESW14518.1| hypothetical protein PHAVU_008G288000g [Phaseolus vulgaris]
Length=213

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 85/153 (56%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +H  +  + DKFDF A +SG++KFCF N     ETV F +H
Sbjct  61   WHYGDEGVDLVVKGPSGEQIHDFRDKTSDKFDFVAHKSGVHKFCFTNKSPYHETVDFDVH  120

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R I 
Sbjct  121  VGHFSYFEQHAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAIH  180

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS+LQV  ++RLF + +  +RV
Sbjct  181  KAIFESAALIGASALQVYLLQRLFERKLGTSRV  213



>gb|ABG66965.1| LRR resistance protein-like protein [Gossypium arboreum]
Length=60

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -3

Query  422  TSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            T+EQKYLKARD RHRHTNESTRKRVI YTVGEYILL L S+LQV+YIR+LFSKSVAYNRV
Sbjct  1    TAEQKYLKARDTRHRHTNESTRKRVIGYTVGEYILLTLVSALQVIYIRQLFSKSVAYNRV  60



>dbj|BAK04640.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=214

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 7/84 (8%)
 Frame = -3

Query  719  VDHDIFWNSDHP--GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTP  546
            VDHDIFW+SD P  GIDFTVTS G N V+++KG SG+KF+F APR G YKFCFH+PY  P
Sbjct  46   VDHDIFWSSDRPDPGIDFTVTSRGGNTVYTLKGISGEKFEFNAPRGGTYKFCFHSPYGAP  105

Query  545  ETVSFYIHVGHIPNEHNLAKDEHL  474
            ETVSFY+H G      NL ++E L
Sbjct  106  ETVSFYVHDG-----RNLVREEAL  124



>ref|XP_002265305.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Vitis vinifera]
 emb|CBI28463.3| unnamed protein product [Vitis vinifera]
Length=214

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 87/156 (56%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  +  P  + +H  +  + +KF+F A + G+++FCF N     ET+ F
Sbjct  59   DASWHYAEDGVDLVIKGPSGDQIHDFRDKTSEKFEFVAQKKGLHRFCFTNKSPYQETIDF  118

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH       AKDEH +P+  +IA+L EAL ++  EQ +L+A+  R    NE   +R
Sbjct  119  DVHVGHFTYYDQHAKDEHFNPLLEQIAKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSQR  178

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +   + E + L  AS LQ+  ++RLF + +  +RV
Sbjct  179  AVHKAMFESVALVGASVLQIYLLQRLFERKLGISRV  214



>gb|KHN46897.1| Transmembrane emp24 domain-containing protein 2 [Glycine soja]
Length=212

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 85/153 (56%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ D  G+D  V  P    +   +  + +KFDF A +SG++KFCF N     ETV F +H
Sbjct  60   WHYDDEGVDLVVKGPSGEQIQDFRDKTSEKFDFVAHKSGVHKFCFTNKSPYHETVDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R + 
Sbjct  120  VGHFSYFEQHAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAVH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS+LQV  ++RLF + +  +RV
Sbjct  180  KAIFESAALIGASALQVYLLQRLFERKLGTSRV  212



>gb|AFK47679.1| unknown [Lotus japonicus]
Length=212

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 86/153 (56%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +H  +  + +KF+F A +SG++KFCF N     ET+ F +H
Sbjct  60   WHYGDEGVDLVVKGPAGEQIHDFRDKTSEKFEFVAHKSGVHKFCFTNKSPYHETIDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    N++  +R I 
Sbjct  120  VGHFSYYEQHAKDEHFTPLLEQIAKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAIH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS+LQV  ++RLF + +  +RV
Sbjct  180  KALFESAALIGASALQVYLLQRLFERKLGTSRV  212



>ref|XP_010243958.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nelumbo nucifera]
Length=212

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 86/156 (55%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P  + +H  +  + +KFDF   + G+++FCF N     ET+ F
Sbjct  57   DTPWSYGEDGVDLVVKGPSGDQIHDSRDKTSEKFDFIVRKKGLHQFCFTNKSPYHETIDF  116

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH  +    AKDEH +P+  +IA+L E+L ++  EQ +L+A+  R    NE   +R
Sbjct  117  DVHVGHFAHFDQHAKDEHFNPLMEQIAKLEESLYNIQFEQHWLEAQTDRQALVNEGMSRR  176

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             I   + E   L  AS LQV  +RRLF + +  +RV
Sbjct  177  AIHKAMFESAALIGASVLQVYLLRRLFERKLGTSRV  212



>ref|XP_010238339.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Brachypodium distachyon]
Length=212

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 83/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  N +H  +  + DKF+F   + G+++FCF N     ETV F +H
Sbjct  60   WHYSEDGVDLVVKDPNGNQIHDSRAKTSDKFEFVVQKRGVHRFCFTNKSPYHETVDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +I +L EAL S+  EQ +L+A+  R    NE+  KR + 
Sbjct  120  VGHFSYFDQHAKDEHFSPLFAQILKLDEALYSIQFEQHWLEAQTDRQAILNENMSKRAVH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS +Q+  +RRLF + +  +RV
Sbjct  180  KALFESAALIAASVVQIYLLRRLFERKLGSSRV  212



>gb|KDP39307.1| hypothetical protein JCGZ_01064 [Jatropha curcas]
Length=212

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+  + G+D  +  P  + +H  +  + DKF+F A + G+++FCF N     ET+ F IH
Sbjct  60   WHYTNDGVDLVIKGPSGDQIHDFRDKTSDKFEFMARQRGVHRFCFTNKSPYHETIDFDIH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE+  KR I 
Sbjct  120  VGHFSYYDEHAKDEHFKPLLDQIWKLEEALYNIQFEQHWLEAQTERQAIVNEAMSKRAIH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                E   L  AS LQV  +RRLF + +  +RV
Sbjct  180  KAFYESAALIGASVLQVYLLRRLFERKLGMSRV  212



>ref|XP_009394560.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Musa acuminata subsp. malaccensis]
Length=212

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 89/159 (56%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            V  D  W+  + G+D  V  P  + +H  +  + +KF+F   RSG+++FCF N     ET
Sbjct  54   VKSDTPWHYSNDGVDLVVKGPHGDQIHDSRDKTSEKFEFLVQRSGLHRFCFTNKSPYHET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F +HV H  + +  AKDEHL P+  +IA+L EAL ++  EQ +L+A+  R    NE+ 
Sbjct  114  IDFDVHVSHFTHYNQHAKDEHLAPLLEQIAKLEEALYNIQFEQHWLEAQTDRQALVNEAM  173

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +R I   + E   L  AS LQV  + RLF + +  +R+
Sbjct  174  SRRAIHKALFESAALVGASILQVFLLHRLFERKLGTSRI  212



>ref|XP_004491612.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Cicer arietinum]
Length=211

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 87/153 (57%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  + +   +  + +KF+F A +SG++KFCF N     ET+ F +H
Sbjct  59   WHYGDEGVDLVVKGPAGDQIQDFRDKTSEKFEFVAHKSGVHKFCFTNKSPYHETIDFDVH  118

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    N++  +R I 
Sbjct  119  VGHFSYFEQHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAIH  178

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS+LQV  +RRLF + +  +RV
Sbjct  179  KALFESAALIGASALQVYLLRRLFERKLGTSRV  211



>ref|XP_003618033.1| Transmembrane emp24 domain-containing protein [Medicago truncatula]
 gb|AET00992.1| emp24/gp25L/p24 family protein [Medicago truncatula]
 gb|AFK48756.1| unknown [Medicago truncatula]
Length=214

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +   +  + DKF+F A + G++KFCF N     ET+ F +H
Sbjct  62   WHYGDEGVDLVVKGPAGEQIQDFRDKTSDKFEFVAHKPGVHKFCFTNKSPYHETIDFDVH  121

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +IA+L EAL ++  EQ +L+A+  R    N+   +R + 
Sbjct  122  VGHFSYFEQHAKDEHFNPLLEQIAKLEEALYNIQFEQHWLEAQTDRQAIVNDGMSRRAVH  181

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS+LQV  +RRLF + +  +RV
Sbjct  182  KAIFESAALIGASALQVYLLRRLFERKLGTSRV  214



>ref|XP_003618034.1| Transmembrane emp24 domain-containing protein [Medicago truncatula]
 gb|AET00993.1| emp24/gp25L/p24 family protein [Medicago truncatula]
Length=213

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +   +  + DKF+F A + G++KFCF N     ET+ F +H
Sbjct  61   WHYGDEGVDLVVKGPAGEQIQDFRDKTSDKFEFVAHKPGVHKFCFTNKSPYHETIDFDVH  120

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +IA+L EAL ++  EQ +L+A+  R    N+   +R + 
Sbjct  121  VGHFSYFEQHAKDEHFNPLLEQIAKLEEALYNIQFEQHWLEAQTDRQAIVNDGMSRRAVH  180

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS+LQV  +RRLF + +  +RV
Sbjct  181  KAIFESAALIGASALQVYLLRRLFERKLGTSRV  213



>ref|XP_006857765.1| hypothetical protein AMTR_s00061p00199890 [Amborella trichopoda]
 gb|ERN19232.1| hypothetical protein AMTR_s00061p00199890 [Amborella trichopoda]
Length=229

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 83/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  + +H  +  + +KF+F A   G+++FCF N     ET+ F IH
Sbjct  77   WHYGDDGVDLVVKGPSGDQIHDARDKTSEKFEFVAHHKGLHRFCFTNKSPYHETIDFDIH  136

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +IA+L EAL +V  EQ +L+A+  R    NE   +R I 
Sbjct  137  VGHFAYFEQHAKDEHFNPLLEQIAKLEEALYNVQFEQHWLEAQTERQALVNEGMSRRAIH  196

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L   S LQV  +RRLF + +  +RV
Sbjct  197  KALFESAALVGVSVLQVYLLRRLFERKLGTSRV  229



>ref|XP_010942595.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
 ref|XP_010942596.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
Length=212

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 85/153 (56%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+DF V SP  + +H  +  + +KF+F   + G+++FCF N     ET+ F I 
Sbjct  60   WHYGDEGVDFVVKSPHGDQLHDARDKTSEKFEFIVQKKGLHRFCFTNNSPYHETIDFDIQ  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH  +    AKDEH  P+  +IA+L +AL ++  EQ +L+A+  R    NE   +R I 
Sbjct  120  VGHFTHFDQHAKDEHFSPLLEQIAKLEDALYNIQFEQHWLEAQTDRQALVNEGMSRRAIH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  180  KALFESAALIGASILQVFLLRRLFERKLGMSRV  212



>ref|XP_003545588.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Glycine max]
Length=212

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +   +  + +KFDF A +SG++KFCF N     ETV F +H
Sbjct  60   WHYGDEGVDLVVKGPSGEQIQDFRDKTSEKFDFVAHKSGVHKFCFTNKSPYHETVDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R + 
Sbjct  120  VGHFSYFEQHAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAVH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS+LQV  ++RLF + +  +RV
Sbjct  180  KAIFESAALIGASALQVYLLQRLFERKLGTSRV  212



>ref|XP_006574367.1| PREDICTED: uncharacterized protein LOC100527418 isoform X1 [Glycine 
max]
 gb|KHN43972.1| Transmembrane emp24 domain-containing protein [Glycine soja]
Length=212

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +   +  + +KFDF A +SG++KFCF N     ETV F +H
Sbjct  60   WHYGDEGVDLVVKGPSGEQIQDFRDKTSEKFDFVAHKSGVHKFCFTNKSPYHETVDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R + 
Sbjct  120  VGHFSYFEQHAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAVH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS+LQV  ++RLF + +  +RV
Sbjct  180  KAIFESAALIGASALQVYLLQRLFERKLGTSRV  212



>ref|XP_010675969.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Beta vulgaris subsp. vulgaris]
Length=210

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 82/153 (54%), Gaps = 1/153 (1%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W +D  G+D  V  P  + VH       DKFDF A + G Y FCF N     ET+ F + 
Sbjct  59   WRTD-DGVDLVVKGPEHDQVHDSHDRISDKFDFVAHKKGAYSFCFTNKSPYHETIDFDVQ  117

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH+ P+  +I +L E+L ++  EQ +L+A+  R    NE+  KR I 
Sbjct  118  VGHFTYYDQHAKDEHVKPLIEQIEKLGESLYNIQFEQHWLEAQTDRQALVNEAMSKRAIH  177

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              V E + L  AS LQ+  +RRLF K +  +RV
Sbjct  178  KAVMESLALVGASVLQIYLLRRLFEKKLGTSRV  210



>ref|XP_004957295.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Setaria italica]
 ref|XP_004957296.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X2 [Setaria italica]
Length=216

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 85/153 (56%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  + +H  +G + DKF+F   + G+++FCF N     ETV F +H
Sbjct  64   WHYTQDGVDLVVKDPRGDQIHDSRGKTSDKFEFVVHKRGVHRFCFTNKSPYHETVDFDVH  123

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R + 
Sbjct  124  IGHFSYFDQHAKDEHFGPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVH  183

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS +QV  +RRLF + +  +RV
Sbjct  184  KALFESAGLVAASVVQVYLMRRLFERKLGSSRV  216



>ref|NP_001235792.1| uncharacterized protein LOC100527418 [Glycine max]
 gb|ACU16508.1| unknown [Glycine max]
Length=220

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +   +  + +KFDF A +SG++KFCF N     ETV F +H
Sbjct  68   WHYGDEGVDLVVKGPSGEQIQDFRDKTSEKFDFVAHKSGVHKFCFTNKSPYHETVDFDVH  127

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    N++  +R + 
Sbjct  128  VGHFSYFEQHAKDEHFTPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNDAMSRRAVR  187

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS+LQV  ++RLF + +  +RV
Sbjct  188  KAIFESAALIGASALQVYLLQRLFERKLGTSRV  220



>ref|XP_008219687.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Prunus mume]
Length=212

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    +H  +  + +KFDF     G+++FCF N     ET+ F
Sbjct  57   DASWHYTQDGVDLVVKGPSGEQIHDFRDKTSEKFDFVTRHKGVHQFCFTNKSPYHETIDF  116

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             IHV H       AKDEH +P+  ++++L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  117  DIHVSHFTYYDQHAKDEHFNPLLEQVSKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRR  176

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             I     E   L  AS+LQV  +RRLF + +   RV
Sbjct  177  AIHKAFFESAALVGASALQVYLLRRLFERKLGVTRV  212



>ref|XP_007205899.1| hypothetical protein PRUPE_ppa011405mg [Prunus persica]
 gb|EMJ07098.1| hypothetical protein PRUPE_ppa011405mg [Prunus persica]
Length=212

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    +H  +  + +KFDF     G+++FCF N     ET+ F
Sbjct  57   DASWHYTQDGVDLVVKGPSGEQIHDFRDKTSEKFDFVTRHKGVHQFCFTNKSPYHETIDF  116

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             IHV H       AKDEH +P+  ++++L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  117  DIHVSHFTYYDQHAKDEHFNPLLEQVSKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRR  176

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             I     E   L  AS+LQV  +RRLF + +   RV
Sbjct  177  AIHKAFFESAALVGASALQVYLLRRLFERKLGVTRV  212



>ref|XP_008349392.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like, 
partial [Malus domestica]
Length=192

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P  + +H  +  + +K+DF A   G+++FCF N     ET+ F
Sbjct  37   DASWHHTQDGVDLMVKGPSGDKIHDFRDKTTEKYDFVAHHKGIHQFCFTNKSPYHETIDF  96

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             IHV H       AKDEH +P+  ++++L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  97   DIHVSHFTYYDQHAKDEHFNPLLEQVSKLEEALYNIQFEQHWLEAQTERQAIANEAMGRR  156

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             I     E   L  AS LQV  +RRLF + +   RV
Sbjct  157  AIHKVFFESAALVGASLLQVFLLRRLFERKLGMTRV  192



>ref|XP_006474871.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X2 [Citrus sinensis]
Length=921

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 87/159 (55%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +  D  W S H G+D  V  P  + +H  +    +KF+F A   G+++FCF N     ET
Sbjct  763  IKADSSWYSSHDGVDLVVKGPASDQIHDFRDKISEKFEFVAHHKGVHRFCFTNKSPYHET  822

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F +HVGH       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+ 
Sbjct  823  IDFDVHVGHFSYYDEHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAM  882

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +R ++    E   L  AS LQV  +RRLF + +  +RV
Sbjct  883  SRRAVYKAFWESTALVGASVLQVYLLRRLFERKLGMSRV  921



>ref|XP_010252793.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Nelumbo nucifera]
 ref|XP_010252794.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Nelumbo nucifera]
Length=212

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 83/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  + +   +  + +KF+F A + G++ FCF N     ET+ F IH
Sbjct  60   WHYSDDGVDLVVKGPSGDQIRDSRDQTSEKFEFTAHKKGLHSFCFTNKSPYHETIDFDIH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +IA+L E+L ++  EQ +L+A+  R    NE   +R I 
Sbjct  120  VGHFTYFDQHAKDEHFNPLLEQIAKLEESLYNIQFEQHWLEAQTDRQALVNEGMSRRAIH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              V E   L  AS LQV  +RRLF + +  +RV
Sbjct  180  KAVFESAALIGASVLQVYLLRRLFERKLGTSRV  212



>ref|XP_008811267.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Phoenix dactylifera]
Length=212

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+DF V  P  + +H  +  + +KF+F   + G+++FCF N     ET+ F IH
Sbjct  60   WHYGDEGVDFVVKGPHGDQIHDARDKTSEKFEFIVQQKGLHRFCFTNRSPYHETIDFDIH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH  +    AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE   +R + 
Sbjct  120  VGHFTHFDQHAKDEHFAPLLEQISKLEEALYNIQFEQHWLEAQTDRQALVNEGMSRRAMH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L   S LQ+  +RRLF + +  +RV
Sbjct  180  KALLESAALIGVSMLQIFLLRRLFERKLGMSRV  212



>ref|XP_010088435.1| Transmembrane emp24 domain-containing protein [Morus notabilis]
 gb|EXB36050.1| Transmembrane emp24 domain-containing protein [Morus notabilis]
Length=292

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 86/156 (55%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P  + +H  +  + +KF+F A R G+++FCF N   + ET+ F
Sbjct  137  DSSWHYSEEGVDLVVKGPTGDQIHDFRDKTSEKFEFVAHRKGVHRFCFTNKSPSHETIDF  196

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HV H       AKDEHL+P+  +I++L E L ++  EQ +L+A+  R    NE+  KR
Sbjct  197  DVHVSHFSYYDEHAKDEHLNPLYEQISKLEEVLYNIQFEQHWLEAQTERQALVNEAMSKR  256

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +     E   L  AS LQV  +RRLF + +  +RV
Sbjct  257  AVQKAFFESAALIGASVLQVYLLRRLFERKLGMSRV  292



>ref|XP_003574832.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Brachypodium distachyon]
Length=213

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 83/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    V   +  + DKFDF   + G+++FCF N     ET+ F
Sbjct  58   DTPWHYSEDGVDLVVKDPNGGQVRDSRDKTSDKFDFIVQKRGVHRFCFTNKSPYHETIDF  117

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  KR
Sbjct  118  DVHVGHFSYFEQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSKR  177

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +   + E   L  AS +QV  +RRLF + +  +RV
Sbjct  178  AVHKALIESAALIAASVIQVYLLRRLFERKLGTSRV  213



>gb|KJB10764.1| hypothetical protein B456_001G223000 [Gossypium raimondii]
Length=215

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 84/153 (55%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  +++H  +    +KFDF   + G+Y+FCF N     ET+ F + 
Sbjct  63   WHFSDEGVDLVVKGPEGDLIHDFRNKISEKFDFVVHKKGVYRFCFVNKSPYHETIDFDLQ  122

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH    H  AK+EH  P+  +I +L EAL ++  EQ +++A+  R    N+S  +R + 
Sbjct  123  VGHFTYRHQHAKEEHFGPLMEQITKLEEALYNIQFEQHWIEAQTDRQAIVNDSLGRRALH  182

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E + L  AS LQV  ++R+F + +  +RV
Sbjct  183  KAMFESVALIAASILQVFLLKRMFERKLGTSRV  215



>ref|XP_008358798.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Malus domestica]
Length=212

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P  + +H  +  + +K+DF A   G+++FCF N     ET+ F
Sbjct  57   DASWHHTQDGVDLMVKGPSGDKIHDFRDKTTEKYDFVAHHKGIHQFCFTNKSPYHETIDF  116

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             IHV H       AKDEH +P+  ++++L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  117  DIHVSHFTYYDQHAKDEHFNPLLEQVSKLEEALYNIQFEQHWLEAQTERQAIANEAMGRR  176

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             I     E   L  AS LQV  +RRLF + +   RV
Sbjct  177  AIHKVFFESAALVGASLLQVFLLRRLFERKLGMTRV  212



>ref|XP_010644591.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Vitis vinifera]
 ref|XP_010644592.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Vitis vinifera]
 emb|CBI39754.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 85/156 (54%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+ +  G+D  V  P  N +   +  + +KF+F A   G+++FCF N     ET+ F
Sbjct  56   DASWHYNKDGVDLVVKGPSGNQIQDYRDKTSEKFEFMAHEKGLHRFCFTNKSPYHETIDF  115

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             ++ GH       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    N++  +R
Sbjct  116  DVYTGHFAYYDQHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQARVNDAMNRR  175

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             ++    E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  AVYKAFYESAALIGASILQVYLLRRLFERKLGTSRV  211



>emb|CDP13706.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 81/153 (53%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+  H G+D  V  P    VH  +  + +K +F A   G+YKFCF N     ET+ F + 
Sbjct  56   WHFSHEGVDLVVKGPTGEQVHDFRDKTSEKGEFVAYHEGVYKFCFANKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
             GH       AKDEH  P+   I++L EAL ++  EQ +L+A+  R    NE   K+V+ 
Sbjct  116  AGHFIFHDEHAKDEHFKPLFEHISKLEEALYNIQFEQHWLEAQTERQAIVNEGMGKKVMH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E + L  AS LQV  +RRLF + +  +RV
Sbjct  176  KAMYESLALIAASVLQVYLLRRLFDRKLGISRV  208



>ref|XP_010061440.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Eucalyptus grandis]
 gb|KCW68387.1| hypothetical protein EUGRSUZ_F02040 [Eucalyptus grandis]
Length=212

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 81/153 (53%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  + +H  +    +KF+F A   G+++FCF N     ETV F +H
Sbjct  60   WHYSQDGVDLLVKGPSGDQIHDFRDKISEKFEFIAHHKGVHRFCFTNKSPYHETVDFDLH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +I +L EAL ++  EQ +L+A+  R    N+   +R I 
Sbjct  120  VGHFTYHDEHAKDEHFNPLMEQIGKLEEALYNIQFEQHWLEAQTERQAIVNDLMSRRAIH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                E   L  AS LQV  +RRLF + +  +RV
Sbjct  180  KAFFESAALIGASVLQVYLLRRLFERKLGMSRV  212



>ref|XP_011095562.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Sesamum indicum]
Length=208

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 77/153 (50%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +H ++    DK DF A   G+Y+FCF N     ETV F +H
Sbjct  56   WHYSEDGVDLVVKGPNGEQIHDVRDKISDKHDFVAYHQGIYRFCFTNKSPYHETVDFDVH  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
             GH       AKDEH  P+   I +L EAL +V  EQ +L A+  R  + NE   K  I 
Sbjct  116  AGHFLYHDEHAKDEHFKPLFEHIGKLEEALYNVQFEQHWLAAQTDRQANVNEKMSKGAIQ  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L LAS LQV  +R LF + +  +RV
Sbjct  176  KALFESAALILASGLQVYILRHLFERKLGASRV  208



>gb|KHG15887.1| Transmembrane emp24 domain-containing 2 [Gossypium arboreum]
Length=215

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 83/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  +  P  + +H  +    +KFDF   + G+Y+FCF N     ET+ F + 
Sbjct  63   WHFSDEGVDLVIKGPSGDQIHDFRNKISEKFDFVVHKKGVYRFCFVNRSPYHETIDFDLQ  122

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH    H  AK+EH  P+  +I +L EAL ++  EQ +++A+  R    N+S  +R + 
Sbjct  123  VGHFTYRHQHAKEEHFSPLMEQITKLEEALYNIQFEQHWIEAQTDRQAIVNDSLGRRALH  182

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E + L  AS LQV  ++R+F + +  +RV
Sbjct  183  KAMFESVALIAASILQVFLLKRMFERKLGTSRV  215



>gb|KJB13907.1| hypothetical protein B456_002G101200 [Gossypium raimondii]
 gb|KJB13908.1| hypothetical protein B456_002G101200 [Gossypium raimondii]
Length=212

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 83/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W++ H G+D  V  P  + +   +    +KF+F A + G+++FCF N     ETV F +H
Sbjct  60   WHNSHEGVDLVVKGPTGDQIQDFRDKISEKFEFVAHQKGIHRFCFSNKSPYYETVDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
              H       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  120  ESHFTYYDQHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSKRAVH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                E   L  AS LQV  +RRLF + +  +RV
Sbjct  180  KAFYESAALIGASVLQVYLLRRLFERKLGMSRV  212



>ref|NP_001132648.1| hypothetical protein precursor [Zea mays]
 ref|XP_008676620.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008676621.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008676622.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF80416.1| unknown [Zea mays]
 gb|ACF81579.1| unknown [Zea mays]
 gb|ACF82270.1| unknown [Zea mays]
 gb|ACN35285.1| unknown [Zea mays]
 gb|AFW61590.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
 gb|AFW61591.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
 gb|AFW61592.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
 gb|AFW61593.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
 gb|AFW61594.1| hypothetical protein ZEAMMB73_376236 [Zea mays]
Length=213

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 83/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    V   +  + DKF+F   + G+++FCF N     ET+ F +H
Sbjct  61   WHYSEEGVDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVH  120

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R + 
Sbjct  121  VGHFSYFEQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVH  180

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L +AS +QV  +RRLF + +  +RV
Sbjct  181  KALFESAALIVASVIQVYLLRRLFERKLGTSRV  213



>ref|XP_009759544.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nicotiana sylvestris]
Length=220

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 80/148 (54%), Gaps = 0/148 (0%)
 Frame = -3

Query  686  PGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIP  507
            P +   +  P    VH  +  S + ++F+A R G+Y+FCF N     E + F +HV H  
Sbjct  73   PSLHLLIKGPSGEPVHEFRDKSSEMYEFRAQRKGVYQFCFTNNLPYHEYMDFDLHVSHFT  132

Query  506  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  327
            + +  AKDEH DP+   I++L EAL+ +  EQ +L+A+  R    NE   +R +   + E
Sbjct  133  HYNQPAKDEHFDPLLEHISKLEEALQKIQVEQHWLEAQTERQASVNEGMGRRAMTKAIVE  192

Query  326  YILLALASSLQVVYIRRLFSKSVAYNRV  243
             I L L + LQ   +RRLF K +  +RV
Sbjct  193  SIALFLVTELQSFLLRRLFEKKLKSSRV  220



>ref|XP_010524625.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Tarenaya hassleriana]
 ref|XP_010524626.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Tarenaya hassleriana]
Length=208

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 83/159 (52%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            V  D  W+ +  G+D  +  P    VH  +  +  KF+F   + G+Y+FCF N     ET
Sbjct  50   VKSDSQWHYNDDGVDLVIHGPTGEQVHDFRDQTSGKFEFMVQKKGVYRFCFTNKSPYHET  109

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F + + H       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+ 
Sbjct  110  IDFDVQLAHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENM  169

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KR I   + E   L  AS LQV  +RRLF + +  +RV
Sbjct  170  SKRAIHKAMFESAALVGASVLQVYLLRRLFERKLGISRV  208



>ref|XP_010927754.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
 ref|XP_010927755.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
Length=212

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 83/159 (52%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            + +D  W+    G+D  V  P    +H  +    +KF+F + + G+Y+FCF N     ET
Sbjct  54   IKYDTPWHYSDDGVDLVVNDPHGAQIHDFRNKISEKFEFISQKKGLYRFCFTNKSPYHET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F +HV H       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE  
Sbjct  114  IDFDVHVKHFSYFDEHAKDEHFAPLLEQIGKLEEALYNIQFEQHWLEAQTDRQALVNEGM  173

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +R I   + E   L  AS LQV  +RRLF + +  +RV
Sbjct  174  SRRAIHKALFESAALIGASVLQVYLLRRLFERKLGTSRV  212



>gb|EYU27447.1| hypothetical protein MIMGU_mgv1a013853mg [Erythranthe guttata]
Length=208

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 79/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +H ++  + +K +F A   G+Y+FCF N     ET+ F +H
Sbjct  56   WHYSEDGVDLVVKGPNGEQIHDIRDKTSEKHEFVAYHQGVYRFCFTNKSPYHETIDFDVH  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
             GH       AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   +  I 
Sbjct  116  AGHFLYHDEHAKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEKMSRGAIH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L LAS LQV  +RRLF + +  +RV
Sbjct  176  KALLESAALVLASGLQVYVLRRLFERKLGVSRV  208



>ref|XP_002444693.1| hypothetical protein SORBIDRAFT_07g026110 [Sorghum bicolor]
 gb|EES14188.1| hypothetical protein SORBIDRAFT_07g026110 [Sorghum bicolor]
Length=214

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    V   +  + DKF+F   + G+++FCF N     ET+ F
Sbjct  59   DTPWHYSEEGVDLVVKDPNGGQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDF  118

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  119  DVHVGHFSYFEQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRR  178

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +   + E   L  AS +QV  +RRLF + +  +RV
Sbjct  179  AVHKALFESAALIAASVIQVYLLRRLFERKLGTSRV  214



>ref|XP_008790745.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Phoenix dactylifera]
Length=212

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 82/159 (52%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            + +D  W+    G+D  V  P    +H  +    +KF+F   + G+Y+FCF N     ET
Sbjct  54   IKYDTPWHYSDDGVDLVVKDPHGAQIHDFRNKISEKFEFIGHQKGLYRFCFTNKSPYHET  113

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F +HV H       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE  
Sbjct  114  IDFDVHVNHFSYFDEHAKDEHFAPLLEQIGKLEEALYNIQFEQHWLEAQTDRQALVNEGM  173

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +R I   + E   L  AS LQV  +RRLF + +  +RV
Sbjct  174  SRRAIHKALFESAALIGASVLQVFLLRRLFERKLGTSRV  212



>ref|XP_004974010.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Setaria italica]
Length=212

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    V   +  + DKF+F   + G+++FCF N     ET+ F
Sbjct  57   DTPWHYSEEGVDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDF  116

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  117  DVHVGHFSYFEQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRR  176

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +   + E   L  AS +QV  +RRLF + +  +RV
Sbjct  177  AVHKALFESAALIAASVIQVYLLRRLFERKLGTSRV  212



>dbj|BAK05986.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 81/153 (53%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  N +H  +    DKF+F   + G+++FCF N     ETV F +H
Sbjct  61   WHYSEDGVDLVVKDPNGNQLHDSRAKVSDKFEFMVQKRGVHRFCFTNKSPYHETVDFDVH  120

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  ++ +L E L ++  EQ +L A+  R    NE+  KR + 
Sbjct  121  VGHFSYFDQHAKDEHFGPLFEQMRKLDEDLFNIQFEQHWLTAQTDRQAILNENMSKRAVH  180

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS++QV  +RRLF + +  +RV
Sbjct  181  KALLESAALIAASAVQVYLLRRLFERKLGASRV  213



>ref|XP_010551965.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Tarenaya hassleriana]
Length=208

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 82/159 (52%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +  D  W+ +  G+D  +  P    VH  +  +  K +F   R G+YKFCF N     ET
Sbjct  50   IKSDAQWHYNEDGVDLVIHGPTGEQVHDFRDQTSGKHEFVVQRKGVYKFCFTNKSPYHET  109

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F + + H       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+ 
Sbjct  110  IDFDVQLAHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENM  169

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KR I   + E   L  AS LQV  +RRLF + +  +RV
Sbjct  170  SKRAIHKAMFESAALIGASVLQVYLLRRLFERKLGMSRV  208



>ref|XP_006659626.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Oryza brachyantha]
Length=213

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    V   +  + DKF+F   + G+++FCF N     ET+ F
Sbjct  58   DTPWHYSEDGVDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDF  117

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  118  DVHVGHFSYYDQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRR  177

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +   + E   L  AS +QV  +RRLF + +  +RV
Sbjct  178  AVHKALLESAALIAASVIQVYLLRRLFERKLGTSRV  213



>ref|XP_002300382.1| emp24/gp25L/p24 family protein [Populus trichocarpa]
 ref|XP_011038808.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Populus euphratica]
 gb|ABK92934.1| unknown [Populus trichocarpa]
 gb|EEE85187.1| emp24/gp25L/p24 family protein [Populus trichocarpa]
Length=213

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 82/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  + +H  +    +K +F A + G+++FCF N     ET+ F +H
Sbjct  61   WHYSDDGVDLVVKGPSGDQIHDFRDKISEKIEFVAHQKGVHRFCFTNKSPYHETIDFDVH  120

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    N++  +R I 
Sbjct  121  VGHFSYYDEHAKDEHFQPLLEQISKLEEALYNIQFEQHWLEAQTDRQAIINDAMSRRTIH  180

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                E   L  AS LQV  +RRLF + +  +RV
Sbjct  181  KAFFESAALVAASILQVYLLRRLFERKLGMSRV  213



>ref|NP_001062344.1| Os08g0532900 [Oryza sativa Japonica Group]
 dbj|BAD11657.1| coated vesicle membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF24258.1| Os08g0532900 [Oryza sativa Japonica Group]
 gb|EAZ07774.1| hypothetical protein OsI_30027 [Oryza sativa Indica Group]
 gb|EAZ43460.1| hypothetical protein OsJ_28066 [Oryza sativa Japonica Group]
 dbj|BAG93588.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97218.1| unnamed protein product [Oryza sativa Japonica Group]
Length=212

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 83/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    V   +  + DKF+F   + G+++FCF N     ETV F
Sbjct  57   DTPWHYSEDGVDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETVDF  116

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  117  DVHVGHFSYFDQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRR  176

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +   + E   L  AS +QV  +RRLF + +  +RV
Sbjct  177  AVHKALLESAALIAASVIQVYLLRRLFERKLGTSRV  212



>ref|XP_004144551.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Cucumis sativus]
 gb|KGN43402.1| hypothetical protein Csa_7G031630 [Cucumis sativus]
Length=214

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 82/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  +  P    +H  +  + +K +F A   G+++FCF N     ET+ F +H
Sbjct  62   WHYGDDGVDLVIKGPSGEHLHDFRDKTSEKHEFIAHNKGLHRFCFTNKSPYHETIDFDVH  121

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE   KR I 
Sbjct  122  VGHFSYHEQHAKDEHFNPLMDQISKLEEALYNIQFEQHWLEAQTDRQAIVNEGMGKRAIH  181

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  ++RLF + +  +RV
Sbjct  182  KAMFESAALVGASVLQVYLLQRLFERKLGTSRV  214



>ref|XP_009408352.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Musa acuminata subsp. malaccensis]
Length=210

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 79/149 (53%), Gaps = 0/149 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    GID  V  P    +H     + +KF+F A +SG+++FCF N     ET+ F ++
Sbjct  60   WHYGDEGIDLVVKDPSGTQIHDFYDKTSEKFEFMAQKSGLHRFCFTNRSPYHETIDFDVY  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE   +R I 
Sbjct  120  IGHFSYFEQHAKDEHFGPLLEQIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSRRAIH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVA  255
              + E   L  AS LQV  +RRLF + + 
Sbjct  180  KALFESAALIGASVLQVYLLRRLFERKLG  208



>ref|XP_006407808.1| hypothetical protein EUTSA_v10021526mg [Eutrema salsugineum]
 gb|ESQ49261.1| hypothetical protein EUTSA_v10021526mg [Eutrema salsugineum]
Length=208

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NES  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNESMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQ+  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASVLQIYLLRRLFERKLGMSRV  208



>ref|XP_011461874.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=212

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    +H  +  + +K++F     G+++FCF N     ET+ F
Sbjct  57   DASWHYTQDGVDLMVKGPSGEQIHEFRDKTSEKYEFVTRHKGIHQFCFTNKSPYHETIDF  116

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             IHV H       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  117  DIHVSHFTYYDQHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRR  176

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             I     E   L  AS LQV  +RRLF + +  +RV
Sbjct  177  AIHKAFFESAGLVGASVLQVYLLRRLFERKLGMSRV  212



>emb|CDY28027.1| BnaC05g44290D [Brassica napus]
Length=211

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  59   WHFNEDGVDLVIHGPAGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  118

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  119  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  178

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  179  KALFESFALIGASVLQVYLLRRLFERKLGMSRV  211



>emb|CDY35954.1| BnaA05g29960D [Brassica napus]
Length=208

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPAGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASVLQVYLLRRLFERKLGMSRV  208



>ref|XP_009147043.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Brassica rapa]
Length=208

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPAGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASVLQVYLLRRLFERKLGMSRV  208



>ref|XP_009134990.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Brassica rapa]
Length=208

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASVLQVYLLRRLFERKLGMSRV  208



>ref|XP_009124202.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Brassica rapa]
Length=208

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASVLQVYLLRRLFERKLGMSRV  208



>emb|CDY07978.1| BnaC03g35450D [Brassica napus]
Length=209

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  57   WHFNEDGVDLVIHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  116

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  117  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  176

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  177  KALFESFALIGASVLQVYLLRRLFERKLGMSRV  209



>emb|CDX74033.1| BnaA03g30140D [Brassica napus]
Length=208

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASVLQVYLLRRLFERKLGMSRV  208



>ref|XP_006452612.1| hypothetical protein CICLE_v100094662mg, partial [Citrus clementina]
 gb|ESR65852.1| hypothetical protein CICLE_v100094662mg, partial [Citrus clementina]
 gb|KDO59138.1| hypothetical protein CISIN_1g0281952mg, partial [Citrus sinensis]
Length=142

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 79/142 (56%), Gaps = 0/142 (0%)
 Frame = -3

Query  668  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  489
            V  P  + +H  +    +KF+F A   G+++FCF N     ET+ F +HVGH       A
Sbjct  1    VKGPASDQIHDFRDKISEKFEFVAHHKGVHRFCFTNKSPYHETIDFDVHVGHFSYYDEHA  60

Query  488  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  309
            KDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R ++    E   L  
Sbjct  61   KDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRRAVYKAFWESTALVG  120

Query  308  ASSLQVVYIRRLFSKSVAYNRV  243
            AS LQV  +RRLF + +  +RV
Sbjct  121  ASVLQVYLLRRLFERKLGMSRV  142



>ref|XP_006298554.1| hypothetical protein CARUB_v10014637mg [Capsella rubella]
 gb|EOA31452.1| hypothetical protein CARUB_v10014637mg [Capsella rubella]
Length=208

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 81/153 (53%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMGRRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E + L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALVESLALIAASLLQVYLLRRLFERKLGMSRV  208



>ref|XP_010456670.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Camelina sativa]
Length=208

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFSPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASLLQVYLLRRLFERKLGMSRV  208



>ref|NP_001147761.1| LOC100281371 precursor [Zea mays]
 ref|XP_008674556.1| PREDICTED: LOC100281371 isoform X1 [Zea mays]
 gb|ACG28608.1| transmembrane emp24 domain-containing protein 3 precursor [Zea 
mays]
 gb|ACN25245.1| unknown [Zea mays]
 gb|ACR37909.1| unknown [Zea mays]
 gb|ACR38221.1| unknown [Zea mays]
 tpg|DAA48232.1| TPA: Transmembrane emp24 domain-containing protein 3 isoform 
1 [Zea mays]
 tpg|DAA48233.1| TPA: Transmembrane emp24 domain-containing protein 3 isoform 
2 [Zea mays]
 tpg|DAA48234.1| TPA: Transmembrane emp24 domain-containing protein 3 isoform 
3 [Zea mays]
Length=213

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    V   +  + DKF+F   + G+++FCF N     ET+ F
Sbjct  58   DTPWHYSEEGVDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDF  117

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  118  DVHVGHFSYFEQHAKDEHFAPLFEQIGKLDEALYNIQFEQHWLEAQTDRQAILNENMSRR  177

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +   + E   L  AS +QV  +RRLF + +  +RV
Sbjct  178  AVHKALFESAALIAASVIQVYLLRRLFERKLGTSRV  213



>gb|EMS66095.1| Transmembrane emp24 domain-containing protein [Triticum urartu]
Length=212

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 81/153 (53%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    V   +    DKF+F   + G+++FCF N     ET+ F +H
Sbjct  60   WHYSEDGVDLVVKDPNGAQVRDSRDKISDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R I 
Sbjct  120  VGHYSYFDQHAKDEHFSPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAIH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS +QV  +RRLF + +  +RV
Sbjct  180  KALFESAALIAASVIQVYLLRRLFERKLGTSRV  212



>ref|XP_010464406.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Camelina sativa]
Length=208

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 82/159 (52%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            V  D  W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET
Sbjct  50   VKSDSQWHFNEDGVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHET  109

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F + +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+ 
Sbjct  110  IDFDVQLGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENM  169

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             KR +   + E   L  AS LQV  +RRLF + +  +RV
Sbjct  170  SKRAVHKALFESFALIGASLLQVYLLRRLFERKLGMSRV  208



>ref|XP_002676871.1| predicted protein [Naegleria gruberi]
 gb|EFC44127.1| predicted protein [Naegleria gruberi]
Length=197

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 3/139 (2%)
 Frame = -3

Query  680  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYST--PETVSFYIHVGHIP  507
            ID  V  P   ++H  +  S  KF   A + G YKFCF N  ST  P+TVSF+I +G   
Sbjct  54   IDLVVFDPDGEILHQQERESEGKFSINADKKGTYKFCFSNKISTLTPKTVSFHISIGDFV  113

Query  506  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  327
            +  N+AK EHL P+   I +L E L  + +EQ+  +AR+A HR+  E+T +RV +Y +  
Sbjct  114  DT-NIAKLEHLSPVEQTIQKLSEGLSHIQNEQQEFRAREATHRNICEATNERVTYYNLFS  172

Query  326  YILLALASSLQVVYIRRLF  270
              LL   S +Q+  +R  F
Sbjct  173  IFLLVCLSGVQIYVLRMWF  191



>ref|XP_007049383.1| Emp24/gp25L/p24 family/GOLD family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93540.1| Emp24/gp25L/p24 family/GOLD family protein isoform 1 [Theobroma 
cacao]
Length=216

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 83/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    GID  +  P    +H  +  + +K++F   + G+Y+FCF+N     ET+ F + 
Sbjct  64   WHFSDEGIDLVIRGPSGEQIHDFRDKTSEKYEFVVQQKGVYRFCFYNKSPYHETIDFDVK  123

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            + H   +   AKDEH+ P+  +I++L EAL ++  EQ +++A+  R    N+S   R I 
Sbjct  124  LAHFAYQEQHAKDEHIAPLLEQISKLEEALYNIQFEQHWIEAQTDRQAIVNDSMGLRAIH  183

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  184  KAMLESAALVGASILQVCLLRRLFERKLGTSRV  216



>ref|XP_009590973.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Nicotiana tomentosiformis]
Length=189

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 80/145 (55%), Gaps = 0/145 (0%)
 Frame = -3

Query  677  DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEH  498
            ++ +  P    VH  +  + + ++F A R G+Y+FCF N     E + F +HV H  + +
Sbjct  45   NYQIKGPSGEPVHEFRDKTSEMYEFMAQRKGIYQFCFTNKSPYHEYMDFDLHVSHFTHCN  104

Query  497  NLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYIL  318
              AKDEH DP+  +I++L  AL+ +  EQ +L+A+  R    NE   +R +   + E I 
Sbjct  105  QPAKDEHFDPLLEQISKLEAALQKIQVEQHWLEAQTERQASVNEGMGRRAMAKAIVESIA  164

Query  317  LALASSLQVVYIRRLFSKSVAYNRV  243
            L L S LQ   +RRLF K ++ +RV
Sbjct  165  LFLVSELQSFLLRRLFEKKLSSSRV  189



>ref|XP_002882543.1| hypothetical protein ARALYDRAFT_478100 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58802.1| hypothetical protein ARALYDRAFT_478100 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASLLQVYLLRRLFERKLGMSRV  208



>gb|EMT09288.1| Transmembrane emp24 domain-containing protein 7 [Aegilops tauschii]
Length=317

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 82/159 (52%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +  D  W+    G+D  V  P  N VH  +    DKF+F   + G+++FCF N     ET
Sbjct  159  IKADTPWHYSEDGVDLVVKDPNGNQVHDSRAKVSDKFEFIVQKRGVHRFCFTNKSPYHET  218

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            V F +HVGH       AKDEH  P+  +I +L E L +V  EQ +L A+  R    NE+ 
Sbjct  219  VDFDVHVGHFSYFDQHAKDEHFGPLFEQIRKLDEDLYNVLFEQHWLTAQTDRQAILNENM  278

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              R I   + E   L  AS++QV  +RRLF + +  +RV
Sbjct  279  STRAIHKALLESAALIAASAVQVYLLRRLFERKLGTSRV  317



>ref|XP_010486337.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Camelina sativa]
Length=208

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASLLQVYLLRRLFERKLGMSRV  208



>ref|NP_187425.1| p24 subfamily beta 2 [Arabidopsis thaliana]
 sp|Q9S7M9.1|P24B2_ARATH RecName: Full=Transmembrane emp24 domain-containing protein p24beta2; 
AltName: Full=p24 family protein beta1; Short=p24beta1; 
AltName: Full=p24 family protein beta2; Short=p24beta2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF13086.1|AC009176_13 putative coated vesicle membrane protein [Arabidopsis thaliana]
 gb|AAF21178.1|AC013483_2 putative coated vesicle membrane protein [Arabidopsis thaliana]
 gb|AAK25978.1|AF360268_1 putative coated vesicle membrane protein [Arabidopsis thaliana]
 gb|AAK64137.1| putative coated vesicle membrane protein [Arabidopsis thaliana]
 gb|AEE74586.1| p24 subfamily beta 2 [Arabidopsis thaliana]
Length=208

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASFLQVYLLRRLFERKLGMSRV  208



>gb|AAM66112.1| putative coated vesicle membrane protein [Arabidopsis thaliana]
Length=208

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    +H  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  56   WHFNEDGVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  115

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  116  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  175

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  176  KALFESFALIGASFLQVYLLRRLFERKLGMSRV  208



>gb|ACG35396.1| transmembrane emp24 domain-containing protein 3 precursor [Zea 
mays]
Length=213

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    V   +  + DKF+F   + G+++FCF N     ET+ F
Sbjct  58   DTPWHYSEEGVDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDF  117

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  118  DVHVGHFSYFEQHAKDEHFAPLFDQIGKLDEALYNIQFEQHWLEAQTDRQAILNENMSRR  177

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +   + E   L  AS +QV  +RRLF + +  +RV
Sbjct  178  AVHKALFESAALIAASVIQVYLLRRLFERKLGTSRV  213



>emb|CDY22128.1| BnaC01g39730D [Brassica napus]
Length=242

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ +  G+D  +  P    VH  +     K DF   + G+Y+FCF N     ET+ F + 
Sbjct  90   WHFNEDGVDLVIHGPTGEQVHDFREQISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQ  149

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            +GH       AKDEH  P+  +I++L EAL ++  EQ +L+A+  R    NE+  KR + 
Sbjct  150  LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTDRQAIVNENMSKRAVH  209

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  +RRLF + +  +RV
Sbjct  210  KALFESFALIGASVLQVYLLRRLFERKLGMSRV  242



>gb|AGT16036.1| transmembrane emp24 domain-containing protein [Saccharum hybrid 
cultivar R570]
Length=237

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 83/158 (53%), Gaps = 0/158 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +  D  W+    G+D  V  P    V   +  + DKF+F   + G+++FCF N     ET
Sbjct  56   IKADTPWHYSEEGVDLVVKDPNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHET  115

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F +HVGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+ 
Sbjct  116  IDFDVHVGHFSYFEQHAKDEHFAPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENM  175

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNR  246
             +R +   + E   L  AS +QV  +RRLF + +  +R
Sbjct  176  SRRAVHKALFESAALIAASVIQVYLLRRLFERKLGTSR  213



>ref|XP_010689227.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Beta vulgaris subsp. vulgaris]
Length=216

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 85/157 (54%), Gaps = 1/157 (1%)
 Frame = -3

Query  710  DIFWNSDHPGI-DFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVS  534
            D  W+S++ G+ D  V  P    +H  +  S +KF+F A + G+Y FCF N     ET+ 
Sbjct  60   DSAWHSENEGVVDLVVKGPDGEQLHDTREKSSEKFEFIAHKKGIYHFCFGNRSPYHETID  119

Query  533  FYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRK  354
            F + VGH     + AKDEH+ P+  +IA+L EAL ++  EQ +L+A   R    NE   +
Sbjct  120  FDVLVGHYGYVDHHAKDEHVSPLYEQIAKLEEALYNIQFEQHWLEAETDRQAIINEGMSQ  179

Query  353  RVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R I     E   L  AS LQV  ++RLF + +  +RV
Sbjct  180  RAIHKAFFESAALIGASVLQVYLLKRLFERKLGTSRV  216



>gb|EMS53833.1| Transmembrane emp24 domain-containing protein 7 [Triticum urartu]
Length=243

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 81/156 (52%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P  N VH  +    DKF+F   + G+++FCF N     ETV F
Sbjct  88   DTPWHYSEDGVDLVVKDPNGNQVHDSRAKVSDKFEFIVQKRGVHRFCFTNKSPYHETVDF  147

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +HVGH       AKDEH  P+  +I +L + L +V  EQ +L A+  R    NE+   R
Sbjct  148  DVHVGHFSYFDQHAKDEHFGPLFEQIRKLDDDLYNVLFEQHWLTAQTDRQAILNENMSTR  207

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             I   + E   L  AS++QV  +RRLF + +  +RV
Sbjct  208  AIHKALLESAALIAASAVQVYLLRRLFERKLGTSRV  243



>ref|XP_011100513.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Sesamum indicum]
 ref|XP_011100514.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Sesamum indicum]
Length=216

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 82/153 (54%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W     G+D  +  P    VH       +K++F + R G+Y+FCF N     ET+ F +H
Sbjct  64   WIYSDEGVDLLIKGPSGEQVHEFHDRISEKYEFLSQRKGIYRFCFTNKSPYHETIDFDVH  123

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH    +  AKDEH +P+  +I++L  AL ++  EQ +L+A+  R    NE   ++  +
Sbjct  124  VGHFMYHNQHAKDEHFNPMLEQISKLEVALYNIQFEQHWLEAQVDRQALVNEVMGRKAFY  183

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E + L  AS LQV  ++RLF + +  +RV
Sbjct  184  KAIFESLALLGASFLQVYLLQRLFERKLGTSRV  216



>ref|XP_008380011.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Malus domestica]
Length=216

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 79/156 (51%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  +  PG   +H ++G + +K++      G+++FCF N     ET+ F
Sbjct  61   DSTWHYTEDGVDLVIKGPGGEQIHDIRGKTSEKYELVVQXQGVHQFCFTNKSPYHETIDF  120

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +H  H       AKDEH  P+  +I +L EAL ++  EQ +L+A   R    NE   +R
Sbjct  121  DVHAAHFTYHDQHAKDEHFTPLLEQIQKLEEALYNIQFEQHWLEAETDRQAIVNEGMSRR  180

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                 + E   L  AS LQV  ++RLF + +  +RV
Sbjct  181  ATHKALIESAALIGASCLQVFLLKRLFERKLGSSRV  216



>gb|ABB90548.1| coated vesicle membrane protein-like [Triticum aestivum]
Length=212

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 81/153 (53%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V       V   +  + DKF+F   + G+++FCF N     ET+ F +H
Sbjct  60   WHYSEDGVDLVVKDSNGAQVRDSRDKTSDKFEFIVQKRGVHRFCFTNKSPYHETIDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH  P+  +IA+L EAL ++  EQ +L+A+  R    NE+  +R I 
Sbjct  120  VGHYSYFDQHAKDEHFSPLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAIH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS +QV  +RRLF + +  +RV
Sbjct  180  KALFESAALIAASVIQVYLLRRLFERKLGTSRV  212



>gb|KDO50955.1| hypothetical protein CISIN_1g040712mg, partial [Citrus sinensis]
Length=179

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 79/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G++ TVT P D  V      S   F+F A + G+YKFCF N     ET  F IH
Sbjct  27   WHYSDEGVELTVTGPSDERVRDFDRRSTATFEFVAYKKGLYKFCFTNKSPYHETPDFDIH  86

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            V H       AKDEH++PI  +IA+L EAL  +  +Q +  A+  R    N++  +R I+
Sbjct  87   VAHYAYHDQHAKDEHINPILDQIAKLEEALYDIHFQQHWFDAQTERQSIVNKTMSRRAIY  146

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              +     L  AS LQ+  ++RLF +    +RV
Sbjct  147  KAMLGSFFLITASFLQIHLLKRLFDRKQGLSRV  179



>ref|XP_010063252.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
isoform X1 [Eucalyptus grandis]
 gb|KCW70465.1| hypothetical protein EUGRSUZ_F03682 [Eucalyptus grandis]
Length=212

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 78/153 (51%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +        +KF+F A   G+++FCF N     ET+ F +H
Sbjct  60   WHYSQEGVDLVVKGPSGEQIQDFHDKISEKFEFVAHHKGVHRFCFTNKSPYHETIDFDVH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +I +L EAL ++  EQ +L+A   R    N++  +R + 
Sbjct  120  VGHFTFYDQHAKDEHFNPLLEQIGKLEEALYNIQFEQHWLEAETERQAIVNDAMSRRAVH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                E   L  AS LQV  +RRLF + +  +RV
Sbjct  180  KAFFESAALIGASVLQVYLLRRLFERKLGISRV  212



>ref|XP_009616557.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nicotiana tomentosiformis]
Length=214

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 85/160 (53%), Gaps = 1/160 (1%)
 Frame = -3

Query  719  VDHDIFWNSDHPG-IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPE  543
            +  D  W+S + G +D  +  P    +H+    + +K++F A R G+Y+FCF N     E
Sbjct  55   IKSDTPWHSANEGAVDLLIKGPSGEQIHNFPDKTSEKYEFVAHRKGVYQFCFTNKSPNHE  114

Query  542  TVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNES  363
            T+ F +HV H       AKDEH DP+  +I++L  AL ++  EQ +L+A+  R    NE 
Sbjct  115  TLDFDVHVVHYTYFDQHAKDEHFDPLLEQISKLEAALYNIQFEQHWLEAQTDRQALVNEG  174

Query  362  TRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              +R I   + E + L   S LQV  ++RLF K +   RV
Sbjct  175  MSQRAITKAILESVTLVGVSFLQVFLLQRLFEKKIRTIRV  214



>ref|XP_009361538.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Pyrus x bretschneideri]
Length=216

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 79/156 (51%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  +  PG   +H ++  + +K+D    + G+++FCF N     ETV F
Sbjct  61   DSTWHYTDDGVDLVIKGPGGEQIHDIRDKTSEKYDLVVQKQGVHQFCFTNKSPYHETVDF  120

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +H  H       AKDEH  P+  +I +L EAL ++  EQ +L+A   R    NE   +R
Sbjct  121  DVHAAHFTYYDQHAKDEHFTPLLEQIQKLEEALYNIQFEQHWLEAETDRQAIVNEGMSRR  180

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                 + E   L  AS LQV  ++RLF + +  +RV
Sbjct  181  ATHKALIESAALIGASCLQVFLLKRLFERKLGSSRV  216



>ref|XP_636960.1| hypothetical protein DDB_G0288053 [Dictyostelium discoideum AX4]
 sp|Q769F9.1|TMEDA_DICDI RecName: Full=Transmembrane emp24 domain-containing protein A; 
Flags: Precursor [Dictyostelium discoideum]
 dbj|BAD05160.1| emp24/gp25L/p24 family protein [Dictyostelium discoideum]
 gb|EAL63452.1| hypothetical protein DDB_G0288053 [Dictyostelium discoideum AX4]
Length=205

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -3

Query  680  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYS--TPETVSFYIHVGHIP  507
            IDFT+ SP   +V+S +  S      ++  +G+Y FCF N  S  T +TVSF + VG   
Sbjct  61   IDFTIISPDKRIVYSGQRESEGTKTLRSSFAGVYSFCFSNKMSSLTDKTVSFILSVGESS  120

Query  506  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  327
                +AK + L PI   I  L + + +V +EQ Y K R+A HR+T EST  RV++++V E
Sbjct  121  PIREIAKKKDLTPIERSIMTLSDGVIAVKNEQNYFKMREAAHRNTAESTNSRVLWWSVFE  180

Query  326  YILLALASSLQVVYIRRLF  270
              +L   S  Q+ Y+RR F
Sbjct  181  AFVLIALSIWQIYYLRRFF  199



>dbj|BAM20109.1| transmembrane emp24 domain-containing protein [Papilio xuthus]
Length=207

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 81/141 (57%), Gaps = 4/141 (3%)
 Frame = -3

Query  680  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYST--PETVSFYIHVGHIP  507
            ID T+T P   V+H  +  S   + F AP SG Y +CF N  ST  P+ V F + +G  P
Sbjct  61   IDITITGPDGAVIHKGERESSGIYTFSAPTSGRYTYCFSNKMSTMTPKVVMFNLEIGEAP  120

Query  506  NEHNLAKDEHLDPINVK--IAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  333
            N++    DE  +  N++  I EL   L++V +EQ+Y++ RD  HR  NEST  RV+ +++
Sbjct  121  NKNAGDNDEEANHNNLENMIKELGATLKTVKNEQEYMQVRDRIHRAINESTNSRVVMWSI  180

Query  332  GEYILLALASSLQVVYIRRLF  270
             E  +L + +  QV Y++R F
Sbjct  181  FEASVLLVMTLGQVYYLKRFF  201



>ref|XP_009787783.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nicotiana sylvestris]
Length=214

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 1/160 (1%)
 Frame = -3

Query  719  VDHDIFWNSDHPG-IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPE  543
            +  D  W+S   G +D  +  P    +H+    + +K++F A R G+YKFCF N     E
Sbjct  55   IKADTPWHSASEGAVDLLIKGPSGEQIHNFPDKTSEKYEFVAHRKGVYKFCFTNKSPYHE  114

Query  542  TVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNES  363
            T+ F +HV H       AKDEH DP+  +I++L  AL ++  EQ +L+A+  R    NE 
Sbjct  115  TLDFDVHVVHYTYFDQHAKDEHFDPLLEQISKLEAALYNIQFEQHWLEAQTERQALVNEG  174

Query  362  TRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              +R I   + E + L   S LQV  ++RLF + V   RV
Sbjct  175  MSQRAITKAILESVTLVGVSFLQVFLLQRLFEQKVRTIRV  214



>ref|XP_008362318.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Malus domestica]
Length=216

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 78/153 (51%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  +  PG   +H ++  +  K+DF   + G+++FCF N     ET+ F +H
Sbjct  64   WHYTDDGVDLVIKGPGGEQIHDIRDKTSVKYDFVVEKQGVHQFCFTNKSPYHETIDFDVH  123

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
              H       AKDEH  P+  +I +L EAL ++  EQ +L+A   R    NE   +R   
Sbjct  124  AAHFTYYDQHAKDEHFTPLLDQIQKLEEALYNIQFEQHWLEAETDRQAIVNEGMSRRATH  183

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS LQV  ++RLF + +  +RV
Sbjct  184  KALIESAALIGASCLQVFLLKRLFERKLGSSRV  216



>ref|XP_004172188.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like, 
partial [Cucumis sativus]
Length=206

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 0/144 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  +  P    +H  +  + +K +F A   G+++FCF N     ET+ F +H
Sbjct  62   WHYGDDGVDLVIKGPSGEHLHDFRDKTSEKHEFIAHNKGLHRFCFTNKSPYHETIDFDVH  121

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE   KR I 
Sbjct  122  VGHFSYHEQHAKDEHFNPLMDQISKLEEALYNIQFEQHWLEAQTDRQAIVNEGMGKRAIH  181

Query  341  YTVGEYILLALASSLQVVYIRRLF  270
              + E   L  AS LQV  ++RLF
Sbjct  182  KAMFESAALVGASVLQVYLLQRLF  205



>ref|XP_006586144.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Glycine max]
 gb|KHN11154.1| Transmembrane emp24 domain-containing protein A [Glycine soja]
Length=214

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 79/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W   H G+D +V  P    +      + + F+F A  SG Y+FCF N     ETV F
Sbjct  55   DTSWQHTHEGVDLSVKGPSGEPIKDFHDMTSEIFEFVARNSGPYRFCFINKSPYHETVDF  114

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +H  HI      AKDEHL P+  +I +L +AL ++  EQ +L+A+  R    + +   R
Sbjct  115  DVHSNHIHFTDQHAKDEHLTPLLDQIVKLEQALFNIQYEQHWLEAQTERQAIASNAMSSR  174

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAY  252
             I   + E + L  AS+LQV  +RRLF +  AY
Sbjct  175  AIHKALLESMTLMGASALQVYLLRRLFERKPAY  207



>ref|XP_010313948.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Solanum lycopersicum]
Length=215

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 78/153 (51%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+ ++ G+D  V  P    +H ++    +K +F +   G+Y+FCF N     ET+ F +H
Sbjct  63   WHHNNDGVDLVVKGPSGEQIHDLRDKISEKSEFTSHHEGIYRFCFTNKSPYHETIDFDLH  122

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
              H       AKDEH  P+   I +L EAL S+  EQ +L+A+  R    NE   KR ++
Sbjct  123  AAHFVYHDEHAKDEHFKPLFEHIGKLEEALYSIQFEQHWLEAQTDRQAIVNEGMSKRAMY  182

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L   S LQV  ++ LF + +  +RV
Sbjct  183  KALFESSALICVSFLQVFLLKHLFERKLGQSRV  215



>ref|XP_006660817.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006660818.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X2 [Oryza brachyantha]
Length=212

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 81/153 (53%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  N +H  +    DKF+F   + G+++FCF N     ETV F + 
Sbjct  60   WHFTKDGVDLVVKDPNGNQIHDSRDKITDKFEFIVHKRGVHRFCFTNKSPYHETVDFDVL  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            VGH       AKDEH   +  +IA+L EAL ++  EQ +L+A+  R    NE+  +R + 
Sbjct  120  VGHFSYFDQHAKDEHFGTLFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMGRRAVH  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L  AS +QV  +RRLF + +  +RV
Sbjct  180  KALFESAALIAASVVQVYLLRRLFERKLGTSRV  212



>ref|XP_002522778.1| coated vesicle membrane protein, putative [Ricinus communis]
 gb|EEF39629.1| coated vesicle membrane protein, putative [Ricinus communis]
Length=938

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 83/159 (52%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            V  D  W+    G+D  +  P  + +H  +    DK++F A + G++ FCF N     ET
Sbjct  780  VKTDSSWHYTEDGVDLVIKGPSGDQIHDFRDKVSDKYEFMARQKGVHHFCFTNKSPYHET  839

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F +HVGH       AKDEH  P+  +I +L EAL ++  EQ +L+A+  R    NE+ 
Sbjct  840  IDFDVHVGHFSYYDEHAKDEHFKPLLDQIWKLEEALYNIQFEQHWLEAQTERQAIVNEAM  899

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +R +     E   L  AS LQV  +RRLF + +  +RV
Sbjct  900  SRRAVHKAFYESAALIGASVLQVYLLRRLFERKLGISRV  938



>emb|CDP20746.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 74/123 (60%), Gaps = 0/123 (0%)
 Frame = -3

Query  611  FDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREAL  432
            F+F AP+ G+Y+FCF N     ETV F +HVGH P     AKDEH +P+  +I++L EAL
Sbjct  52   FEFMAPKKGLYRFCFTNRSPYHETVDFDVHVGHFPYYEQHAKDEHFNPLLEQISKLEEAL  111

Query  431  ESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAY  252
             ++  EQ +L+A+  R    NE+  K+ +   + E I L   S LQV  ++RLF + +  
Sbjct  112  YNIQFEQHWLEAQTDRQALVNENMSKKAVHKALLESIALIGTSVLQVYLLQRLFERKLGT  171

Query  251  NRV  243
            +RV
Sbjct  172  SRV  174



>ref|XP_011095564.1| PREDICTED: cellulose synthase-like protein E6 [Sesamum indicum]
Length=934

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 80/153 (52%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +H ++  + DK +F A + G+Y+FCF N     ET+ F +H
Sbjct  782  WHYSDDGVDLVVKGPNGEQIHDIRDKTSDKHEFVAYQQGVYRFCFTNKSPYHETLDFDVH  841

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
             GH       AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   +  I 
Sbjct  842  AGHFLYHDEHAKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEKMSRGAIH  901

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L LAS LQV  +RRLF + +  +RV
Sbjct  902  KALFESAALILASGLQVYILRRLFERKLGASRV  934



>dbj|GAM18347.1| hypothetical protein SAMD00019534_015220, partial [Acytostelium 
subglobosum LB1]
Length=209

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -3

Query  680  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYS--TPETVSFYIHVGHIP  507
            IDFT+ SP   +++  +  S      KA   G+Y FCF N  S  T +TVSF + VG   
Sbjct  65   IDFTIISPDSRILYKGERESEGTKVMKASMEGLYSFCFSNQMSSLTEKTVSFMVVVGERS  124

Query  506  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  327
               +LAK   + P+  +I +L + ++++ +EQ  LK R+  HR+T EST  RV ++   E
Sbjct  125  QMADLAKKGDITPLERQIVQLADGVQAILNEQNNLKMREITHRNTAESTNSRVTWWAFFE  184

Query  326  YILLALASSLQVVYIRRLF  270
             +LL   S  Q+ Y+RR F
Sbjct  185  AVLLVTMSLWQIYYLRRFF  203



>ref|XP_008229935.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Prunus mume]
 ref|XP_008229936.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Prunus mume]
 ref|XP_008229938.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Prunus mume]
Length=216

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 81/156 (52%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W++   G+D  +  P    ++ ++  + +KF+F   + G+++FCF N     ET+ F
Sbjct  61   DSSWHNAEDGVDLVIKGPSGEQINDIRDKTSEKFEFVVQKQGVHQFCFTNKSPYHETIDF  120

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +H  H       AKDEH  P+  +IA+L EAL ++  EQ +L+A   R    NE   +R
Sbjct  121  DVHAAHFTYYDQHAKDEHFTPLLEQIAKLEEALFNIQFEQHWLEAETDRQAIVNEGMGRR  180

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                 + E   L   S LQVV ++RLF + +  +RV
Sbjct  181  ATHKALIESGALIGVSILQVVLLKRLFERKLGSSRV  216



>ref|XP_010926811.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Elaeis guineensis]
Length=211

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 80/147 (54%), Gaps = 0/147 (0%)
 Frame = -3

Query  683  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  504
            G+D  V  P    ++ ++    +KF+F   + G ++FCF N     ET+ F + + H  +
Sbjct  65   GVDLVVRDPDGAQIYDVRNKISEKFEFVVGKKGHHRFCFTNKSPYRETIDFDVRLNHFSH  124

Query  503  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  324
                AKDEH+DP+  +IA+L EAL+SV  EQ +L A   R    N+S  +R I   + E 
Sbjct  125  IGQHAKDEHVDPLLEQIAKLEEALDSVKFEQHWLFAYAYRQLLVNKSMSQRAIHKAIFES  184

Query  323  ILLALASSLQVVYIRRLFSKSVAYNRV  243
              L  AS LQV  +RRLF + +  +RV
Sbjct  185  AALVGASVLQVYLLRRLFERKLGISRV  211



>ref|XP_004295183.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=940

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 82/156 (53%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D  V  P    +H  +  + +K++F     G+++FCF N     ET+ F
Sbjct  785  DASWHYTQDGVDLMVKGPSGEQIHEFRDKTSEKYEFVTRHKGIHQFCFTNKSPYHETIDF  844

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             IHV H       AKDEH +P+  +I++L EAL ++  EQ +L+A+  R    NE+  +R
Sbjct  845  DIHVSHFTYYDQHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTERQAIVNEAMSRR  904

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             I     E   L  AS LQV  +RRLF + +  +RV
Sbjct  905  AIHKAFFESAGLVGASVLQVYLLRRLFERKLGMSRV  940



>ref|XP_009606341.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Nicotiana tomentosiformis]
Length=212

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 75/153 (49%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +H  +    +K +F A   G+Y+FCF N     ET+ F +H
Sbjct  60   WHYSEEGVDLVVKGPSGEQIHDFRDKISEKTEFVAHHEGVYRFCFTNKSPYHETIDFDLH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
              H       AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   KR ++
Sbjct  120  AAHFVYHDEHAKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAVY  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L   S LQV  ++ LF + +  +RV
Sbjct  180  KALFESSALICVSVLQVFLLKHLFERKLGQSRV  212



>ref|XP_007215846.1| hypothetical protein PRUPE_ppa010256mg [Prunus persica]
 gb|EMJ17045.1| hypothetical protein PRUPE_ppa010256mg [Prunus persica]
Length=257

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 81/156 (52%), Gaps = 0/156 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W++   G+D  +  P    ++ ++  + +KF+F   + G+++FCF N     ET+ F
Sbjct  102  DSSWHNTEDGVDLVIKGPSGEQINDIRDKTSEKFEFVVQKQGVHQFCFTNKSPYHETIDF  161

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +H  H       AKDEH  P+  +IA+L EAL ++  EQ +L+A   R    NE   +R
Sbjct  162  DVHAAHFTYYDQHAKDEHFAPLLEQIAKLEEALFNIQFEQHWLEAETDRQAIVNEGMSRR  221

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                 + E   L   S LQVV ++RLF + +  +RV
Sbjct  222  ATHKALVESGALIGVSILQVVLLKRLFERKLGSSRV  257



>ref|XP_009793108.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Nicotiana sylvestris]
Length=212

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 75/153 (49%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +H  +    +K +F A   G+Y+FCF N     ET+ F +H
Sbjct  60   WHYSEEGVDLVVKGPSGEQIHDFRDKISEKTEFVAHHEGVYRFCFTNKSPYHETIDFDLH  119

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
              H       AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   KR ++
Sbjct  120  AAHFVYHDEHAKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAVY  179

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L   S LQV  ++ LF + +  +RV
Sbjct  180  KALFESSALICVSILQVFLLKHLFERKLGQSRV  212



>ref|XP_006344897.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006344898.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X2 [Solanum tuberosum]
Length=215

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 77/153 (50%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+  + G+D  V  P    +H ++    +K +F +   G+Y+FCF N     ET+ F +H
Sbjct  63   WHHSNDGVDLVVKGPSGEQIHDLRDKISEKSEFTSHHEGIYRFCFTNKSPYHETIDFDLH  122

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
              H       AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   KR ++
Sbjct  123  AAHFVYHDEHAKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAMY  182

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L   S LQV  ++ LF + +  +RV
Sbjct  183  KALFESSALICVSFLQVFLLKHLFERKLGQSRV  215



>ref|XP_007020468.1| Emp24/gp25L/p24 family/GOLD family protein [Theobroma cacao]
 gb|EOY11993.1| Emp24/gp25L/p24 family/GOLD family protein [Theobroma cacao]
Length=224

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 86/168 (51%), Gaps = 12/168 (7%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHS-MKGTSGD-----------KFDFKAPRSGMYKFCF  567
            D  W+S   G+D  V        +  +KG +GD           KF+F A + G+++FCF
Sbjct  57   DSTWHSSDEGVDLVVAIELATCCNCQVKGPTGDQIQDYRDKISEKFEFVAHQKGVHRFCF  116

Query  566  HNPYSTPETVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDA  387
             N     ETV F +H  H       AKDEH +P+  +I++L EAL ++  EQ +L+A+  
Sbjct  117  SNKSPYYETVDFDVHESHFTYYDQHAKDEHFNPLLEQISKLEEALYNIQFEQHWLEAQTE  176

Query  386  RHRHTNESTRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            R    NE+  KR +   + E   L  AS LQV  +RRLF + +  +RV
Sbjct  177  RQAIVNEAMSKRAVHKAIYESAALIGASVLQVYLLRRLFERKLGMSRV  224



>ref|XP_002737710.1| PREDICTED: transmembrane emp24 domain-containing protein 2-like 
isoform 1 [Saccoglossus kowalevskii]
Length=203

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -3

Query  680  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYST--PETVSFYIHVGHIP  507
            ID  +T P   V++S +  S  K+ F A   G+YK+CF N  ST  P+ V F + VG  P
Sbjct  59   IDVKITGPDGKVIYSGERESNGKYTFAAHMDGVYKYCFSNKMSTMTPKIVMFSMDVGDSP  118

Query  506  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  327
               ++  D   D ++  + EL  AL+ V  EQ+Y++ R+  HR  N++T  RV+ ++  E
Sbjct  119  KGSDMDTDAQQDKLDDMVGELTTALKGVKREQEYMEVREKLHRMINDNTNSRVVLWSFFE  178

Query  326  YILLALASSLQVVYIRRLF  270
             ++L   +  QV Y++R F
Sbjct  179  SLVLVAMTLGQVYYLKRFF  197



>dbj|GAA94318.1| hypothetical protein E5Q_00967 [Mixia osmundae IAM 14324]
 gb|KEI37467.1| hypothetical protein L969DRAFT_78613 [Mixia osmundae IAM 14324]
Length=232

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 82/143 (57%), Gaps = 9/143 (6%)
 Frame = -3

Query  689  HPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTP--ETVSFYIH-V  519
            H  IDF +T P +NV+++        +DF A + G Y +CF N  ST   +TVSF +H V
Sbjct  89   HIDIDFEMTDPDENVMYANTKQDTGSYDFVAFKDGRYTYCFSNKMSTVAVKTVSFNVHGV  148

Query  518  GHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFY  339
             ++ +      D H  PI  +I  L  ALE+V  EQ+Y+  R+  HR+T EST  RV ++
Sbjct  149  MYVED------DGHTAPIEKEIRALANALEAVKDEQEYIVVRERLHRNTAESTNDRVKYW  202

Query  338  TVGEYILLALASSLQVVYIRRLF  270
            +  + +LLA+  + Q+ Y++R F
Sbjct  203  SFAQMLLLAVVCAWQIYYLKRFF  225



>ref|XP_003286220.1| hypothetical protein DICPUDRAFT_150161 [Dictyostelium purpureum]
 gb|EGC37250.1| hypothetical protein DICPUDRAFT_150161 [Dictyostelium purpureum]
Length=205

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 78/140 (56%), Gaps = 4/140 (3%)
 Frame = -3

Query  680  IDFTVTSPGDNVVHSM-KGTSGDKFDFKAPRSGMYKFCFHNPYS--TPETVSFYIHVGHI  510
            IDFT+ SP   +V+   + T G K   ++  +G+Y FCF N  S  T +TVSF + VG  
Sbjct  61   IDFTIISPDKRIVYQGHRETEGTK-TLRSSFAGIYSFCFSNKMSSLTDKTVSFMLSVGEN  119

Query  509  PNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVG  330
                 LAK   L PI   I  L + +  V +EQ Y + R+A HR+T EST  RV+++++ 
Sbjct  120  SPIRELAKKNDLTPIERSIMTLSDGVTGVRNEQNYFRMREAAHRNTAESTNSRVLWWSIF  179

Query  329  EYILLALASSLQVVYIRRLF  270
            E  +L   S  Q+ Y+RR F
Sbjct  180  EACVLVSLSIWQIYYLRRFF  199



>gb|EAZ45308.1| hypothetical protein OsJ_29951 [Oryza sativa Japonica Group]
Length=211

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 78/153 (51%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  N +H  +    DKF+F   R G+++FCF N     ETV F + 
Sbjct  59   WHYTEDGVDLVVRDPNGNQIHDSRDKISDKFEFIVHRRGVHRFCFTNKSPYHETVDFDVL  118

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            V H       AKDEH   +  +IA+L EAL ++  EQ +L+A+  R    NE+  +R + 
Sbjct  119  VSHFSYYDQHAKDEHFSALFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVH  178

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                E   L  AS +QV  + RLF + +  +RV
Sbjct  179  KAFFESAALIAASVVQVYLLHRLFERKLGTSRV  211



>ref|XP_003600347.1| Transmembrane emp24 domain-containing protein [Medicago truncatula]
 gb|AES70598.1| emp24/gp25L/p24 family/GOLD protein [Medicago truncatula]
Length=210

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 76/152 (50%), Gaps = 0/152 (0%)
 Frame = -3

Query  710  DIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSF  531
            D  W+    G+D TV  P  + +   +  + +KFDF A   G Y+FCF N     E + F
Sbjct  58   DSTWHLTQEGLDLTVRGPNGDQIREFRDKTSEKFDFVAHTKGPYRFCFTNKSPYREKIDF  117

Query  530  YIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKR  351
             +H  H       A+DEH  P+  +I +L EAL ++  EQ +L+A+  R    N +   R
Sbjct  118  DVHSNHFSTFEQHAQDEHFTPMLDQIIKLEEALFNIQYEQHWLEAQTERQSIVNNAMSSR  177

Query  350  VIFYTVGEYILLALASSLQVVYIRRLFSKSVA  255
             I   + E   L  AS+LQV  +RRLF + + 
Sbjct  178  AIHKALLESAALIGASTLQVYLLRRLFERKLG  209



>ref|XP_002532207.1| coated vesicle membrane protein, putative [Ricinus communis]
 gb|EEF30176.1| coated vesicle membrane protein, putative [Ricinus communis]
Length=211

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 79/147 (54%), Gaps = 0/147 (0%)
 Frame = -3

Query  683  GIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPN  504
            G+D  +  P    +H +   + +K++F   + G+Y+FCF N      T+ F +H+GH   
Sbjct  65   GVDLLIKGPSGEKLHDLHDKTSEKYEFVVYKKGLYQFCFTNKSPFLITIDFDVHLGHFTY  124

Query  503  EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEY  324
                AKDEH  P+  +I+ L+EAL ++  EQ +L+A   R    N++  +R +   + E 
Sbjct  125  HDQHAKDEHFAPLLKQISRLQEALYNIQFEQHWLEAETDRQAIVNDNMSRRALHKAMLES  184

Query  323  ILLALASSLQVVYIRRLFSKSVAYNRV  243
              L  AS LQ+  +RRLF + +  +RV
Sbjct  185  AALVGASVLQMYLMRRLFDRKLGISRV  211



>gb|KFM70595.1| Transmembrane emp24 domain-containing protein 2, partial [Stegodyphus 
mimosarum]
Length=207

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 72/139 (52%), Gaps = 2/139 (1%)
 Frame = -3

Query  680  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYST--PETVSFYIHVGHIP  507
            ID  +T P   V++  +  S  K+ F A   G+Y +CF N  ST  P+ V F + +G  P
Sbjct  63   IDVKITGPDGKVIYQGERESNGKYTFAAHTDGVYTYCFSNAMSTMTPKIVMFSMDIGEAP  122

Query  506  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  327
              H+   + H + +   I EL  +L SV  EQ+Y+  RD  HR  NEST  RV+ +   E
Sbjct  123  KGHDAEAEAHQNKLEEMIKELSTSLTSVKHEQEYMAVRDRIHRAINESTNSRVVLWAFFE  182

Query  326  YILLALASSLQVVYIRRLF  270
              +L   +  QV Y+RR F
Sbjct  183  AAVLVAMTVGQVYYLRRFF  201



>ref|XP_009624028.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Nicotiana tomentosiformis]
Length=210

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 77/151 (51%), Gaps = 1/151 (1%)
 Frame = -3

Query  695  SDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVG  516
            S+  G+D  V  P    +H ++    +K +F A   G+Y+FCF N     ETV F +H  
Sbjct  61   SEEEGVDLVVKGPSGEQIHDLRDKISEKSEFVAHHEGIYRFCFTNKSPYHETVDFDLHAA  120

Query  515  HIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYT  336
            H       AKDEH  P+   I +L EAL ++  EQ +L+A+  R    NE   KR ++  
Sbjct  121  HFVYHDEHAKDEHFKPLFEHIGKLEEALYNIQFEQHWLEAQTDRQAIVNEGMSKRAVYKA  180

Query  335  VGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
            + E   L   S LQ V+++ LF + +  +RV
Sbjct  181  LFESSALICVSFLQ-VFLKNLFERKLGQSRV  210



>ref|XP_008462127.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Cucumis melo]
Length=173

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 77/142 (54%), Gaps = 0/142 (0%)
 Frame = -3

Query  668  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  489
            +  P    +H  +  + +K +F A   G+++FCF N     ET+ F +HVGH       A
Sbjct  32   IKGPTGEHLHDFRDKTSEKHEFIAHNKGLHRFCFTNKSPYHETIDFDVHVGHFSYHEQHA  91

Query  488  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  309
            KDEH +P+  +I++L EAL ++  EQ +L+A+  R    N+   KR I   + E   L  
Sbjct  92   KDEHFNPLMDQISKLEEALYNIQFEQHWLEAQTDRQAIVNDGMSKRAIHKAMFESAALVG  151

Query  308  ASSLQVVYIRRLFSKSVAYNRV  243
            AS LQV  ++RLF + +  +RV
Sbjct  152  ASVLQVYLLQRLFERKLGTSRV  173



>dbj|BAA75463.1| COP-coated vesicle membrane protein P24 homolog [Polysphondylium 
pallidum]
Length=206

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 81/141 (57%), Gaps = 5/141 (4%)
 Frame = -3

Query  680  IDFTVTSPGDNVVH-SMKGTSGDKFDFKAPRSGMYKFCFHNPYS--TPETVSFYIHVGHI  510
            IDF + SP   V++   + T G K   K+  +G+Y FCF N  S  T +TVSF I VG  
Sbjct  61   IDFMIISPDKRVLYKGQRETEGTKV-MKSNFAGVYSFCFSNQMSSLTEKTVSFMILVGEQ  119

Query  509  PN-EHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTV  333
                 +LA    +  +  +I  L + +++V SEQ Y + R+A HR+T EST  RV+++++
Sbjct  120  STITQDLATKGQMPQLESQIMALADGVQAVKSEQYYFRMREATHRNTAESTNSRVVWWSI  179

Query  332  GEYILLALASSLQVVYIRRLF  270
             E ++L   S+ Q+ Y+RR F
Sbjct  180  FEALILVAMSAWQIYYLRRFF  200



>ref|XP_010063253.1| PREDICTED: cellulose synthase-like protein E1 isoform X2 [Eucalyptus 
grandis]
Length=956

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 0/159 (0%)
 Frame = -3

Query  719  VDHDIFWNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPET  540
            +  D  W+    G+D  V  P    +        +KF+F A   G+++FCF N     ET
Sbjct  798  IKSDSSWHYSQEGVDLVVKGPSGEQIQDFHDKISEKFEFVAHHKGVHRFCFTNKSPYHET  857

Query  539  VSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNEST  360
            + F +HVGH       AKDEH +P+  +I +L EAL ++  EQ +L+A   R    N++ 
Sbjct  858  IDFDVHVGHFTFYDQHAKDEHFNPLLEQIGKLEEALYNIQFEQHWLEAETERQAIVNDAM  917

Query  359  RKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
             +R +     E   L  AS LQV  +RRLF + +  +RV
Sbjct  918  SRRAVHKAFFESAALIGASVLQVYLLRRLFERKLGISRV  956



>ref|XP_002737711.1| PREDICTED: transmembrane emp24 domain-containing protein 2-like 
isoform 2 [Saccoglossus kowalevskii]
Length=203

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 77/139 (55%), Gaps = 2/139 (1%)
 Frame = -3

Query  680  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYST--PETVSFYIHVGHIP  507
            ID  +T P   V++S +  S  K+ F A   G+YK+CF N  ST  P+ V F + VG  P
Sbjct  59   IDVKITGPDGKVIYSGERESNGKYTFAAHMDGVYKYCFSNKMSTMTPKIVMFSMDVGDSP  118

Query  506  NEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGE  327
               ++  DEH + +   + EL  AL  V  EQ+Y++ R+  HR  N++T  RV+ ++  E
Sbjct  119  KGSDMDTDEHHNKLEEMVNELATALTGVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFE  178

Query  326  YILLALASSLQVVYIRRLF  270
             ++L   +  QV Y++R F
Sbjct  179  SLVLVAMTLGQVYYLKRFF  197



>ref|XP_010033500.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW53170.1| hypothetical protein EUGRSUZ_J02451 [Eucalyptus grandis]
Length=142

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 76/142 (54%), Gaps = 11/142 (8%)
 Frame = -3

Query  635  MKGTSGD-----------KFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  489
            MKG SG+           KF+F A   G+++FCF N     ET+ F +HVGH       A
Sbjct  1    MKGPSGEQIQDFHDKISEKFEFVAHHKGVHRFCFTNKSHYHETIDFDVHVGHFTFYDQHA  60

Query  488  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  309
            KDEH +P+  +I +L EAL ++  EQ +L+A   R    N++  +R +     E   L  
Sbjct  61   KDEHFNPLLEQIGKLEEALYNIQFEQNWLEAETERQAIVNDAMSRRAVHKAFFESAALIG  120

Query  308  ASSLQVVYIRRLFSKSVAYNRV  243
            AS LQV  +RRLF + + ++RV
Sbjct  121  ASVLQVYLLRRLFERKLGFSRV  142



>ref|XP_006352045.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Solanum tuberosum]
Length=207

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 83/160 (52%), Gaps = 1/160 (1%)
 Frame = -3

Query  719  VDHDIFWNS-DHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPE  543
            +  D  W+S +  G+D  +  P   ++H  +  + +K++F A + G+Y+FCF N     E
Sbjct  48   IQADTPWHSANKGGVDLMIKGPSGELIHGFRDKTSEKYEFVAYKKGIYQFCFTNKSPYHE  107

Query  542  TVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNES  363
            T+ F + V H       AK+EH DP+  ++++L  AL ++  EQ +L+A  AR    NE 
Sbjct  108  TLEFDVQVVHYTYYDQHAKNEHFDPLLDQLSKLEAALYNIQFEQHWLEAHTARQALLNEG  167

Query  362  TRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              +R I   + E + L     LQV  ++RLF   +   RV
Sbjct  168  MSQRAITKALLESVTLVGVCFLQVFLLQRLFENKLQTVRV  207



>ref|XP_004303575.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2 
[Fragaria vesca subsp. vesca]
Length=209

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 77/153 (50%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P    +H ++  + +KF+F   ++G++ FCF N     ET+ F +H
Sbjct  57   WHYTQDGVDLVVKGPSGEQLHDIRDKTSEKFEFVVQKAGVHHFCFTNKSPYHETIDFDVH  116

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
              H       AKDEH  P+  +I +L EA+ ++  EQ +L+A   R    NE   +R   
Sbjct  117  SAHFTYYDEHAKDEHFKPLFEQIQKLEEAIFNIQFEQHWLEAETDRQAILNEGMSRRATH  176

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
              + E   L   S LQV  ++RLF + +  +RV
Sbjct  177  KAMFESAALIGTSFLQVFLLKRLFERKLGSSRV  209



>dbj|BAK05139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=181

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -3

Query  680  IDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNE  501
            IDFTVTS G N V+++KG SG+KF+F APR G YKFCFH+PY  PETVSFY+H G     
Sbjct  28   IDFTVTSRGGNTVYTLKGISGEKFEFNAPRGGTYKFCFHSPYGAPETVSFYVHDG-----  82

Query  500  HNLAKDEHL  474
             NL ++E L
Sbjct  83   RNLVREEAL  91



>ref|XP_008357987.1| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like, 
partial [Malus domestica]
Length=155

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 0/142 (0%)
 Frame = -3

Query  668  VTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHNLA  489
            +  PG   +H ++G + +K++      G+++FCF N     ET+ F +H  H       A
Sbjct  14   IKGPGGEQIHDIRGKTSEKYELVVQNQGVHQFCFTNKSPYHETIDFDVHAAHFTYHDQHA  73

Query  488  KDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIFYTVGEYILLAL  309
            KDEH  P+  +I +L EAL ++  EQ +L+A   R    NE   +R     + E   L  
Sbjct  74   KDEHFTPLLEQIQKLEEALYNIQFEQHWLEAETDRQAIVNEGMSRRATHKALIESAALIG  133

Query  308  ASSLQVVYIRRLFSKSVAYNRV  243
            AS LQV  ++RLF + +  +RV
Sbjct  134  ASCLQVFLLKRLFERKLGSSRV  155



>gb|EAZ09689.1| hypothetical protein OsI_31972 [Oryza sativa Indica Group]
Length=211

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 77/153 (50%), Gaps = 0/153 (0%)
 Frame = -3

Query  701  WNSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPETVSFYIH  522
            W+    G+D  V  P  N +H  +    DKF+F   R G+++FCF N     ETV F + 
Sbjct  59   WHYTEDGVDLVVRDPNGNQIHDSRDKISDKFEFIVHRRGVHRFCFTNKSPYHETVDFDVL  118

Query  521  VGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNESTRKRVIF  342
            V H       AKDEH   +  +IA+L EAL ++  EQ +L+A+  R    NE+  +R + 
Sbjct  119  VSHFSYYDQHAKDEHFSALFEQIAKLDEALYNIQFEQHWLEAQTDRQAILNENMSRRAVH  178

Query  341  YTVGEYILLALASSLQVVYIRRLFSKSVAYNRV  243
                E   L  AS +QV  +  LF + +  +RV
Sbjct  179  KAFFESAALIAASVVQVYLLHLLFERKLGTSRV  211



>ref|XP_004252039.2| PREDICTED: transmembrane emp24 domain-containing protein p24beta2-like 
[Solanum lycopersicum]
Length=277

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 82/158 (52%), Gaps = 1/158 (1%)
 Frame = -3

Query  719  VDHDIFW-NSDHPGIDFTVTSPGDNVVHSMKGTSGDKFDFKAPRSGMYKFCFHNPYSTPE  543
            +  D  W +S+  G+D  +  P   ++H  +  + +K++F A + G+Y+FCF N     E
Sbjct  48   IKADTPWHSSNEGGVDLMIKGPSGELIHGFRDKTSEKYEFVAYKKGIYQFCFTNKSPYHE  107

Query  542  TVSFYIHVGHIPNEHNLAKDEHLDPINVKIAELREALESVTSEQKYLKARDARHRHTNES  363
            T+ F + V H       AK+EH DP+   I++L  AL ++  EQ +L+A+ AR    NE 
Sbjct  108  TLDFDVQVVHYAYYDQHAKNEHFDPLLDHISKLEAALYNIQFEQHWLEAQTARQASLNEG  167

Query  362  TRKRVIFYTVGEYILLALASSLQVVYIRRLFSKSVAYN  249
              +R I   + E + L     LQV  ++RLF   +  N
Sbjct  168  MSQRAITKALLESVTLIGVCFLQVFLLQRLFENKLQKN  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425