BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF020A10

Length=785
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008353771.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    323   9e-107   
gb|KDP31760.1|  hypothetical protein JCGZ_12221                         326   3e-103   Jatropha curcas
ref|XP_002525155.1|  acyl-CoA oxidase, putative                         323   1e-102   
ref|NP_001280826.1|  acyl-coenzyme A oxidase 3, peroxisomal-like        322   9e-102   Malus domestica [apple tree]
ref|XP_002325591.1|  acyl-CoA oxidase family protein                    321   3e-101   
ref|XP_011002667.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    319   2e-100   Populus euphratica
ref|XP_009354288.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    318   4e-100   Pyrus x bretschneideri [bai li]
ref|XP_007213791.1|  hypothetical protein PRUPE_ppa002439m2g            313   5e-100   
ref|XP_008244854.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    316   2e-99    Prunus mume [ume]
ref|XP_004248184.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    316   3e-99    Solanum lycopersicum
ref|XP_004248185.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    316   4e-99    Solanum lycopersicum
emb|CDP15892.1|  unnamed protein product                                315   5e-99    Coffea canephora [robusta coffee]
emb|CBI21935.3|  unnamed protein product                                312   5e-99    Vitis vinifera
ref|XP_006376402.1|  acyl-CoA oxidase family protein                    314   1e-98    
ref|XP_006364108.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    315   1e-98    Solanum tuberosum [potatoes]
ref|XP_004303096.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    314   2e-98    Fragaria vesca subsp. vesca
ref|XP_006364109.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    314   2e-98    Solanum tuberosum [potatoes]
gb|AFQ93695.1|  acyl-CoA oxidase 3                                      313   3e-98    Prunus persica
ref|XP_011037432.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    308   5e-98    Populus euphratica
ref|XP_006469060.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    311   2e-97    Citrus sinensis [apfelsine]
ref|XP_002278663.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    311   2e-97    Vitis vinifera
ref|XP_009621612.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    311   2e-97    Nicotiana tomentosiformis
ref|XP_009621605.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    311   2e-97    Nicotiana tomentosiformis
ref|XP_009621600.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    311   3e-97    Nicotiana tomentosiformis
ref|XP_009783429.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    310   7e-97    Nicotiana sylvestris
ref|XP_006446734.1|  hypothetical protein CICLE_v10014502mg             310   7e-97    Citrus clementina [clementine]
ref|XP_009783430.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    310   8e-97    Nicotiana sylvestris
ref|XP_009783428.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    310   9e-97    Nicotiana sylvestris
ref|XP_007043726.1|  Acyl-CoA oxidase 3 isoform 2                       309   1e-96    
ref|XP_007043725.1|  Acyl-CoA oxidase 3 isoform 1                       309   2e-96    
ref|XP_011013710.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    308   2e-96    Populus euphratica
ref|XP_003607535.1|  Acyl-coenzyme A oxidase 3, peroxisomal             308   4e-96    Medicago truncatula
gb|KJB50145.1|  hypothetical protein B456_008G155500                    303   9e-96    Gossypium raimondii
gb|EYU29818.1|  hypothetical protein MIMGU_mgv1a002427mg                305   3e-95    Erythranthe guttata [common monkey flower]
gb|KHN07770.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  304   3e-95    Glycine soja [wild soybean]
ref|XP_003527400.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    304   1e-94    Glycine max [soybeans]
ref|XP_006592447.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    301   2e-94    
ref|XP_010093490.1|  Acyl-coenzyme A oxidase 3                          303   3e-94    
ref|XP_011100229.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    303   4e-94    Sesamum indicum [beniseed]
gb|AAF82159.1|AC068143_1  Contains similarity to an acyl-CoA oxid...    295   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358246.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-coenzym...    292   7e-94    
gb|KJB50144.1|  hypothetical protein B456_008G155500                    301   8e-94    Gossypium raimondii
ref|XP_003539950.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    300   3e-93    Glycine max [soybeans]
ref|XP_004505527.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    299   7e-93    Cicer arietinum [garbanzo]
ref|XP_004151905.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    298   2e-92    Cucumis sativus [cucumbers]
ref|XP_004171897.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    298   3e-92    
ref|XP_010279215.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    296   9e-92    Nelumbo nucifera [Indian lotus]
gb|KHG13766.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    295   2e-91    Gossypium arboreum [tree cotton]
gb|EMS62188.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  285   3e-91    Triticum urartu
ref|XP_010035824.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    294   7e-91    Eucalyptus grandis [rose gum]
gb|KCW47289.1|  hypothetical protein EUGRSUZ_K01080                     294   7e-91    Eucalyptus grandis [rose gum]
ref|XP_007132685.1|  hypothetical protein PHAVU_011G116000g             294   9e-91    Phaseolus vulgaris [French bean]
gb|AAF73843.1|AF207994_1  acyl-CoA oxidase ACX3                         293   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_172119.1|  acyl-coenzyme A oxidase 3                             293   2e-90    Arabidopsis thaliana [mouse-ear cress]
gb|EPS63701.1|  hypothetical protein M569_11080                         283   3e-90    Genlisea aurea
ref|XP_002889597.1|  acyl-CoA oxidase ACX3                              291   6e-90    
ref|XP_010916040.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    293   8e-90    Elaeis guineensis
ref|XP_010522108.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    291   1e-89    Tarenaya hassleriana [spider flower]
ref|XP_008455941.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    290   2e-89    Cucumis melo [Oriental melon]
gb|KJB31620.1|  hypothetical protein B456_005G198300                    288   2e-88    Gossypium raimondii
ref|XP_008784451.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    288   2e-88    Phoenix dactylifera
ref|NP_001057591.1|  Os06g0354500                                       288   2e-88    
gb|EAZ00875.1|  hypothetical protein OsI_22900                          288   3e-88    Oryza sativa Indica Group [Indian rice]
gb|EAZ36947.1|  hypothetical protein OsJ_21282                          288   3e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011013714.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    286   3e-88    Populus euphratica
ref|XP_009405080.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    287   3e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006306351.1|  hypothetical protein CARUB_v10012245mg             287   4e-88    Capsella rubella
emb|CDY10192.1|  BnaC05g04350D                                          286   6e-88    Brassica napus [oilseed rape]
ref|XP_006417937.1|  hypothetical protein EUTSA_v10006988mg             286   9e-88    Eutrema salsugineum [saltwater cress]
ref|XP_010485961.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    284   1e-87    Camelina sativa [gold-of-pleasure]
ref|XP_009119069.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    285   1e-87    Brassica rapa
ref|XP_010475360.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    285   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010457756.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    284   3e-87    Camelina sativa [gold-of-pleasure]
gb|KFK42952.1|  hypothetical protein AALP_AA1G060500                    284   4e-87    Arabis alpina [alpine rockcress]
ref|XP_006417936.1|  hypothetical protein EUTSA_v10009440mg             283   4e-87    
ref|XP_006656066.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    283   7e-87    
gb|EMT28672.1|  Acyl-coenzyme A oxidase 3, peroxisomal                  281   8e-87    
gb|KHG26832.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    283   1e-86    Gossypium arboreum [tree cotton]
gb|KJB12478.1|  hypothetical protein B456_002G020600                    283   1e-86    Gossypium raimondii
ref|XP_010689759.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    283   1e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010689760.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    282   2e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010689758.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    282   4e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_172120.2|  putative acyl-CoA oxidase                             280   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003573815.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    280   2e-85    Brachypodium distachyon [annual false brome]
ref|XP_009388733.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    279   5e-85    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11955.1|  Acyl-coenzyme A oxidase 3, peroxisomal -like protein    275   1e-83    Gossypium arboreum [tree cotton]
ref|XP_002889598.1|  acyl-CoA oxidase 6                                 275   2e-83    Arabidopsis lyrata subsp. lyrata
ref|XP_004965421.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    274   3e-83    Setaria italica
ref|XP_006852548.1|  hypothetical protein AMTR_s00021p00193270          273   8e-83    Amborella trichopoda
gb|KJB12486.1|  hypothetical protein B456_002G020700                    272   1e-82    Gossypium raimondii
ref|XP_002456627.1|  hypothetical protein SORBIDRAFT_03g039670          272   3e-82    Sorghum bicolor [broomcorn]
emb|CDY10194.1|  BnaC05g04370D                                          270   6e-82    Brassica napus [oilseed rape]
ref|XP_009119067.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    270   9e-82    Brassica rapa
emb|CDY57822.1|  BnaA10g28090D                                          270   1e-81    Brassica napus [oilseed rape]
ref|NP_001152024.1|  acyl-coenzyme A oxidase 2                          270   2e-81    Zea mays [maize]
tpg|DAA56859.1|  TPA: putative acyl-CoA oxidase family protein          270   2e-81    
gb|AGT17248.1|  acyl-coenzyme A oxidase                                 268   4e-81    Saccharum hybrid cultivar R570
gb|ACN41105.1|  unknown                                                 249   6e-74    Picea sitchensis
ref|XP_007043727.1|  Acyl-CoA oxidase 3 isoform 3                       248   8e-74    
ref|NP_187325.4|  putative acyl-coenzyme A oxidase                      221   3e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002994091.1|  hypothetical protein SELMODRAFT_187751             208   1e-58    
ref|XP_002985513.1|  hypothetical protein SELMODRAFT_122536             204   3e-57    
ref|XP_001772379.1|  predicted protein                                  204   3e-57    
ref|XP_011466939.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...    197   1e-54    Fragaria vesca subsp. vesca
ref|XP_001759376.1|  predicted protein                                  195   1e-53    
emb|CDY57819.1|  BnaA10g28070D                                          176   5e-50    Brassica napus [oilseed rape]
ref|XP_010038681.1|  PREDICTED: putative acyl-coenzyme A oxidase ...    169   1e-48    
emb|CBI36628.3|  unnamed protein product                                146   5e-40    Vitis vinifera
emb|CAN66151.1|  hypothetical protein VITISV_035129                     145   9e-38    Vitis vinifera
gb|AAG50996.1|AC036106_9  unknown protein; 4820-5433                    135   3e-36    Arabidopsis thaliana [mouse-ear cress]
emb|CAN66343.1|  hypothetical protein VITISV_040587                     117   2e-29    Vitis vinifera
emb|CAN77404.1|  hypothetical protein VITISV_009474                     115   6e-29    Vitis vinifera
emb|CBI39134.3|  unnamed protein product                                113   7e-28    Vitis vinifera
gb|AAF63829.1|  hypothetical protein                                    112   1e-27    Arabidopsis thaliana [mouse-ear cress]
emb|CDP21363.1|  unnamed protein product                                108   2e-26    Coffea canephora [robusta coffee]
ref|XP_005712269.1|  unnamed protein product                            114   8e-25    Chondrus crispus [carageen]
ref|XP_005707013.1|  acyl-CoA oxidase isoform 1                         113   1e-24    Galdieria sulphuraria
ref|XP_005703885.1|  acyl-CoA oxidase                                   106   2e-22    Galdieria sulphuraria
emb|CBI24556.3|  unnamed protein product                              96.3    1e-21    Vitis vinifera
emb|CBI31502.3|  unnamed protein product                              96.3    1e-21    Vitis vinifera
ref|XP_005712968.1|  acyl-CoA oxidase                                   103   2e-21    Chondrus crispus [carageen]
ref|XP_005712270.1|  acyl-CoA oxidase                                   100   4e-20    Chondrus crispus [carageen]
ref|XP_005716306.1|  acyl-CoA oxidase                                 97.4    3e-19    Chondrus crispus [carageen]
ref|WP_020534466.1|  hypothetical protein                             97.4    4e-19    Lewinella cohaerens
ref|WP_026707256.1|  acyl-CoA oxidase                                 96.7    6e-19    Flavobacterium frigidarium
gb|AEW08613.1|  hypothetical protein CL814Contig1_06                  87.4    2e-18    Pinus radiata
ref|WP_022834726.1|  acyl-CoA oxidase                                 93.6    7e-18    Salisaeta longa
ref|WP_015352554.1|  acyl-CoA dehydrogenase                           93.6    8e-18    Myxococcus stipitatus
gb|KJB12480.1|  hypothetical protein B456_002G020600                  91.7    2e-17    Gossypium raimondii
ref|WP_011404446.1|  acyl-CoA oxidase                                 92.4    2e-17    Salinibacter ruber
ref|WP_013062161.1|  acyl-CoA oxidase                                 92.0    3e-17    Salinibacter ruber
ref|WP_043324301.1|  acyl-CoA oxidase                                 91.7    3e-17    
ref|WP_043716325.1|  acyl-CoA oxidase                                 91.3    4e-17    Kutzneria sp. 744
gb|AFE09438.1|  putative acyl-CoA dehydrogenase                       91.3    4e-17    Corallococcus coralloides DSM 2259
ref|WP_006946147.1|  acyl-CoA oxidase                                 91.3    4e-17    Dermacoccus
ref|WP_038570380.1|  acyl-CoA oxidase                                 90.9    4e-17    Dermacoccus nishinomiyaensis
ref|XP_004365565.1|  acyl-coenzyme A oxidase 3                        90.9    6e-17    Capsaspora owczarzaki ATCC 30864
gb|AAB97825.1|  acyl-CoA oxidase                                      89.4    7e-17    Myxococcus xanthus DK 1622
ref|WP_033441505.1|  acyl-CoA oxidase                                 89.4    1e-16    
ref|WP_016988806.1|  acyl-CoA oxidase                                 89.4    2e-16    Flavobacterium sp. ACAM 123
ref|WP_008611975.1|  acyl-CoA oxidase                                 89.4    2e-16    Joostella marina
gb|ABF87186.1|  putative acyl-CoA dehydrogenase                       88.6    2e-16    Myxococcus xanthus DK 1622
ref|WP_017497064.1|  acyl-CoA oxidase                                 89.0    2e-16    Flavobacterium sp. WG21
ref|WP_005440921.1|  acyl-CoA oxidase                                 88.2    3e-16    Saccharomonospora azurea
ref|WP_020478009.1|  acyl-CoA dehydrogenase                           88.2    5e-16    Myxococcus xanthus
ref|WP_033431876.1|  acyl-CoA oxidase                                 87.8    5e-16    Saccharothrix syringae
ref|XP_003294150.1|  hypothetical protein DICPUDRAFT_58874            87.8    5e-16    Dictyostelium purpureum
ref|WP_025744009.1|  acyl-CoA oxidase                                 87.8    6e-16    Aquimarina pacifica
ref|WP_040407217.1|  acyl-CoA oxidase                                 87.4    6e-16    
ref|WP_040459667.1|  acyl-CoA oxidase                                 87.4    7e-16    
gb|EKF56589.1|  acyl-CoA oxidase                                      87.4    7e-16    Galbibacter marinus
ref|WP_026812503.1|  acyl-CoA oxidase                                 87.4    7e-16    Arenibacter certesii
ref|WP_002637005.1|  acyl-CoA dehydrogenase                           86.7    1e-15    Myxococcus hansupus
ref|WP_042180408.1|  acyl-CoA oxidase                                 86.3    2e-15    Kibdelosporangium sp. MJ126-NF4
ref|WP_013937938.1|  acyl-CoA dehydrogenase                           85.5    3e-15    Myxococcus macrosporus
ref|WP_013154234.1|  acyl-CoA oxidase                                 85.5    3e-15    Nocardiopsis dassonvillei
ref|WP_019609734.1|  acyl-CoA oxidase                                 85.5    3e-15    Nocardiopsis sp. CNS-639
ref|WP_024874955.1|  acyl-CoA oxidase                                 85.1    3e-15    Saccharomonospora sp. CNQ490
ref|WP_042564417.1|  acyl-CoA oxidase                                 85.1    4e-15    Flavobacterium sp. MEB061
ref|WP_039751994.1|  acyl-CoA oxidase                                 85.1    4e-15    
ref|WP_036151893.1|  acyl-CoA oxidase                                 84.7    5e-15    Maribacter forsetii
ref|WP_026985441.1|  acyl-CoA oxidase                                 84.7    5e-15    Flavobacterium sp. URHB0058
ref|WP_044187894.1|  acyl-CoA oxidase                                 84.3    7e-15    Hyalangium minutum
ref|WP_035847687.1|  acyl-CoA oxidase                                 84.0    8e-15    Cryptosporangium arvum
ref|WP_017565178.1|  acyl-CoA oxidase                                 83.6    1e-14    Nocardiopsis synnemataformans
ref|WP_017588837.1|  acyl-CoA oxidase                                 83.6    1e-14    Nocardiopsis ganjiahuensis
ref|WP_035644791.1|  acyl-CoA oxidase                                 83.2    2e-14    Flavobacterium sp. Fl
ref|WP_035680554.1|  acyl-CoA oxidase                                 83.2    2e-14    Flavobacterium reichenbachii
ref|WP_007810516.1|  acyl-CoA oxidase                                 82.8    2e-14    Flavobacterium sp. CF136
ref|WP_035657136.1|  acyl-CoA oxidase                                 82.8    2e-14    Flavobacterium seoulense
ref|WP_042212501.1|  acyl-CoA oxidase                                 82.4    2e-14    
ref|WP_006239330.1|  acyl-CoA oxidase                                 82.4    2e-14    Saccharomonospora xinjiangensis
ref|WP_019809905.1|  acyl-CoA oxidase                                 82.4    3e-14    Saccharomonospora halophila
ref|WP_026810093.1|  acyl-CoA oxidase                                 82.0    4e-14    Arenibacter latericius
ref|WP_015780052.1|  acyl-CoA oxidase                                 82.0    4e-14    Kytococcus sedentarius
ref|WP_033293761.1|  acyl-CoA oxidase                                 81.6    4e-14    Amycolatopsis jejuensis
ref|WP_027064968.1|  acyl-CoA oxidase                                 81.6    5e-14    Maribacter sp. Hel_I_7
ref|WP_026155732.1|  acyl-CoA oxidase                                 81.6    5e-14    
ref|WP_002612916.1|  acyl-CoA dehydrogenase                           81.6    5e-14    Stigmatella aurantiaca
ref|WP_012787563.1|  acyl-CoA oxidase                                 81.3    5e-14    Catenulispora acidiphila
ref|WP_012025377.1|  acyl-CoA oxidase                                 81.6    6e-14    Flavobacterium johnsoniae
dbj|GAM25056.1|  hypothetical protein SAMD00019534_082310             81.3    6e-14    Acytostelium subglobosum LB1
ref|WP_043394213.1|  acyl-CoA oxidase                                 81.6    6e-14    Archangium violaceum
ref|WP_034305416.1|  acyl-CoA oxidase                                 80.9    8e-14    Amycolatopsis lurida
ref|WP_028496686.1|  MULTISPECIES: acyl-CoA dehydrogenase             80.9    8e-14    Microbacterium
ref|WP_031456312.1|  acyl-CoA oxidase                                 80.9    9e-14    Flavobacterium chungangense
ref|WP_030531740.1|  acyl-CoA oxidase                                 80.5    1e-13    Prauserella rugosa
ref|WP_026729518.1|  acyl-CoA oxidase                                 80.9    1e-13    Flavobacterium denitrificans
ref|WP_025104659.1|  acyl-CoA dehydrogenase                           80.5    1e-13    Microbacterium
ref|WP_022925252.1|  acyl-CoA oxidase                                 80.5    1e-13    Serinicoccus marinus
ref|WP_028709678.1|  acyl-CoA oxidase                                 80.1    1e-13    Propionicicella superfundia
ref|WP_007028884.1|  acyl-CoA oxidase domain-containing protein       80.1    1e-13    Amycolatopsis decaplanina
gb|EJG02802.1|  acyl-CoA oxidase                                      80.1    2e-13    Flavobacterium sp. F52
ref|WP_014773637.1|  acyl-CoA oxidase                                 80.1    2e-13    Belliella baltica
ref|WP_026716117.1|  acyl-CoA oxidase                                 80.1    2e-13    Flavobacterium gelidilacus
ref|WP_033229275.1|  acyl-CoA oxidase                                 80.1    2e-13    
ref|WP_035690755.1|  acyl-CoA oxidase                                 80.1    2e-13    Flavobacterium sp. F52
ref|WP_026453893.1|  acyl-CoA oxidase                                 79.7    2e-13    [Actinopolyspora] iraqiensis
ref|WP_007023318.1|  acyl-CoA oxidase                                 79.7    2e-13    Saccharomonospora paurometabolica
ref|WP_017619701.1|  acyl-CoA oxidase                                 79.7    2e-13    Nocardiopsis gilva
ref|WP_037065914.1|  acyl-CoA oxidase                                 79.3    3e-13    
ref|WP_003924602.1|  acyl-CoA oxidase                                 79.3    3e-13    Mycolicibacterium thermoresistibile
ref|WP_044852233.1|  acyl-CoA oxidase                                 79.0    3e-13    Amycolatopsis orientalis
ref|WP_029269714.1|  acyl-CoA oxidase                                 79.3    3e-13    Flavobacterium sp. KJJ
ref|WP_039115718.1|  acyl-CoA oxidase                                 79.0    3e-13    Flavobacterium sp. KMS
ref|WP_027078216.1|  acyl-CoA oxidase                                 79.0    3e-13    Maribacter antarcticus
ref|WP_005168178.1|  Acyl-coenzyme A oxidase 1, peroxisomal           79.0    4e-13    Amycolatopsis azurea
ref|WP_037306481.1|  acyl-CoA oxidase                                 79.0    4e-13    Amycolatopsis orientalis
ref|XP_003293845.1|  hypothetical protein DICPUDRAFT_158763           79.0    4e-13    Dictyostelium purpureum
ref|WP_016693747.1|  hypothetical protein                             77.4    4e-13    
ref|WP_005466173.1|  acyl-CoA oxidase                                 79.0    4e-13    Saccharomonospora glauca
ref|XP_642669.1|  acyl-CoA oxidase                                    78.6    5e-13    Dictyostelium discoideum AX4
ref|WP_038508394.1|  acyl-CoA oxidase                                 78.6    5e-13    Amycolatopsis japonica
ref|WP_013993723.1|  acyl-CoA oxidase                                 78.6    5e-13    Zobellia galactanivorans
ref|WP_037271082.1|  acyl-CoA oxidase                                 78.6    5e-13    Kibdelosporangium aridum
ref|WP_019182355.1|  acyl-CoA dehydrogenase                           78.6    5e-13    Microbacterium yannicii
ref|WP_037816709.1|  acyl-CoA oxidase                                 78.2    5e-13    Streptomyces sp. NRRL F-3213
ref|WP_003080258.1|  acyl-CoA oxidase                                 78.2    5e-13    Amycolatopsis vancoresmycina
ref|WP_034664791.1|  acyl-CoA oxidase                                 78.6    5e-13    
ref|WP_019598670.1|  hypothetical protein                             78.6    6e-13    Rhodonellum
ref|WP_009945757.1|  acyl-CoA oxidase                                 78.2    6e-13    Saccharopolyspora erythraea
ref|WP_037340849.1|  acyl-CoA oxidase                                 78.2    6e-13    Amycolatopsis sp. MJM2582
ref|WP_026126958.1|  acyl-CoA oxidase                                 78.2    6e-13    Nocardiopsis xinjiangensis
ref|WP_020631448.1|  acyl-CoA oxidase                                 78.2    7e-13    Amycolatopsis alba
ref|WP_027391884.1|  acyl-CoA oxidase                                 78.2    7e-13    Aquimarina latercula
ref|WP_029261307.1|  MULTISPECIES: acyl-CoA dehydrogenase             77.8    8e-13    Microbacterium
ref|WP_039400089.1|  acyl-CoA dehydrogenase                           78.2    8e-13    Microbacterium mangrovi
ref|WP_017598018.1|  acyl-CoA oxidase                                 77.8    8e-13    Nocardiopsis lucentensis
ref|WP_038237921.1|  acyl-CoA oxidase                                 78.2    8e-13    Zobellia uliginosa
ref|WP_026468560.1|  acyl-CoA oxidase                                 77.8    8e-13    Amycolatopsis balhimycina
ref|WP_025615938.1|  acyl-CoA oxidase                                 77.8    8e-13    
ref|WP_029450063.1|  acyl-CoA oxidase                                 77.8    8e-13    
ref|WP_006552333.1|  acyl-CoA oxidase                                 77.8    9e-13    Rhodococcus pyridinivorans
ref|WP_040270575.1|  acyl-CoA oxidase                                 77.8    9e-13    Streptomonospora alba
ref|WP_039119472.1|  acyl-CoA oxidase                                 77.8    9e-13    Flavobacterium sp. JRM
ref|WP_029447141.1|  acyl-CoA oxidase                                 77.8    9e-13    
ref|WP_011292662.1|  acyl-CoA oxidase                                 77.8    9e-13    Thermobifida fusca
ref|WP_040168540.1|  acyl-CoA dehydrogenase                           77.8    1e-12    
ref|WP_034248225.1|  acyl-CoA oxidase                                 77.8    1e-12    
ref|WP_016337188.1|  acyl-CoA oxidase                                 77.4    1e-12    Amycolatopsis keratiniphila
ref|WP_017576371.1|  acyl-CoA oxidase                                 77.4    1e-12    Nocardiopsis kunsanensis
ref|WP_036382477.1|  acyl-CoA oxidase                                 77.4    1e-12    Muricauda sp. MAR_2010_75
ref|WP_024481861.1|  acyl-CoA oxidase                                 77.4    1e-12    
ref|WP_015100482.1|  Acyl-CoA oxidase                                 77.4    1e-12    Saccharothrix espanaensis
ref|WP_035694733.1|  acyl-CoA oxidase                                 77.4    1e-12    Flavobacterium soli
ref|WP_017546736.1|  acyl-CoA oxidase                                 77.0    1e-12    Nocardiopsis prasina
ref|WP_036396123.1|  acyl-CoA oxidase                                 77.0    1e-12    Mycolicibacterium cosmeticum
ref|WP_017204343.1|  acyl-CoA dehydrogenase                           77.0    2e-12    Microbacterium
ref|WP_039500185.1|  acyl-CoA oxidase                                 77.0    2e-12    
ref|WP_006241046.1|  acyl-CoA oxidase                                 77.0    2e-12    Mycolicibacterium tusciae
emb|CDO05676.1|  acyl-CoA dehydrogenase domain-containing protein     77.0    2e-12    Mycolicibacterium cosmeticum
ref|WP_029154223.1|  acyl-CoA dehydrogenase                           76.6    2e-12    
ref|WP_037367820.1|  acyl-CoA oxidase                                 76.6    2e-12    Amycolatopsis orientalis
ref|WP_007924190.1|  acyl-CoA oxidase                                 76.6    2e-12    
ref|WP_020097728.1|  acyl-CoA dehydrogenase                           76.6    2e-12    Microbacterium sp. 11MF
ref|WP_033387237.1|  acyl-CoA oxidase                                 76.6    2e-12    
ref|WP_018185822.1|  acyl-CoA dehydrogenase                           76.6    2e-12    Microbacterium
ref|WP_030096915.1|  acyl-CoA oxidase                                 76.6    2e-12    Mycobacteroides
ref|WP_028785613.1|  acyl-CoA oxidase                                 76.3    2e-12    
ref|WP_017605859.1|  acyl-CoA oxidase                                 76.6    2e-12    Nocardiopsis alkaliphila
ref|WP_038676593.1|  acyl-CoA oxidase                                 76.6    2e-12    Pimelobacter simplex
ref|WP_024101715.1|  acyl-CoA oxidase                                 76.3    2e-12    Rhodococcus pyridinivorans
ref|XP_005718655.1|  acyl-CoA oxidase                                 76.3    2e-12    Chondrus crispus [carageen]
ref|WP_017572294.1|  acyl-CoA oxidase                                 76.3    2e-12    Nocardiopsis halotolerans
ref|WP_025239597.1|  acyl-CoA oxidase                                 76.3    2e-12    Mycobacteroides abscessus
ref|WP_041518765.1|  acyl-CoA oxidase                                 76.3    2e-12    Flavobacterium hibernum
ref|WP_035622798.1|  acyl-CoA oxidase                                 76.3    3e-12    Flavobacterium hydatis
ref|WP_019291205.1|  MULTISPECIES: acyl-CoA oxidase                   76.3    3e-12    Rhodococcus
ref|WP_026978660.1|  acyl-CoA oxidase                                 76.3    3e-12    Flavobacterium tegetincola
ref|WP_005080876.1|  acyl-CoA oxidase                                 76.3    3e-12    Mycobacteroides abscessus
ref|WP_043077692.1|  acyl-CoA oxidase                                 76.3    3e-12    Mycobacteroides immunogenum
gb|AIC71572.1|  acyl-CoA oxidase                                      76.3    3e-12    Mycobacteroides abscessus subsp. massiliense str. GO 06
ref|WP_022877289.1|  acyl-CoA dehydrogenase                           76.3    3e-12    Microbacterium sp. B19
ref|WP_022827387.1|  acyl-CoA oxidase                                 76.3    3e-12    Flavobacterium antarcticum
ref|WP_017204937.1|  acyl-CoA oxidase                                 75.9    3e-12    Mycobacteroides abscessus
ref|WP_016343166.1|  putative acyl-CoA oxidase                        75.9    3e-12    Mycobacteroides abscessus
ref|XP_004360487.1|  acyl-CoA oxidase                                 76.3    3e-12    Cavenderia fasciculata
ref|WP_014909212.1|  MULTISPECIES: acyl-CoA oxidase                   75.9    3e-12    Nocardiopsis alba
ref|WP_016888063.1|  acyl-CoA oxidase                                 75.9    3e-12    Mycobacteroides abscessus
ref|WP_005056292.1|  acyl-CoA oxidase                                 75.9    3e-12    
ref|WP_016891967.1|  acyl-CoA oxidase                                 75.9    3e-12    
ref|WP_005077362.1|  acyl-CoA oxidase                                 75.9    3e-12    
ref|WP_005459114.1|  acyl-CoA oxidase                                 75.9    3e-12    
gb|ERJ18395.1|  acyl-CoA oxidase protein                              76.3    3e-12    
ref|WP_005088450.1|  MULTISPECIES: acyl-CoA oxidase                   75.9    3e-12    
ref|WP_043786179.1|  acyl-CoA oxidase                                 75.9    4e-12    
ref|WP_019814246.1|  acyl-CoA oxidase                                 75.9    4e-12    
ref|WP_024455592.1|  acyl-CoA oxidase                                 75.9    4e-12    
ref|WP_043828107.1|  acyl-CoA oxidase                                 75.9    4e-12    
ref|WP_026449386.1|  acyl-CoA oxidase                                 75.9    4e-12    
ref|WP_036310890.1|  acyl-CoA dehydrogenase                           75.9    4e-12    
ref|WP_018524646.1|  MULTISPECIES: acyl-CoA oxidase                   75.9    4e-12    
gb|EMP11646.1|  acyl-CoA dehydrogenase, middle domain protein         75.9    4e-12    
ref|WP_036565630.1|  acyl-CoA oxidase                                 75.9    4e-12    
ref|WP_013229814.1|  acyl-CoA oxidase                                 75.5    4e-12    
ref|WP_010313150.1|  acyl-CoA oxidase                                 75.5    4e-12    
gb|EFA74856.1|  acyl-CoA oxidase                                      75.5    5e-12    
ref|WP_017614281.1|  acyl-CoA oxidase                                 75.5    5e-12    
ref|XP_002672633.1|  peroxisomal acyl-CoA oxidase                     75.5    5e-12    
ref|WP_009183890.1|  acyl-CoA oxidase                                 75.5    5e-12    
ref|WP_018102778.1|  MULTISPECIES: acyl-CoA oxidase                   75.5    5e-12    
ref|WP_042537923.1|  acyl-CoA dehydrogenase                           75.5    6e-12    
ref|WP_030389344.1|  acyl-CoA oxidase                                 75.1    6e-12    
ref|WP_023953010.1|  acyl-CoA dehydrogenase                           75.1    7e-12    
ref|WP_021198474.1|  acyl-CoA dehydrogenase                           75.1    7e-12    
ref|WP_029258888.1|  acyl-CoA dehydrogenase                           75.1    7e-12    
ref|WP_030226700.1|  acyl-CoA oxidase                                 75.1    7e-12    
ref|WP_029266513.1|  acyl-CoA dehydrogenase                           75.1    7e-12    
ref|WP_020664913.1|  acyl-CoA oxidase                                 74.7    7e-12    
ref|WP_036470198.1|  acyl-CoA oxidase                                 74.7    8e-12    
ref|WP_037114191.1|  acyl-CoA oxidase                                 74.7    8e-12    
ref|WP_037185147.1|  acyl-CoA oxidase                                 74.7    8e-12    
ref|WP_020112517.1|  acyl-CoA oxidase                                 74.7    9e-12    
ref|WP_028503193.1|  acyl-CoA dehydrogenase                           74.7    9e-12    
ref|WP_036491874.1|  acyl-CoA oxidase                                 74.7    9e-12    
ref|WP_037662951.1|  acyl-CoA oxidase                                 74.7    9e-12    
ref|WP_033105265.1|  acyl-CoA dehydrogenase                           74.7    9e-12    
ref|WP_019666492.1|  MULTISPECIES: acyl-CoA oxidase                   74.7    9e-12    
gb|EON25586.1|  acyl-CoA oxidase domain-containing protein            74.7    1e-11    
ref|WP_035947609.1|  acyl-CoA oxidase                                 74.3    1e-11    
ref|WP_015360696.1|  acyl-CoA oxidase domain-containing protein       74.3    1e-11    
ref|WP_017972609.1|  acyl-CoA oxidase                                 74.3    1e-11    
gb|KGN32028.1|  acyl-CoA oxidase                                      74.3    1e-11    
ref|WP_036298108.1|  acyl-CoA dehydrogenase                           74.3    1e-11    
ref|XP_009829957.1|  hypothetical protein, variant                    74.3    1e-11    
ref|WP_036442896.1|  acyl-CoA oxidase                                 73.9    1e-11    
ref|WP_019969895.1|  acyl-CoA oxidase                                 73.9    1e-11    
ref|WP_017581593.1|  acyl-CoA oxidase                                 73.9    1e-11    
ref|XP_009829956.1|  hypothetical protein H257_06444                  73.9    1e-11    
gb|AEM70899.1|  Acyl-CoA oxidase                                      73.9    1e-11    
ref|WP_041801916.1|  acyl-CoA oxidase                                 73.9    1e-11    
ref|WP_036344488.1|  acyl-CoA oxidase                                 73.9    2e-11    
gb|EUA32514.1|  acyl-CoA oxidase family protein                       71.6    2e-11    
ref|WP_018599328.1|  acyl-CoA oxidase                                 73.9    2e-11    
ref|WP_043644508.1|  hypothetical protein                             73.9    2e-11    
ref|WP_012813658.1|  acyl-CoA oxidase                                 73.9    2e-11    
ref|WP_017831400.1|  acyl-CoA dehydrogenase                           73.6    2e-11    
gb|EFA75614.1|  putative acyl-CoA oxidase                             73.6    2e-11    
ref|WP_032779937.1|  acyl-CoA oxidase                                 73.6    2e-11    
dbj|GAM28721.1|  hypothetical protein SAMD00019534_118970             73.6    2e-11    
ref|WP_028649709.1|  acyl-CoA oxidase                                 73.6    2e-11    
ref|WP_032769032.1|  acyl-CoA oxidase                                 73.6    2e-11    
ref|WP_006122746.1|  MULTISPECIES: acyl-CoA oxidase                   73.6    2e-11    
ref|WP_016932641.1|  acyl-CoA oxidase                                 73.6    2e-11    
gb|KEP76103.1|  acyl-CoA dehydrogenase                                73.6    2e-11    
ref|WP_029182498.1|  acyl-CoA oxidase                                 73.2    2e-11    
ref|WP_011893606.1|  acyl-CoA oxidase                                 73.2    2e-11    
ref|WP_037715592.1|  acyl-CoA oxidase                                 73.2    2e-11    
ref|WP_044101585.1|  acyl-CoA oxidase                                 73.6    2e-11    
ref|WP_042295862.1|  acyl-CoA oxidase                                 73.6    2e-11    
ref|WP_008354960.1|  acyl-CoA oxidase                                 73.2    2e-11    
ref|WP_018170434.1|  acyl-CoA dehydrogenase                           73.2    3e-11    
ref|WP_035751757.1|  acyl-CoA oxidase                                 73.2    3e-11    
ref|WP_011856090.1|  acyl-CoA oxidase                                 73.2    3e-11    
ref|WP_011560818.1|  MULTISPECIES: acyl-CoA oxidase                   73.2    3e-11    
gb|EOM77189.1|  acyl-CoA oxidase                                      73.2    3e-11    
ref|WP_012832911.1|  acyl-CoA oxidase                                 73.2    3e-11    
ref|WP_040772532.1|  acyl-CoA oxidase                                 73.2    3e-11    
ref|WP_036457059.1|  acyl-CoA oxidase                                 73.2    3e-11    
gb|EFL10817.1|  acyl-CoA oxidase                                      72.8    3e-11    
ref|WP_030317285.1|  acyl-CoA oxidase                                 72.8    3e-11    
ref|WP_030811972.1|  acyl-CoA oxidase                                 72.8    3e-11    
ref|WP_026204649.1|  acyl-CoA oxidase                                 72.8    3e-11    
ref|XP_004333085.1|  acylCoA oxidase                                  69.7    4e-11    
gb|EUA33411.1|  acyl-CoA dehydrogenase, C-terminal domain protein     71.6    4e-11    
ref|XP_636605.1|  hypothetical protein DDB_G0288735                   72.8    4e-11    
ref|XP_002671572.1|  peroxisomal acyl-CoA oxidase-like protein        72.4    4e-11    
ref|WP_030760334.1|  MULTISPECIES: acyl-CoA oxidase                   72.4    4e-11    
ref|WP_027862959.1|  acyl-CoA oxidase                                 72.4    4e-11    
ref|WP_040783005.1|  acyl-CoA oxidase                                 72.4    4e-11    
gb|EME62368.1|  acyl-CoA oxidase                                      72.4    4e-11    
ref|WP_010853776.1|  Acyl-coenzyme A oxidase 1, peroxisomal           72.4    4e-11    
ref|WP_009678111.1|  acyl-CoA oxidase                                 72.4    5e-11    
ref|WP_018156945.1|  hypothetical protein                             72.4    5e-11    
ref|WP_005258360.1|  acyl-CoA oxidase                                 72.4    5e-11    
ref|WP_036358810.1|  acyl-CoA oxidase                                 72.0    5e-11    
ref|WP_036280440.1|  acyl-CoA dehydrogenase                           72.0    6e-11    
ref|WP_007619749.1|  putative acyl-CoA oxidase                        72.0    6e-11    
ref|WP_006437568.1|  putative acyl-CoA oxidase                        72.0    6e-11    
ref|WP_031937608.1|  acyl-CoA oxidase                                 72.0    6e-11    
ref|WP_029144974.1|  acyl-CoA dehydrogenase                           72.0    7e-11    
ref|WP_040608171.1|  hypothetical protein                             72.0    7e-11    
gb|ADV49363.1|  Acyl-CoA oxidase                                      72.0    7e-11    
ref|WP_030580799.1|  acyl-CoA oxidase                                 72.0    7e-11    
ref|WP_041557690.1|  acyl-CoA oxidase                                 72.0    7e-11    
ref|WP_003933305.1|  acyl-CoA oxidase                                 71.6    7e-11    
ref|XP_002677851.1|  acyl-coenzyme A oxidase                          72.0    7e-11    
emb|CCH75984.1|  conserved hypothetical protein                       71.6    8e-11    
ref|WP_039819999.1|  acyl-CoA oxidase                                 71.6    8e-11    
ref|WP_032788418.1|  acyl-CoA oxidase                                 71.6    8e-11    
ref|WP_036460965.1|  acyl-CoA oxidase                                 71.6    8e-11    
ref|WP_023986016.1|  MULTISPECIES: acyl-CoA oxidase                   71.6    8e-11    
ref|WP_024445310.1|  acyl-CoA oxidase                                 71.6    8e-11    
ref|WP_030133589.1|  acyl-CoA oxidase                                 71.6    8e-11    
ref|WP_018894104.1|  acyl-CoA oxidase                                 71.6    8e-11    
ref|WP_029373113.1|  acyl-CoA oxidase                                 71.6    9e-11    
ref|WP_037308120.1|  acyl-CoA oxidase                                 71.6    9e-11    
ref|WP_008713698.1|  Acyl-CoA dehydrogenase domain protein            71.6    9e-11    
ref|WP_030433418.1|  acyl-CoA oxidase                                 71.2    9e-11    
ref|WP_015787457.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_030480778.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_044506891.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_006358547.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_017984803.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_042270257.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_036581400.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_028655548.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_017933227.1|  hypothetical protein                             71.2    1e-10    
ref|WP_042246211.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_005628484.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|XP_005647184.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_005194221.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_042377454.1|  acyl-CoA oxidase                                 71.2    1e-10    
ref|WP_017557135.1|  hypothetical protein                             71.2    1e-10    
ref|WP_023420722.1|  MULTISPECIES: Acyl-coenzyme A oxidase 1, per...  70.9    1e-10    
ref|WP_003921933.1|  acyl-CoA oxidase                                 70.9    1e-10    
ref|WP_005144785.1|  acyl-CoA oxidase                                 70.9    1e-10    
ref|WP_003895830.1|  acyl-CoA oxidase                                 70.9    1e-10    
ref|WP_015356441.1|  acyl-CoA dehydrogenase                           70.9    1e-10    
ref|WP_020786817.1|  Acyl-coenzyme A oxidase 3, peroxisomal           70.9    2e-10    
ref|WP_013453510.1|  acyl-CoA oxidase                                 70.9    2e-10    
ref|WP_033948443.1|  acyl-CoA oxidase                                 70.9    2e-10    
ref|WP_038580130.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_012395254.1|  acyl-CoA oxidase                                 70.5    2e-10    
gb|EPQ74968.1|  Acyl-coenzyme A oxidase 3, peroxisomal                70.5    2e-10    
ref|WP_036393685.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_035128869.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_044376178.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_036456278.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_011729863.1|  acyl-CoA oxidase                                 70.5    2e-10    
gb|AII09135.1|  acyl-CoA oxidase                                      70.5    2e-10    
ref|WP_030570486.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_008735487.1|  acyl-CoA oxidase                                 70.5    2e-10    
gb|KGN33304.1|  acyl-CoA oxidase                                      70.5    2e-10    
ref|WP_035914201.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_012924042.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_022597503.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_013416987.1|  acyl-CoA oxidase                                 70.5    2e-10    
ref|WP_037233366.1|  acyl-CoA oxidase                                 70.1    2e-10    
ref|WP_011753930.1|  acyl-CoA oxidase                                 70.1    2e-10    
ref|WP_003946657.1|  MULTISPECIES: acyl-CoA oxidase                   70.1    2e-10    
ref|WP_019343338.1|  acyl-CoA oxidase                                 70.1    3e-10    
ref|WP_022901141.1|  acyl-CoA dehydrogenase                           70.1    3e-10    
ref|WP_030762017.1|  acyl-CoA oxidase                                 70.1    3e-10    
dbj|GAK89315.1|  acyl-coenzyme A oxidase 1                            68.9    3e-10    
dbj|GAM25458.1|  hypothetical protein SAMD00019534_086330             70.1    3e-10    
ref|WP_006865285.1|  acyl-CoA oxidase                                 70.1    3e-10    
ref|WP_005566484.1|  MULTISPECIES: acyl-CoA oxidase                   70.1    3e-10    
ref|WP_012688927.1|  acyl-CoA oxidase                                 70.1    3e-10    
gb|EXX75212.1|  hypothetical protein RirG_043720                      69.3    3e-10    
ref|XP_002159574.1|  PREDICTED: putative acyl-coenzyme A oxidase ...  69.7    3e-10    
ref|WP_018471012.1|  acyl-CoA oxidase                                 69.7    3e-10    
dbj|GAK93201.1|  acyl-coenzyme A oxidase 1                            68.6    3e-10    
ref|WP_014212607.1|  acyl-CoA oxidase                                 69.7    3e-10    
gb|EFA78532.1|  putative acyl-CoA oxidase                             69.7    3e-10    
ref|WP_031177408.1|  acyl-CoA oxidase                                 69.7    3e-10    
ref|WP_005518129.1|  acyl-CoA oxidase                                 69.7    3e-10    
ref|WP_014359023.1|  acyl-CoA oxidase                                 69.7    4e-10    
ref|WP_010639493.1|  acyl-CoA oxidase                                 69.7    4e-10    
ref|WP_032390396.1|  acyl-CoA oxidase                                 69.7    4e-10    
ref|WP_020937550.1|  acyl-CoA dehydrogenase                           69.7    4e-10    
ref|WP_020172265.1|  acyl-CoA oxidase                                 69.7    4e-10    
ref|WP_013828514.1|  acyl-CoA oxidase                                 69.7    4e-10    
ref|XP_002128280.1|  PREDICTED: acyl-coenzyme A oxidase 3, peroxi...  66.6    4e-10    
ref|WP_019734689.1|  acyl-CoA oxidase                                 69.3    4e-10    
ref|WP_006372698.1|  acyl-CoA oxidase                                 69.7    4e-10    
ref|WP_030697375.1|  acyl-CoA oxidase                                 69.3    4e-10    
ref|WP_013584223.1|  acyl-CoA dehydrogenase                           69.3    4e-10    
ref|XP_009061608.1|  hypothetical protein LOTGIDRAFT_127454           68.2    5e-10    
ref|WP_029109612.1|  acyl-CoA oxidase                                 69.3    5e-10    
gb|AAC32108.1|  acyl-CoA oxidase homolog                              67.0    5e-10    
ref|WP_027934089.1|  acyl-CoA oxidase                                 69.3    5e-10    
ref|WP_007317217.1|  acyl-CoA oxidase                                 69.3    5e-10    
ref|WP_037186992.1|  acyl-CoA oxidase                                 69.3    5e-10    
ref|WP_027498339.1|  MULTISPECIES: acyl-CoA oxidase                   69.3    5e-10    
ref|WP_020890884.1|  Acyl-coenzyme A oxidase 1, peroxisomal           69.3    5e-10    
ref|WP_030081577.1|  acyl-CoA oxidase                                 69.3    5e-10    
ref|WP_040883508.1|  acyl-CoA oxidase                                 69.3    5e-10    
gb|EAP98968.1|  hypothetical protein JNB_02330                        69.3    5e-10    
ref|WP_030629375.1|  acyl-CoA oxidase                                 68.9    6e-10    
ref|WP_029254848.1|  acyl-CoA oxidase                                 68.9    6e-10    
ref|WP_012381918.1|  acyl-CoA oxidase                                 68.9    6e-10    
ref|WP_035837845.1|  acyl-CoA dehydrogenase                           68.9    6e-10    
ref|WP_030704772.1|  acyl-CoA oxidase                                 68.9    6e-10    
ref|WP_003879598.1|  MULTISPECIES: acyl-CoA oxidase                   68.9    6e-10    
ref|WP_024487810.1|  MULTISPECIES: acyl-CoA oxidase                   68.9    6e-10    
ref|WP_041815718.1|  acyl-CoA oxidase                                 68.9    6e-10    
ref|WP_043221719.1|  acyl-CoA oxidase                                 68.9    6e-10    
ref|WP_030768335.1|  acyl-CoA oxidase                                 68.9    6e-10    
ref|WP_033235472.1|  acyl-CoA oxidase                                 68.9    6e-10    
gb|ESA00876.1|  hypothetical protein GLOINDRAFT_265185                68.9    6e-10    
gb|KJF23120.1|  Acyl-CoA dehydrogenase, short-chain specific          68.9    6e-10    
ref|WP_017680041.1|  acyl-CoA oxidase                                 68.9    7e-10    
ref|WP_026242212.1|  acyl-CoA oxidase                                 68.9    7e-10    
dbj|BAH32371.1|  putative acyl-CoA oxidase                            68.9    7e-10    
ref|WP_006899076.1|  putative acyl-CoA oxidase                        68.9    7e-10    
gb|EME15692.1|  acyl-CoA oxidase                                      68.9    7e-10    
ref|XP_004363191.1|  putative acyl-CoA oxidase                        68.9    7e-10    
ref|WP_005251993.1|  acyl-CoA oxidase                                 68.9    7e-10    
ref|WP_014021931.1|  acyl-CoA oxidase                                 68.9    7e-10    



>ref|XP_008353771.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Malus 
domestica]
Length=284

 Score =   323 bits (827),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+  +++GK FK LGLEHMN+PCPVIPS+L+S TL   QFQ
Sbjct  73   FEGDNNVLMQQVSKALLAEYIATQKRGKPFKALGLEHMNKPCPVIPSQLTSSTLQCSQFQ  132

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN FA EVSQ Q  GE KE + +LSYQLA DLGRAFADR+I  TF++AE
Sbjct  133  MDAFCLRERDLLNRFAMEVSQRQKQGESKEYSIILSYQLAGDLGRAFADRSILQTFIDAE  192

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLKN+L+L+RSMYA+  L+EDAAFLRYG L+T+N AAVRKE++ LC ELRPHAL
Sbjct  193  AALPAGSLKNVLALLRSMYALICLEEDAAFLRYGYLSTNNVAAVRKEVSRLCGELRPHAL  252

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWIDSN+WSS+
Sbjct  253  ALVSSFGIPDAFLSPIAFNWIDSNSWSSV  281


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQG+KTENR+G  K E+DV ST       L  ++++  L      + R +  K
Sbjct  46   REACGGQGIKTENRVGHFKGEFDVQSTFEGDNNVLMQQVSKALLAEYIATQKRGKPFK  103



>gb|KDP31760.1| hypothetical protein JCGZ_12221 [Jatropha curcas]
Length=680

 Score =   326 bits (836),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+  ++K K FKG GLEHMN PCPVIPS+L+S  L S QFQ
Sbjct  470  FEGDNNVLMQQVSKALLAEYIAAQKKNKPFKGFGLEHMNGPCPVIPSQLTSAILRSSQFQ  529

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             + FCLRER LL+ FAAEVSQHQA+GE KE AF++SYQLAEDLGRAF+DR I  TF+ AE
Sbjct  530  INAFCLRERDLLSRFAAEVSQHQANGESKERAFIMSYQLAEDLGRAFSDRLILQTFIEAE  589

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V++GSLKN+L L+RSMYA+  L+ED+AFLRYG L+T++AAAVRKE+A LCSELRPHAL
Sbjct  590  TTVSAGSLKNVLGLLRSMYALICLEEDSAFLRYGYLSTESAAAVRKEVAKLCSELRPHAL  649

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWID+N+WSS+
Sbjct  650  ALVSSFGIPDAFLSPIAFNWIDANSWSSV  678


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  KSE+DV ST       L  ++++  L     A+ + +  K
Sbjct  443  REACGGQGLKTENRVGHLKSEFDVQSTFEGDNNVLMQQVSKALLAEYIAAQKKNKPFK  500



>ref|XP_002525155.1| acyl-CoA oxidase, putative [Ricinus communis]
 gb|EEF37282.1| acyl-CoA oxidase, putative [Ricinus communis]
Length=625

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++  ++K K FKGLGLEHMN PC +IPS+L+S  L S QFQ
Sbjct  415  FEGDNNVLMQQVSKALFAEFIAAQKKKKPFKGLGLEHMNGPCLIIPSQLTSTILRSSQFQ  474

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
               FCLRER LLN FA EVSQHQA GE KENAF+L YQLAEDLGRAF+DR I  TF+ AE
Sbjct  475  IGAFCLRERDLLNRFATEVSQHQAKGESKENAFMLGYQLAEDLGRAFSDRAILQTFIEAE  534

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             SV+ G+LKN+L L+RSMYAM  L+EDAAFLRYG L+T+NAAAVRKE+  LC+ELRPHAL
Sbjct  535  TSVSDGALKNVLGLLRSMYAMICLEEDAAFLRYGYLSTENAAAVRKEVMKLCNELRPHAL  594

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWID+N+WSS+
Sbjct  595  ALVSSFGIPDAFLSPIAFNWIDANSWSSV  623


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  KSE+DV +T       L  ++++        A+ + +  K
Sbjct  388  REACGGQGLKTENRVGNLKSEFDVQTTFEGDNNVLMQQVSKALFAEFIAAQKKKKPFK  445



>ref|NP_001280826.1| acyl-coenzyme A oxidase 3, peroxisomal-like [Malus domestica]
 gb|ABB83366.1| putative medium chain acyl-CoA oxidase [Malus domestica]
Length=674

 Score =   322 bits (826),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+  +++GK FK LGLEHMN+PCPVIPS+L+S TL   QFQ
Sbjct  463  FEGDNNVLMQQVSKALLAEYIATQKRGKPFKALGLEHMNKPCPVIPSQLTSSTLQCSQFQ  522

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN FA EVSQ Q  GE KE + +LSYQLA DLGRAFADR+I  TF++AE
Sbjct  523  MDAFCLRERDLLNRFAMEVSQRQKQGESKEYSIILSYQLAGDLGRAFADRSILQTFIDAE  582

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLKN+L+L+RSMYA+  L+EDAAFLRYG L+TDN AAVRKE++ LC ELRPHAL
Sbjct  583  AALPAGSLKNVLALLRSMYALICLEEDAAFLRYGYLSTDNVAAVRKEVSRLCGELRPHAL  642

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWIDSN+WSS+
Sbjct  643  ALVSSFGIPDAFLSPIAFNWIDSNSWSSV  671


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQG+KTENR+G  K E+DV ST       L  ++++  L      + R +  K
Sbjct  436  REACGGQGIKTENRVGHFKGEFDVQSTFEGDNNVLMQQVSKALLAEYIATQKRGKPFK  493



>ref|XP_002325591.1| acyl-CoA oxidase family protein [Populus trichocarpa]
 gb|EEE99972.1| acyl-CoA oxidase family protein [Populus trichocarpa]
Length=680

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL+EY   K+K K FKGLGLEHMN P PVIPS L+S TL S QFQ
Sbjct  470  FEGDNNVLMQQVSKALLSEYAAAKKKNKPFKGLGLEHMNGPVPVIPSNLTSSTLRSSQFQ  529

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             + FCLRER LLN FAAEVS +Q+ GE KE+AF+LSYQLAEDLGRAF+DR I  TF++AE
Sbjct  530  MNAFCLRERDLLNRFAAEVSLYQSKGESKEHAFILSYQLAEDLGRAFSDRAILQTFIDAE  589

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V++GSLKN+L L+RSMYA+  L+EDAAFLRYG L+TDNAAAVRKE+  LC ELRPHAL
Sbjct  590  ANVSAGSLKNVLGLLRSMYALICLEEDAAFLRYGYLSTDNAAAVRKEVTKLCGELRPHAL  649

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+S GIPD FL PIAFNWID+N+WSS+
Sbjct  650  ALVSSLGIPDAFLGPIAFNWIDANSWSSV  678


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTEN+IG  K E+DV ST       L  ++++  L   + AK + +  K
Sbjct  443  REACGGQGLKTENKIGHLKGEFDVQSTFEGDNNVLMQQVSKALLSEYAAAKKKNKPFK  500



>ref|XP_011002667.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=680

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL+EY   K+K K FKGLGLEHMN P PVIPS L+S+ L S QFQ
Sbjct  470  FEGDNNVLMQQVSKALLSEYAAAKKKNKPFKGLGLEHMNGPVPVIPSNLTSNNLRSSQFQ  529

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             + FCLRER LLN FAAEVS +Q+ GE KE+AF+LSYQLAEDLGRAF+DR I  TF++AE
Sbjct  530  MNAFCLRERDLLNRFAAEVSLYQSKGESKEHAFILSYQLAEDLGRAFSDRAILQTFIDAE  589

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V++GSLKN+L L+RSMYA+  L+EDAAFLRYG L+TDNAAAVRKE+  LC ELRPHAL
Sbjct  590  ANVSAGSLKNVLGLLRSMYALICLEEDAAFLRYGYLSTDNAAAVRKEVTKLCGELRPHAL  649

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+S GIPD FL PIAFNWID+N+WSS+
Sbjct  650  ALVSSLGIPDAFLGPIAFNWIDANSWSSV  678


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            R+ACGGQGLKTEN+IG  K E+DV ST       L  ++++  L   + AK + +  K
Sbjct  443  RDACGGQGLKTENKIGHLKGEFDVQSTFEGDNNVLMQQVSKALLSEYAAAKKKNKPFK  500



>ref|XP_009354288.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Pyrus 
x bretschneideri]
Length=674

 Score =   318 bits (815),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+  +++GK FK LGLEHMN+PCPVIPS+L+S TL   QFQ
Sbjct  463  FEGDNNVLMQQVSKALLAEYIAAQKRGKPFKALGLEHMNKPCPVIPSQLTSSTLQCRQFQ  522

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN FA EVSQ Q  GE KE + +LSYQLA DLGRAFADR I  TF++AE
Sbjct  523  MDAFCLRERDLLNRFAMEVSQRQKQGESKEYSIILSYQLAGDLGRAFADRAILQTFIDAE  582

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLKN+L+L+RSMYA+  L+EDAAFLRYG L+TDN AAVRKE++ LC ELRPHAL
Sbjct  583  AALPAGSLKNVLALLRSMYALICLEEDAAFLRYGYLSTDNVAAVRKEVSRLCGELRPHAL  642

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD  LSPIAFNWIDSN+WSS+
Sbjct  643  ALVSSFGIPDACLSPIAFNWIDSNSWSSV  671


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQG+KTENR+G  K E+DV ST       L  ++++  L     A+ R +  K
Sbjct  436  REACGGQGIKTENRVGHFKGEFDVQSTFEGDNNVLMQQVSKALLAEYIAAQKRGKPFK  493



>ref|XP_007213791.1| hypothetical protein PRUPE_ppa002439m2g, partial [Prunus persica]
 gb|EMJ14990.1| hypothetical protein PRUPE_ppa002439m2g, partial [Prunus persica]
Length=520

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+   ++ K FK LGLEHMN+PCPVIPS+L+S TL S QFQ
Sbjct  310  FEGDNNVLMQQVSKALLAEYIAAHKRSKPFKALGLEHMNKPCPVIPSQLTSSTLQSSQFQ  369

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN FA EVS+ Q  GE KE + +LSYQLA+DLGRAF+DRTI    ++AE
Sbjct  370  MDAFCLRERDLLNRFAMEVSERQKQGESKEYSVILSYQLAQDLGRAFSDRTILQALLDAE  429

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              V SGSLKN+L+++RSMYA+  L+ED AFLR+G L+TDN AAVRKE++ LC ELRPHAL
Sbjct  430  AGVPSGSLKNVLAMLRSMYALICLEEDPAFLRFGYLSTDNVAAVRKEVSRLCGELRPHAL  489

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWID+N+WSS+
Sbjct  490  ALVSSFGIPDAFLSPIAFNWIDANSWSSV  518


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K EYDV ST       L  ++++  L     A  R++  K
Sbjct  283  REACGGQGLKTENRIGPLKGEYDVQSTFEGDNNVLMQQVSKALLAEYIAAHKRSKPFK  340



>ref|XP_008244854.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Prunus 
mume]
Length=662

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+  +++ K FK LGLEHMN+PCPVIPS+L+S TL S QFQ
Sbjct  452  FEGDNNVLMQQVSKALLAEYIAAQKRSKPFKALGLEHMNKPCPVIPSRLTSSTLQSSQFQ  511

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN FA EVS+ Q  GE KE + +LSYQLA+DLGRAF+DRTI  T ++AE
Sbjct  512  MDAFCLRERDLLNRFAMEVSERQKQGESKEYSVILSYQLAQDLGRAFSDRTILQTLLDAE  571

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              V SGSLKN+L+++RSMYA+  L+ED AFLR+G L+TDN AAVRKE++ LC ELRPHAL
Sbjct  572  AGVPSGSLKNVLAMLRSMYALICLEEDLAFLRFGYLSTDNVAAVRKEVSRLCGELRPHAL  631

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWID+N+WSS+
Sbjct  632  ALVSSFGIPDAFLSPIAFNWIDANSWSSV  660



>ref|XP_004248184.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Solanum lycopersicum]
Length=686

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL  EYV  KR  K F+GLGLEHMN   PVIPS+L+S T+   QFQ
Sbjct  476  FEGDNNVLMQQVSKALFGEYVAAKRSKKPFRGLGLEHMNTSRPVIPSQLTSITMRQAQFQ  535

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVSQ QA G+ KE AF L+YQLAEDLGRAF+DR + HTF++AE
Sbjct  536  NDIFCLRERDLLERFAAEVSQCQAQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLDAE  595

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             SV SG LKN+L LVRSMY +  L+EDAAFLRYG L+ DNAA VRKE+A LCSELRPHAL
Sbjct  596  ASVTSGPLKNVLDLVRSMYVLITLEEDAAFLRYGYLSMDNAAIVRKEVAKLCSELRPHAL  655

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFG+PD FLSPIAFNW+++NAWSS
Sbjct  656  SLVSSFGLPDAFLSPIAFNWVEANAWSS  683


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAK  631
            REACGGQGLKTENRIGQ K EYDV ST       L  ++++        AK
Sbjct  449  REACGGQGLKTENRIGQLKGEYDVQSTFEGDNNVLMQQVSKALFGEYVAAK  499



>ref|XP_004248185.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Solanum lycopersicum]
Length=683

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL  EYV  KR  K F+GLGLEHMN   PVIPS+L+S T+   QFQ
Sbjct  473  FEGDNNVLMQQVSKALFGEYVAAKRSKKPFRGLGLEHMNTSRPVIPSQLTSITMRQAQFQ  532

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVSQ QA G+ KE AF L+YQLAEDLGRAF+DR + HTF++AE
Sbjct  533  NDIFCLRERDLLERFAAEVSQCQAQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLDAE  592

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             SV SG LKN+L LVRSMY +  L+EDAAFLRYG L+ DNAA VRKE+A LCSELRPHAL
Sbjct  593  ASVTSGPLKNVLDLVRSMYVLITLEEDAAFLRYGYLSMDNAAIVRKEVAKLCSELRPHAL  652

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFG+PD FLSPIAFNW+++NAWSS
Sbjct  653  SLVSSFGLPDAFLSPIAFNWVEANAWSS  680


 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAK  631
            REACGGQGLKTENRIGQ K EYDV ST       L  ++++        AK
Sbjct  446  REACGGQGLKTENRIGQLKGEYDVQSTFEGDNNVLMQQVSKALFGEYVAAK  496



>emb|CDP15892.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   315 bits (808),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 179/209 (86%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEYV  K++ K F+GLGLEHMN+P PVIPS+L+S  + SI F+
Sbjct  465  FEGDNNVLMQQVSKALLAEYVAAKKRNKPFEGLGLEHMNKPSPVIPSQLTSTVMRSIDFE  524

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            +D+ CLRER LLN FA+E+SQ QA GE KE+AF++SYQLAEDLGRAF+DR I+ TFV+AE
Sbjct  525  HDMLCLRERDLLNRFASEISQRQAQGESKEHAFVMSYQLAEDLGRAFSDRAIFQTFVDAE  584

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V   +LK+IL L+RSMYA+  L+ED+AFLRYG L+ DNAAAVRKE+A LC ELRPHAL
Sbjct  585  TTVTDATLKSILCLLRSMYALVTLEEDSAFLRYGFLSVDNAAAVRKEVAKLCGELRPHAL  644

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            +LV+SFGIPD  LSPIAFNW+++N+WSS+
Sbjct  645  SLVSSFGIPDALLSPIAFNWLETNSWSSV  673


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQG+KTENRIG  K EYDV ST       L  ++++  L     AK R +  +
Sbjct  438  REACGGQGMKTENRIGHLKGEYDVQSTFEGDNNVLMQQVSKALLAEYVAAKKRNKPFE  495



>emb|CBI21935.3| unnamed protein product [Vitis vinifera]
Length=558

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+  +++ + FKGLGLEHMN+ CPV+PS+L+S TL S QFQ
Sbjct  338  FEGDNNVLMQQVSKALLAEYIAVQKRNRPFKGLGLEHMNKSCPVVPSQLTSSTLRSSQFQ  397

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             DIFCLRER LL  FAAE+SQ QA G  +E A L SYQLAEDLGRAF+DR I  TF++AE
Sbjct  398  TDIFCLRERDLLIRFAAEMSQLQAQGLSREYALLQSYQLAEDLGRAFSDRAILQTFLDAE  457

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V+SG LK++LSL+RSM+ + IL+EDA+FLRYG L+ DNAA +RKE+  LCSELRPHAL
Sbjct  458  AAVSSGPLKSMLSLLRSMHVLIILEEDASFLRYGYLSPDNAAGIRKEVTILCSELRPHAL  517

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWID+N+WSS+
Sbjct  518  ALVSSFGIPDAFLSPIAFNWIDANSWSSV  546


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIGQ K EYDV ST       L  ++++  L      + R R  K
Sbjct  311  REACGGQGLKTENRIGQMKGEYDVQSTFEGDNNVLMQQVSKALLAEYIAVQKRNRPFK  368



>ref|XP_006376402.1| acyl-CoA oxidase family protein [Populus trichocarpa]
 gb|ERP54199.1| acyl-CoA oxidase family protein [Populus trichocarpa]
Length=673

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL+EYV  K+K K FKGLGLEHMN P PVI S L+S TL + QFQ
Sbjct  463  FEGDNNVLMQQVSKALLSEYVAAKKKNKPFKGLGLEHMNGPVPVIQSNLTSTTLRNSQFQ  522

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             +  CLRER LLN FAAEVS +Q+ GE KE AF+LSYQLAEDLGRAF+DR I  TF++AE
Sbjct  523  MNAHCLRERDLLNRFAAEVSLYQSKGESKERAFILSYQLAEDLGRAFSDRAILQTFIDAE  582

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V++GSLKN+L L+RSMYA+  L+EDAAFLRYG L+TDNAAAVR E+  LC ELRPHAL
Sbjct  583  ANVSAGSLKNVLGLLRSMYALICLEEDAAFLRYGYLSTDNAAAVRNEVTKLCGELRPHAL  642

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+S GIPD FLSPIAFNWID+N+WSS+
Sbjct  643  ALVSSLGIPDAFLSPIAFNWIDANSWSSV  671


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K E+DV ST       L  ++++  L     AK + +  K
Sbjct  436  REACGGQGLKTENRVGHLKGEFDVQSTFEGDNNVLMQQVSKALLSEYVAAKKKNKPFK  493



>ref|XP_006364108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Solanum tuberosum]
Length=685

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL  EYV  KR  K FKGLGLEHMN   PVIPS+L++ T+   QFQ
Sbjct  475  FEGDNNVLMQQVSKALFGEYVAAKRSKKPFKGLGLEHMNTSRPVIPSQLTNSTMRQAQFQ  534

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVSQ QA G+ KE AF L+YQLAEDLGRAF+DR + HTF++AE
Sbjct  535  NDIFCLRERDLLERFAAEVSQCQAQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLDAE  594

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              V SG LKN+L LVRSMY +  L+EDAAFLRYG L+ DNAA VRKE+A LCSELRPHAL
Sbjct  595  AFVTSGPLKNVLDLVRSMYVLVTLEEDAAFLRYGYLSMDNAAIVRKEVAKLCSELRPHAL  654

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFG+PD FLSPIAFNW+++NAWSS
Sbjct  655  SLVSSFGLPDAFLSPIAFNWVEANAWSS  682


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIGQ K EYDV ST       L  ++++        AK   +  K
Sbjct  448  REACGGQGLKTENRIGQLKGEYDVQSTFEGDNNVLMQQVSKALFGEYVAAKRSKKPFK  505



>ref|XP_004303096.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=674

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAE++T ++K + FK LGLEHMN+PCPVIP  L+S TL SI+FQ
Sbjct  463  FEGDNNVLMQQVSKALLAEFITAQKKNQPFKALGLEHMNKPCPVIPPHLTSSTLQSIEFQ  522

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN FA EVSQ Q  GE KE + LLSYQLAEDLGRAF+DRTI  TF++ E
Sbjct  523  MDAFCLRERDLLNRFALEVSQRQKQGESKEYSVLLSYQLAEDLGRAFSDRTILQTFIDVE  582

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V +GSLKN+L+++R+MYA+  L+ED  FLRYG L+TDN  AV+KE+++LC ELRPHAL
Sbjct  583  ATVPAGSLKNVLAMLRTMYALICLEEDVTFLRYGYLSTDNVTAVQKEVSSLCRELRPHAL  642

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
             LV+SFGIPD FLSPIAFNWI+SN+WSS+
Sbjct  643  TLVSSFGIPDAFLSPIAFNWIESNSWSSV  671


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K E+DV ST       L  ++++  L     A+ + +  K
Sbjct  436  REACGGQGLKTENRIGNLKGEFDVQSTFEGDNNVLMQQVSKALLAEFITAQKKNQPFK  493



>ref|XP_006364109.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Solanum tuberosum]
Length=683

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL  EYV  KR  K FKGLGLEHMN   PVIPS+L++ T+   QFQ
Sbjct  473  FEGDNNVLMQQVSKALFGEYVAAKRSKKPFKGLGLEHMNTSRPVIPSQLTNSTMRQAQFQ  532

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVSQ QA G+ KE AF L+YQLAEDLGRAF+DR + HTF++AE
Sbjct  533  NDIFCLRERDLLERFAAEVSQCQAQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLDAE  592

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              V SG LKN+L LVRSMY +  L+EDAAFLRYG L+ DNAA VRKE+A LCSELRPHAL
Sbjct  593  AFVTSGPLKNVLDLVRSMYVLVTLEEDAAFLRYGYLSMDNAAIVRKEVAKLCSELRPHAL  652

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFG+PD FLSPIAFNW+++NAWSS
Sbjct  653  SLVSSFGLPDAFLSPIAFNWVEANAWSS  680


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIGQ K EYDV ST       L  ++++        AK   +  K
Sbjct  446  REACGGQGLKTENRIGQLKGEYDVQSTFEGDNNVLMQQVSKALFGEYVAAKRSKKPFK  503



>gb|AFQ93695.1| acyl-CoA oxidase 3 [Prunus persica]
Length=672

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+   ++ K FK LGLEHMN+PCPVIPS+L+S TL S QFQ
Sbjct  462  FEGDNNVLMQQVSKALLAEYIAAHKRSKPFKALGLEHMNKPCPVIPSQLTSSTLQSSQFQ  521

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN FA EVS+ Q  GE KE + +LSYQLA+DLGRAF+DRTI    ++AE
Sbjct  522  MDAFCLRERDLLNRFAMEVSERQKQGESKEYSVILSYQLAQDLGRAFSDRTILQALLDAE  581

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              V SGSLKN+L+++RSMYA+  L+ED AFLR+G L+TDN AAVRKE++ LC ELRPHAL
Sbjct  582  AGVPSGSLKNVLAMLRSMYALICLEEDPAFLRFGYLSTDNVAAVRKEVSRLCGELRPHAL  641

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWID+N+WSS+
Sbjct  642  ALVSSFGIPDAFLSPIAFNWIDANSWSSV  670


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K EYDV ST       L  ++++  L     A  R++  K
Sbjct  435  REACGGQGLKTENRIGPLKGEYDVQSTFEGDNNVLMQQVSKALLAEYIAAHKRSKPFK  492



>ref|XP_011037432.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=514

 Score =   308 bits (789),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL+EY   K+K K FKGLGLEHMN P PVI S L+S TL + QFQ
Sbjct  304  FEGDNNVLMQQVSKALLSEYGAAKKKNKPFKGLGLEHMNGPVPVIQSNLTSTTLRNSQFQ  363

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             +  CLRER LLN FAAEVS +Q+ GE KE AF+LSYQLAEDLGRAF+DR I  TF++AE
Sbjct  364  MNTHCLRERDLLNRFAAEVSLYQSKGESKERAFILSYQLAEDLGRAFSDRAILQTFIDAE  423

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V++G LKN+L L+RSMYA+  L+EDAAFLRYG L+T+NAAAVR E+  LC ELRPHAL
Sbjct  424  ANVSAGPLKNVLGLLRSMYALICLEEDAAFLRYGYLSTENAAAVRNEVTKLCGELRPHAL  483

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+S GIPD FLSPIAFNWID+N+WSS+
Sbjct  484  ALVSSLGIPDAFLSPIAFNWIDANSWSSV  512


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K E+DV ST       L  ++++  L     AK + +  K
Sbjct  277  REACGGQGLKTENRVGHLKGEFDVQSTFEGDNNVLMQQVSKALLSEYGAAKKKNKPFK  334



>ref|XP_006469060.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Citrus 
sinensis]
Length=671

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L FEGDNNVLMQQVSKALLAEY+  +++ +  +GLGLEHMN+PCPVIPS+L+S  L + Q
Sbjct  460  LTFEGDNNVLMQQVSKALLAEYLAAQKRNRPLQGLGLEHMNKPCPVIPSQLTSSILRTTQ  519

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
            FQ D FCLRER LL+ F  +VSQHQA G+ K+ A +LSYQLAEDLGRAF+DR +  TF++
Sbjct  520  FQMDAFCLRERDLLSRFVMKVSQHQAEGQSKDYALMLSYQLAEDLGRAFSDRAMLQTFID  579

Query  349  AEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPH  170
             E +++SGSLKN+L L+RS+YA+  L+EDAAFLRYG L+TDNA+AVR E+  LCSE+RPH
Sbjct  580  TEATISSGSLKNVLGLLRSLYALTCLEEDAAFLRYGYLSTDNASAVRNEVQKLCSEIRPH  639

Query  169  ALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALALV+SFGIPD FL PIAF+WID+NAWSS+
Sbjct  640  ALALVSSFGIPDAFLGPIAFDWIDANAWSSV  670


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K E+DV  T       L  ++++  L     A+ R R L+
Sbjct  435  REACGGQGLKTENRVGHLKGEFDVQLTFEGDNNVLMQQVSKALLAEYLAAQKRNRPLQ  492



>ref|XP_002278663.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Vitis vinifera]
Length=691

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+  +++ + FKGLGLEHMN+ CPV+PS+L+S TL S QFQ
Sbjct  471  FEGDNNVLMQQVSKALLAEYIAVQKRNRPFKGLGLEHMNKSCPVVPSQLTSSTLRSSQFQ  530

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             DIFCLRER LL  FAAE+SQ QA G  +E A L SYQLAEDLGRAF+DR I  TF++AE
Sbjct  531  TDIFCLRERDLLIRFAAEMSQLQAQGLSREYALLQSYQLAEDLGRAFSDRAILQTFLDAE  590

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V+SG LK++LSL+RSM+ + IL+EDA+FLRYG L+ DNAA +RKE+  LCSELRPHAL
Sbjct  591  AAVSSGPLKSMLSLLRSMHVLIILEEDASFLRYGYLSPDNAAGIRKEVTILCSELRPHAL  650

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWID+N+WSS+
Sbjct  651  ALVSSFGIPDAFLSPIAFNWIDANSWSSV  679


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIGQ K EYDV ST       L  ++++  L      + R R  K
Sbjct  444  REACGGQGLKTENRIGQMKGEYDVQSTFEGDNNVLMQQVSKALLAEYIAVQKRNRPFK  501



>ref|XP_009621612.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X3 
[Nicotiana tomentosiformis]
Length=676

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL EYVT KR  K FKGLGLEHMN+  PV+PS+ +S  +   QFQ
Sbjct  466  FEGDNNVLMQQVSKALLGEYVTAKRSKKPFKGLGLEHMNKSRPVVPSQFTSSAMRQAQFQ  525

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVS  Q+ G+ KE AF L+YQLAEDLGRAF+DR + HTF+ AE
Sbjct  526  NDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLEAE  585

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             SV S  LKNIL LVRSMYA+  +DED AFLRYG L TDNAA VRKE+A LCSELRPHAL
Sbjct  586  ASVTSAPLKNILGLVRSMYALVTVDEDVAFLRYGYLWTDNAAMVRKEVAKLCSELRPHAL  645

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFGIPD FL PIAFNW+++N WSS
Sbjct  646  SLVSSFGIPDAFLGPIAFNWVEANVWSS  673


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+GQ K E+DV ST       L  ++++  L     AK   +  K
Sbjct  439  REACGGQGLKTENRVGQLKGEFDVQSTFEGDNNVLMQQVSKALLGEYVTAKRSKKPFK  496



>ref|XP_009621605.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X2 
[Nicotiana tomentosiformis]
Length=686

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL EYVT KR  K FKGLGLEHMN+  PV+PS+ +S  +   QFQ
Sbjct  476  FEGDNNVLMQQVSKALLGEYVTAKRSKKPFKGLGLEHMNKSRPVVPSQFTSSAMRQAQFQ  535

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVS  Q+ G+ KE AF L+YQLAEDLGRAF+DR + HTF+ AE
Sbjct  536  NDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLEAE  595

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             SV S  LKNIL LVRSMYA+  +DED AFLRYG L TDNAA VRKE+A LCSELRPHAL
Sbjct  596  ASVTSAPLKNILGLVRSMYALVTVDEDVAFLRYGYLWTDNAAMVRKEVAKLCSELRPHAL  655

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFGIPD FL PIAFNW+++N WSS
Sbjct  656  SLVSSFGIPDAFLGPIAFNWVEANVWSS  683


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+GQ K E+DV ST       L  ++++  L     AK   +  K
Sbjct  449  REACGGQGLKTENRVGQLKGEFDVQSTFEGDNNVLMQQVSKALLGEYVTAKRSKKPFK  506



>ref|XP_009621600.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X1 
[Nicotiana tomentosiformis]
Length=691

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL EYVT KR  K FKGLGLEHMN+  PV+PS+ +S  +   QFQ
Sbjct  481  FEGDNNVLMQQVSKALLGEYVTAKRSKKPFKGLGLEHMNKSRPVVPSQFTSSAMRQAQFQ  540

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVS  Q+ G+ KE AF L+YQLAEDLGRAF+DR + HTF+ AE
Sbjct  541  NDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLEAE  600

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             SV S  LKNIL LVRSMYA+  +DED AFLRYG L TDNAA VRKE+A LCSELRPHAL
Sbjct  601  ASVTSAPLKNILGLVRSMYALVTVDEDVAFLRYGYLWTDNAAMVRKEVAKLCSELRPHAL  660

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFGIPD FL PIAFNW+++N WSS
Sbjct  661  SLVSSFGIPDAFLGPIAFNWVEANVWSS  688


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+GQ K E+DV ST       L  ++++  L     AK   +  K
Sbjct  454  REACGGQGLKTENRVGQLKGEFDVQSTFEGDNNVLMQQVSKALLGEYVTAKRSKKPFK  511



>ref|XP_009783429.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X2 
[Nicotiana sylvestris]
Length=686

 Score =   310 bits (794),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL EYVT KR  K FKGLGLEHMN   PV+PS+L S  +   QFQ
Sbjct  476  FEGDNNVLMQQVSKALLGEYVTAKRSKKPFKGLGLEHMNNSRPVVPSQLKSSAMRQSQFQ  535

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVS  Q+ G+ KE AF L+YQLAEDLGRAF+DR + HTF+ AE
Sbjct  536  NDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLEAE  595

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V SG LK+IL LVRSMY +  L+ED AFLRYG L+TDNAA VRKE+A LCSELRPHAL
Sbjct  596  ATVTSGPLKDILGLVRSMYVLVTLEEDVAFLRYGYLSTDNAAVVRKEVANLCSELRPHAL  655

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFGIPD FL PIAFNW++ N WSS
Sbjct  656  SLVSSFGIPDAFLGPIAFNWVEVNVWSS  683


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+GQ K E+DV ST       L  ++++  L     AK   +  K
Sbjct  449  REACGGQGLKTENRVGQLKGEFDVQSTFEGDNNVLMQQVSKALLGEYVTAKRSKKPFK  506



>ref|XP_006446734.1| hypothetical protein CICLE_v10014502mg [Citrus clementina]
 gb|ESR59974.1| hypothetical protein CICLE_v10014502mg [Citrus clementina]
Length=671

 Score =   310 bits (793),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L FEGDNNVLMQQVSKALLAEY+  +++ +  +GLGLEHMN+PCPVIPS+L+S  L + Q
Sbjct  460  LTFEGDNNVLMQQVSKALLAEYLAAQKRNRPLQGLGLEHMNKPCPVIPSQLTSSILRTTQ  519

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
            FQ D FCLRER LL+ F  +VSQHQA G+ K+ A +LSYQLAEDLGRAF+DR +  TF++
Sbjct  520  FQMDAFCLRERDLLSRFVMKVSQHQAEGQSKDYALMLSYQLAEDLGRAFSDRAMLQTFID  579

Query  349  AEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPH  170
             E +++SGSLKN+L L+RS+YA+  L+EDAAFLRYG L+TDNA+AVR E+  LCSE+RPH
Sbjct  580  TEATISSGSLKNVLGLLRSLYALTCLEEDAAFLRYGYLSTDNASAVRNEVQKLCSEIRPH  639

Query  169  ALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALALV+SFGIPD FL PIAF+WID+N WSS+
Sbjct  640  ALALVSSFGIPDAFLGPIAFDWIDANTWSSV  670


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTEN +G  K E+DV  T       L  ++++  L     A+ R R L+
Sbjct  435  REACGGQGLKTENHVGHLKGEFDVQLTFEGDNNVLMQQVSKALLAEYLAAQKRNRPLQ  492



>ref|XP_009783430.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X3 
[Nicotiana sylvestris]
Length=686

 Score =   310 bits (793),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL EYVT KR  K FKGLGLEHMN   PV+PS+L S  +   QFQ
Sbjct  476  FEGDNNVLMQQVSKALLGEYVTAKRSKKPFKGLGLEHMNNSRPVVPSQLKSSAMRQSQFQ  535

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVS  Q+ G+ KE AF L+YQLAEDLGRAF+DR + HTF+ AE
Sbjct  536  NDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLEAE  595

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V SG LK+IL LVRSMY +  L+ED AFLRYG L+TDNAA VRKE+A LCSELRPHAL
Sbjct  596  ATVTSGPLKDILGLVRSMYVLVTLEEDVAFLRYGYLSTDNAAVVRKEVANLCSELRPHAL  655

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFGIPD FL PIAFNW++ N WSS
Sbjct  656  SLVSSFGIPDAFLGPIAFNWVEVNVWSS  683


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+GQ K E+DV ST       L  ++++  L     AK   +  K
Sbjct  449  REACGGQGLKTENRVGQLKGEFDVQSTFEGDNNVLMQQVSKALLGEYVTAKRSKKPFK  506



>ref|XP_009783428.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal isoform X1 
[Nicotiana sylvestris]
Length=691

 Score =   310 bits (793),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL EYVT KR  K FKGLGLEHMN   PV+PS+L S  +   QFQ
Sbjct  481  FEGDNNVLMQQVSKALLGEYVTAKRSKKPFKGLGLEHMNNSRPVVPSQLKSSAMRQSQFQ  540

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER LL  FAAEVS  Q+ G+ KE AF L+YQLAEDLGRAF+DR + HTF+ AE
Sbjct  541  NDIFCLRERDLLERFAAEVSLCQSQGKSKEYAFTLNYQLAEDLGRAFSDRAVLHTFLEAE  600

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V SG LK+IL LVRSMY +  L+ED AFLRYG L+TDNAA VRKE+A LCSELRPHAL
Sbjct  601  ATVTSGPLKDILGLVRSMYVLVTLEEDVAFLRYGYLSTDNAAVVRKEVANLCSELRPHAL  660

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LV+SFGIPD FL PIAFNW++ N WSS
Sbjct  661  SLVSSFGIPDAFLGPIAFNWVEVNVWSS  688


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+GQ K E+DV ST       L  ++++  L     AK   +  K
Sbjct  454  REACGGQGLKTENRVGQLKGEFDVQSTFEGDNNVLMQQVSKALLGEYVTAKRSKKPFK  511



>ref|XP_007043726.1| Acyl-CoA oxidase 3 isoform 2 [Theobroma cacao]
 gb|EOX99557.1| Acyl-CoA oxidase 3 isoform 2 [Theobroma cacao]
Length=676

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 174/209 (83%), Gaps = 1/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNN+LMQQVSKAL AEYV  ++K KAFKGLGLEHMN+PCPVIPS+L+S TL   QFQ
Sbjct  467  FEGDNNILMQQVSKALFAEYVAAQKKNKAFKGLGLEHMNKPCPVIPSQLTSATLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D  CLRER LL  F  +VSQHQA GE KE+AF++SYQLAEDL RAF+DR I+  FV AE
Sbjct  527  MDALCLRERDLLKCFVLDVSQHQAKGESKEHAFIMSYQLAEDLSRAFSDRAIFQKFVEAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK++L ++RS+YA+ I  ED AFLRYG L+ DNAAAVR+EI  +CSELRPHAL
Sbjct  587  ATLAAGSLKDVLGMLRSLYAL-ICIEDVAFLRYGYLSVDNAAAVRREITKVCSELRPHAL  645

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSP+AFNWID+N+WSS+
Sbjct  646  ALVSSFGIPDAFLSPVAFNWIDANSWSSV  674


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K E+DV ST       L  ++++        A+ + +  K
Sbjct  440  REACGGQGLKTENRVGHLKGEHDVQSTFEGDNNILMQQVSKALFAEYVAAQKKNKAFK  497



>ref|XP_007043725.1| Acyl-CoA oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOX99556.1| Acyl-CoA oxidase 3 isoform 1 [Theobroma cacao]
Length=690

 Score =   309 bits (791),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 174/209 (83%), Gaps = 1/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNN+LMQQVSKAL AEYV  ++K KAFKGLGLEHMN+PCPVIPS+L+S TL   QFQ
Sbjct  481  FEGDNNILMQQVSKALFAEYVAAQKKNKAFKGLGLEHMNKPCPVIPSQLTSATLRCSQFQ  540

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D  CLRER LL  F  +VSQHQA GE KE+AF++SYQLAEDL RAF+DR I+  FV AE
Sbjct  541  MDALCLRERDLLKCFVLDVSQHQAKGESKEHAFIMSYQLAEDLSRAFSDRAIFQKFVEAE  600

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK++L ++RS+YA+ I  ED AFLRYG L+ DNAAAVR+EI  +CSELRPHAL
Sbjct  601  ATLAAGSLKDVLGMLRSLYAL-ICIEDVAFLRYGYLSVDNAAAVRREITKVCSELRPHAL  659

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSP+AFNWID+N+WSS+
Sbjct  660  ALVSSFGIPDAFLSPVAFNWIDANSWSSV  688


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K E+DV ST       L  ++++        A+ + +  K
Sbjct  454  REACGGQGLKTENRVGHLKGEHDVQSTFEGDNNILMQQVSKALFAEYVAAQKKNKAFK  511



>ref|XP_011013710.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A oxidase 3, peroxisomal-like 
[Populus euphratica]
Length=680

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL+EY   K+K K FKGLGLEHMN P PVI S L+S TL + QFQ
Sbjct  470  FEGDNNVLMQQVSKALLSEYGAAKKKNKPFKGLGLEHMNGPVPVIQSNLTSTTLRNSQFQ  529

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             +  CLRER LLN FAAEVS +Q+ GE KE AF+LSYQLAEDLGRAF+DR I  TF++AE
Sbjct  530  MNTHCLRERDLLNRFAAEVSLYQSKGESKERAFILSYQLAEDLGRAFSDRAILQTFIDAE  589

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V++G LKN+L L+RSMYA+  L+EDAAFLRYG L+T+NAAAVR E+  LC ELRPHAL
Sbjct  590  ANVSAGPLKNVLGLLRSMYALICLEEDAAFLRYGYLSTENAAAVRNEVTKLCGELRPHAL  649

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+S GIPD FLSPIAFNWID+N+WSS+
Sbjct  650  ALVSSLGIPDAFLSPIAFNWIDANSWSSV  678



>ref|XP_003607535.1| Acyl-coenzyme A oxidase 3, peroxisomal [Medicago truncatula]
 gb|AES89732.1| peroxisomal acyl-CoA oxidase [Medicago truncatula]
Length=678

 Score =   308 bits (788),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQ+SKALLAEY+ C+ K K FKGLGLEHMN  CPVIPS+L+S T+ S +FQ
Sbjct  468  FEGDNNVLMQQISKALLAEYIACQTKNKPFKGLGLEHMNGSCPVIPSQLTSSTIKSSEFQ  527

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+F LRER LL  FAAEVS+HQ+ G  KE+AF+LSYQLAEDLGRAF++R I  TF+ AE
Sbjct  528  IDLFHLRERDLLKRFAAEVSEHQSQGNSKESAFILSYQLAEDLGRAFSERAILKTFMEAE  587

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK++L L+RS+YA+  +DEDAAFLRYG L+T+NA+AVRKE+  LC+ELRPHAL
Sbjct  588  SALPAGSLKDVLGLLRSLYALISVDEDAAFLRYGYLSTENASAVRKEVPKLCAELRPHAL  647

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV SFGIPD FLSPIA+NW++SN+WS+
Sbjct  648  ALVNSFGIPDAFLSPIAYNWVESNSWST  675


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFL  652
            REACGGQG+KTENRIGQ K EYDVHST       L  ++++  L
Sbjct  441  REACGGQGVKTENRIGQFKGEYDVHSTFEGDNNVLMQQISKALL  484



>gb|KJB50145.1| hypothetical protein B456_008G155500 [Gossypium raimondii]
Length=543

 Score =   303 bits (776),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 173/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNN+LMQQVSKAL AEY+  ++  KAFKGLGLEHMN+PCPVIPS+L++ TL   QFQ
Sbjct  334  FEGDNNILMQQVSKALFAEYMAAQKPNKAFKGLGLEHMNKPCPVIPSQLTTTTLRCSQFQ  393

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+ CLRER LLN F AEVSQ QA GE KE+AF++SYQLAEDLG+AF+DR I  TFV AE
Sbjct  394  MDVLCLRERDLLNRFVAEVSQCQAKGESKEHAFIMSYQLAEDLGKAFSDRAILQTFVEAE  453

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ + SLK++L ++RS+YA+  L ED A+LRYG L+ +NAA VR+EI  +CSELRPHAL
Sbjct  454  ATLAACSLKDVLGMLRSLYALNCL-EDGAYLRYGYLSVENAATVRREITKICSELRPHAL  512

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV+SFGIPD FLSPIAFNWID+N+WSS
Sbjct  513  ALVSSFGIPDAFLSPIAFNWIDANSWSS  540


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLAR  661
            REACGGQGLKTENR+G  K+E+DV ST       L  ++++
Sbjct  307  REACGGQGLKTENRVGHLKAEHDVQSTFEGDNNILMQQVSK  347



>gb|EYU29818.1| hypothetical protein MIMGU_mgv1a002427mg [Erythranthe guttata]
Length=676

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 171/207 (83%), Gaps = 0/207 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL EY+  K++ K FK LGL+HMN+ CP IP +L++ T+ S+QFQ
Sbjct  466  FEGDNNVLMQQVSKALLGEYLAAKKRNKPFKDLGLDHMNKSCPTIPLQLTASTVRSVQFQ  525

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDI CLRER LLN FAA+VS++QA GE KE+A + SY+LAEDLGRAF+DR I+ TFV AE
Sbjct  526  NDILCLRERDLLNHFAAQVSKYQAQGESKESAVIASYRLAEDLGRAFSDRAIFQTFVEAE  585

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V    LKNILS++RSMY +  LDEDAAFLRYG LT +NA  VRKE+A LCSE+RPHAL
Sbjct  586  NNVTDVPLKNILSVLRSMYVLVTLDEDAAFLRYGYLTVENAETVRKEVANLCSEMRPHAL  645

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWS  83
            ALVTSFGIPD FLSPIAF+WI +N+WS
Sbjct  646  ALVTSFGIPDAFLSPIAFDWIAANSWS  672


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLKD  607
            REACGGQGLKTENRIGQ K E+DV ST       L  ++++  L     AK R +  KD
Sbjct  439  REACGGQGLKTENRIGQLKGEFDVQSTFEGDNNVLMQQVSKALLGEYLAAKKRNKPFKD  497



>gb|KHN07770.1| Acyl-coenzyme A oxidase 3, peroxisomal [Glycine soja]
Length=624

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQ+SKAL AEY+ C++K K F GLGLEHMN+P PVIPS+L+S T+ S +FQ
Sbjct  415  FEGDNNVLMQQISKALFAEYIACQKKNKPFSGLGLEHMNKPLPVIPSQLTSSTVRSSEFQ  474

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+F LRER LL  FA EVS++Q+ GE KE+AF+LSYQLA DLGRAF++R I  TF+ AE
Sbjct  475  IDLFHLRERDLLRRFAEEVSEYQSRGESKESAFILSYQLAGDLGRAFSERAILKTFMEAE  534

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +G+LKN+L L+RS+YA+  +DEDAAFLRYG L+T+NA+AVRKE+  LC+E+RPHAL
Sbjct  535  STLPAGTLKNVLGLLRSLYAVICVDEDAAFLRYGYLSTENASAVRKEVPKLCAEIRPHAL  594

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV+SFGIPD FLSPIA+NW+DSN+WSS
Sbjct  595  ALVSSFGIPDAFLSPIAYNWVDSNSWSS  622



>ref|XP_003527400.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Glycine 
max]
Length=675

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQ+SKAL AEY+ C++K K F GLGLEHMN+P PVIPS+L+S T+ S +FQ
Sbjct  466  FEGDNNVLMQQISKALFAEYIACQKKNKPFSGLGLEHMNKPLPVIPSQLTSSTVRSSEFQ  525

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+F LRER LL  FA EVS++Q+ GE KE+AF+LSYQLA DLGRAF++R I  TF+ AE
Sbjct  526  IDLFHLRERDLLRRFAEEVSEYQSRGESKESAFILSYQLAGDLGRAFSERAILKTFMEAE  585

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +G+LKN+L L+RS+YA+  +DEDAAFLRYG L+T+NA+AVRKE+  LC+E+RPHAL
Sbjct  586  STLPAGTLKNVLGLLRSLYAVICVDEDAAFLRYGYLSTENASAVRKEVPKLCAEIRPHAL  645

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV+SFGIPD FLSPIA+NW+DSN+WSS
Sbjct  646  ALVSSFGIPDAFLSPIAYNWVDSNSWSS  673



>ref|XP_006592447.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Glycine max]
Length=584

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQ+SKAL AEYV  ++K K F GLGLEHMN+P PVIPS+L+S  + + +FQ
Sbjct  375  FEGDNNVLMQQISKALFAEYVASQKKKKPFSGLGLEHMNKPLPVIPSQLTSSYIRNSEFQ  434

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+F LRER LL  FA EVS++Q+ GE KE+AF+LSYQLAE+LGRAF++R I  TF+ AE
Sbjct  435  IDLFHLRERDLLRRFAEEVSEYQSRGESKESAFILSYQLAEELGRAFSERAILKTFMEAE  494

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V +GSLKN+L L+RS+YA+  +DED+AFLRYG L+T+NA+AVRKE+  LC+ELRPHAL
Sbjct  495  STVPAGSLKNVLGLLRSLYAVICVDEDSAFLRYGYLSTENASAVRKEVPKLCAELRPHAL  554

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV+SFGIPD FLSPIA+NW+DSN+WSS
Sbjct  555  ALVSSFGIPDAFLSPIAYNWVDSNSWSS  582



>ref|XP_010093490.1| Acyl-coenzyme A oxidase 3 [Morus notabilis]
 gb|EXB54129.1| Acyl-coenzyme A oxidase 3 [Morus notabilis]
Length=667

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 171/208 (82%), Gaps = 5/208 (2%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+  ++K K FKGLGLEHMN   PVIPS+L+S TLGS QFQ
Sbjct  462  FEGDNNVLMQQVSKALLAEYIAVQKKNKPFKGLGLEHMNGAHPVIPSQLTSSTLGSSQFQ  521

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN F+ EVSQHQ  G+ KE+AF+LSYQLAEDLGRAF+DR I  TF++AE
Sbjct  522  MDAFCLRERDLLNRFSMEVSQHQKHGQSKEHAFILSYQLAEDLGRAFSDRAILQTFLDAE  581

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
                  ++ ++   +RSMYA+  L+E+AAFLRYG L+ +NAAA+RKE+  LCSELRPHAL
Sbjct  582  -----ATIPDVFGKLRSMYALICLEEEAAFLRYGYLSMENAAAIRKEVTKLCSELRPHAL  636

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV+SFGIPD FLSPIAFNWIDSN+WSS
Sbjct  637  ALVSSFGIPDAFLSPIAFNWIDSNSWSS  664


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFL  652
            REACGGQGLKTENR+G  K+EYDV ST       L  ++++  L
Sbjct  435  REACGGQGLKTENRVGHMKAEYDVQSTFEGDNNVLMQQVSKALL  478



>ref|XP_011100229.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Sesamum 
indicum]
Length=678

 Score =   303 bits (775),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 169/209 (81%), Gaps = 1/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY   KRK K FK LGLEHMN+ CP+IPS+L+  T  S QFQ
Sbjct  469  FEGDNNVLMQQVSKALLAEYAAAKRKNKPFKELGLEHMNKSCPIIPSQLTVSTARSAQFQ  528

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            NDIFCLRER L+      VS++QA GE KE+AF++SYQLAEDLGRAFADR I  TF+ AE
Sbjct  529  NDIFCLRERDLI-YXXXXVSRYQAQGESKESAFIVSYQLAEDLGRAFADRAILQTFIEAE  587

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V    LKN+LSL+RSMY +  LDEDAAFLRYG LTT+NAA VRKE+A LCSE+RPHAL
Sbjct  588  NNVTDAPLKNMLSLLRSMYVLVTLDEDAAFLRYGYLTTENAATVRKEVAKLCSEIRPHAL  647

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+S GIPD FLSPIAF+W+ +N+WS +
Sbjct  648  ALVSSLGIPDAFLSPIAFDWVAANSWSPV  676


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLKD  607
            REACGGQGLKTENRIGQ K E+DV ST       L  ++++  L   + AK + +  K+
Sbjct  442  REACGGQGLKTENRIGQLKGEFDVQSTFEGDNNVLMQQVSKALLAEYAAAKRKNKPFKE  500



>gb|AAF82159.1|AC068143_1 Contains similarity to an acyl-CoA oxidase from Myxococcus xanthus 
gb|AF013216 and contains an acyl-CoA oxidase PF|01756 
domain. EST gb|AI997124 comes from this gene, partial [Arabidopsis 
thaliana]
Length=419

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN P PV+P++L+S TL   QFQ
Sbjct  211  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQ  270

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E +FLLS+QLAEDLG+AF ++ I  T ++AE
Sbjct  271  TNVFCLRERDLLEQFTSEVAQLQGRGESREFSFLLSHQLAEDLGKAFTEKAILQTILDAE  330

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  L+ED + LRYG L+ DN   VR+E++ LC ELRPHAL
Sbjct  331  AKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHAL  390

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD+FLSPIAFNW+++NAWSS+
Sbjct  391  ALVTSFGIPDSFLSPIAFNWVEANAWSSV  419



>ref|XP_008358246.1| PREDICTED: LOW QUALITY PROTEIN: acyl-coenzyme A oxidase 3, peroxisomal-like 
[Malus domestica]
Length=356

 Score =   292 bits (748),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 167/209 (80%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            +EGDNNVL+QQVSKALLAEY+  +++GK FK   LEHMN+P PVIPS+L+S TL    FQ
Sbjct  132  YEGDNNVLLQQVSKALLAEYIAAQKRGKPFKAXELEHMNKPRPVIPSQLTSSTLQCSXFQ  191

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN FA EVSQHQ  GE KE + + SYQLAEDLGRAF+DR +  TF++AE
Sbjct  192  MDAFCLRERDLLNRFAMEVSQHQKQGESKEYSVIRSYQLAEDLGRAFSDRAMLQTFIDAE  251

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ + SLKN+L+L+RSM A   L+EDAAFLRYG L+T+  AAVR E++ LC ELRPHAL
Sbjct  252  AALPAXSLKNVLALLRSMXAWICLEEDAAFLRYGYLSTNKVAAVRNEVSRLCGELRPHAL  311

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAF WI SN+WSS+
Sbjct  312  ALVSSFGIPDAFLSPIAFXWIHSNSWSSV  340


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  KSEYDV ST       L  ++++  L     A+ R +  K
Sbjct  105  REACGGQGLKTENRVGHLKSEYDVQSTYEGDNNVLLQQVSKALLAEYIAAQKRGKPFK  162



>gb|KJB50144.1| hypothetical protein B456_008G155500 [Gossypium raimondii]
Length=676

 Score =   301 bits (772),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 173/208 (83%), Gaps = 1/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNN+LMQQVSKAL AEY+  ++  KAFKGLGLEHMN+PCPVIPS+L++ TL   QFQ
Sbjct  467  FEGDNNILMQQVSKALFAEYMAAQKPNKAFKGLGLEHMNKPCPVIPSQLTTTTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+ CLRER LLN F AEVSQ QA GE KE+AF++SYQLAEDLG+AF+DR I  TFV AE
Sbjct  527  MDVLCLRERDLLNRFVAEVSQCQAKGESKEHAFIMSYQLAEDLGKAFSDRAILQTFVEAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ + SLK++L ++RS+YA+  L ED A+LRYG L+ +NAA VR+EI  +CSELRPHAL
Sbjct  587  ATLAACSLKDVLGMLRSLYALNCL-EDGAYLRYGYLSVENAATVRREITKICSELRPHAL  645

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV+SFGIPD FLSPIAFNWID+N+WSS
Sbjct  646  ALVSSFGIPDAFLSPIAFNWIDANSWSS  673


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLAR  661
            REACGGQGLKTENR+G  K+E+DV ST       L  ++++
Sbjct  440  REACGGQGLKTENRVGHLKAEHDVQSTFEGDNNILMQQVSK  480



>ref|XP_003539950.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Glycine max]
Length=675

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQ+SKAL AEYV  ++K K F GLGLEHMN+P PVIPS+L+S  + + +FQ
Sbjct  466  FEGDNNVLMQQISKALFAEYVASQKKKKPFSGLGLEHMNKPLPVIPSQLTSSYIRNSEFQ  525

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+F LRER LL  FA EVS++Q+ GE KE+AF+LSYQLAE+LGRAF++R I  TF+ AE
Sbjct  526  IDLFHLRERDLLRRFAEEVSEYQSRGESKESAFILSYQLAEELGRAFSERAILKTFMEAE  585

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V +GSLKN+L L+RS+YA+  +DED+AFLRYG L+T+NA+AVRKE+  LC+ELRPHAL
Sbjct  586  STVPAGSLKNVLGLLRSLYAVICVDEDSAFLRYGYLSTENASAVRKEVPKLCAELRPHAL  645

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV+SFGIPD FLSPIA+NW+DSN+WSS
Sbjct  646  ALVSSFGIPDAFLSPIAYNWVDSNSWSS  673



>ref|XP_004505527.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cicer 
arietinum]
Length=678

 Score =   299 bits (766),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQ+SKALLAEY+ C+ K K FKGLGLEHMN+ CP++PS+L+S  + S +FQ
Sbjct  468  FEGDNNVLMQQISKALLAEYIACQTKNKPFKGLGLEHMNKSCPIVPSQLTSSIINSSEFQ  527

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+F LRER LL  FAAEVS+HQ+ G  KE++F+LSYQLAEDLGRAF+ R I  TF+ AE
Sbjct  528  IDLFHLRERDLLMRFAAEVSEHQSHGNSKESSFILSYQLAEDLGRAFSKRAILKTFMEAE  587

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GS KN+L L+RS+YA+  +DEDAAFLRYG L+T  A+AVRKE+  LC+ELRPHAL
Sbjct  588  SNLPAGSSKNVLGLLRSLYALICVDEDAAFLRYGYLSTRKASAVRKEVPKLCAELRPHAL  647

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV SFGIPD FLSPIA+NW++SN+WS+
Sbjct  648  ALVNSFGIPDAFLSPIAYNWVESNSWSA  675


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFL  652
            REACGGQG+KTENRIGQ K EYDVHST       L  ++++  L
Sbjct  441  REACGGQGVKTENRIGQFKGEYDVHSTFEGDNNVLMQQISKALL  484



>ref|XP_004151905.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
sativus]
 gb|KGN63212.1| hypothetical protein Csa_2G415540 [Cucumis sativus]
Length=681

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAE++  K++ K FKGLGLEHMN+ CPVIPSKL+S  L S QFQ
Sbjct  462  FEGDNNVLMQQVSKALLAEFIAAKKRNKPFKGLGLEHMNKACPVIPSKLTSSILRSCQFQ  521

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN  AAEVSQ  A G  KE AF+ S+  AEDLGRAF+++ I H F+  E
Sbjct  522  TDAFCLRERDLLNRLAAEVSQDVARGNSKEYAFIQSFLFAEDLGRAFSEKAILHCFIEVE  581

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             SV SGS+KN+L L+RSMYA+  L+EDA+FLRYG L+ +N AAVR+E+  LCSE+RPHAL
Sbjct  582  NSVPSGSIKNVLGLLRSMYALICLEEDASFLRYGYLSPENVAAVRQEVKKLCSEIRPHAL  641

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV SFGIPD FL+PIA+NW++SN+WSS+
Sbjct  642  ALVNSFGIPDAFLAPIAYNWVESNSWSSV  670


 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIGQ  SE+DV ST       L  ++++  L     AK R +  K
Sbjct  435  REACGGQGLKTENRIGQLISEFDVQSTFEGDNNVLMQQVSKALLAEFIAAKKRNKPFK  492



>ref|XP_004171897.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
sativus]
Length=681

 Score =   298 bits (762),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAE++  K++ K FKGLGLEHMN+ CPVIPSKL+S  L S QFQ
Sbjct  462  FEGDNNVLMQQVSKALLAEFIAAKKRNKPFKGLGLEHMNKACPVIPSKLTSSILRSCQFQ  521

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN  AAEVSQ  A G  KE AF+ S+  AEDLGRAF+++ I H F+  E
Sbjct  522  TDAFCLRERDLLNRLAAEVSQDVARGNSKEYAFIQSFLFAEDLGRAFSEKAILHCFIEVE  581

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             SV SGS+KN+L L+RSMYA+  L+EDA+FLRYG L+ +N AAVR+E+  LCSE+RPHAL
Sbjct  582  NSVPSGSIKNVLGLLRSMYALICLEEDASFLRYGYLSPENVAAVRQEVKKLCSEIRPHAL  641

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV SFGIPD FL+PIA+NW++SN+WSS+
Sbjct  642  ALVNSFGIPDAFLAPIAYNWVESNSWSSV  670


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIGQ  SE+DV ST       L  ++++  L     AK R +  K
Sbjct  435  REACGGQGLKTENRIGQLISEFDVQSTFEGDNNVLMQQVSKALLAEFIAAKKRNKPFK  492



>ref|XP_010279215.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Nelumbo 
nucifera]
Length=684

 Score =   296 bits (759),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL+EY+  K+K K FKGLGLEHMN+ CPVIP++LSS  L S +FQ
Sbjct  474  FEGDNNVLMQQVSKALLSEYIAAKKKKKPFKGLGLEHMNDSCPVIPAQLSSSVLRSSKFQ  533

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             DIFCLRER LLN  A++V++ QA GE +E AFL+SYQLAEDL RAF++R I   F+ +E
Sbjct  534  VDIFCLRERDLLNRLASQVAERQAQGESREYAFLMSYQLAEDLARAFSERAILQNFLESE  593

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             S++ GSLKN+L L+RSMYAM  L+EDA+FLRYG ++T+N AAVRKE+  LCSELR HAL
Sbjct  594  ASLSVGSLKNVLGLLRSMYAMVSLEEDASFLRYGYMSTENDAAVRKEVMKLCSELRSHAL  653

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            +LV+SFGIPD FLSPIAFNWI+SN+WSS+
Sbjct  654  SLVSSFGIPDAFLSPIAFNWIESNSWSSV  682


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFL  652
            REACGGQGLKTENRIGQ KSE DV ST       L  ++++  L
Sbjct  447  REACGGQGLKTENRIGQLKSENDVKSTFEGDNNVLMQQVSKALL  490



>gb|KHG13766.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=675

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 170/209 (81%), Gaps = 1/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNN+LMQQ+SKALLAEYV  K++ KAF+GLGLEHMN+PCPVIPS+L+S  L S QFQ
Sbjct  466  FEGDNNILMQQISKALLAEYVAAKKRKKAFRGLGLEHMNKPCPVIPSQLTSTALRSSQFQ  525

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
                CLRER LLN FAAE+S +QA G  KE+AF +SYQ+AEDLGRAF DR+I+  F  AE
Sbjct  526  MKALCLRERDLLNRFAAEISHYQAKGLSKEHAFNMSYQIAEDLGRAFTDRSIFQAFAEAE  585

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ + SLK++L +VRS+Y + I  EDA+FLRYG L+ +NAAAVR EI  +C ELRPHAL
Sbjct  586  ATLAASSLKDVLGMVRSLYGL-ICVEDASFLRYGYLSVENAAAVRSEITKVCGELRPHAL  644

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIP  FLSPIAFNWID+N+WSS+
Sbjct  645  ALVSSFGIPHAFLSPIAFNWIDANSWSSI  673


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRAR  619
            REACGGQGL+TEN +GQ K+E+DV ST       L  ++++  L     AK R +
Sbjct  439  REACGGQGLRTENHVGQWKAEFDVQSTFEGDNNILMQQISKALLAEYVAAKKRKK  493



>gb|EMS62188.1| Acyl-coenzyme A oxidase 3, peroxisomal [Triticum urartu]
Length=349

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVL+QQVSKAL  E++T +RK K FKGLGLEH+N PCPVIP  L+SD L S +FQ
Sbjct  139  FEGDNNVLLQQVSKALYTEFLTTQRKKKPFKGLGLEHLNGPCPVIPHSLTSDILRSSKFQ  198

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER LL  FA EV+++ A GE +E A +LSYQ+AEDL RAF +RTI   F+  E
Sbjct  199  MDLFCLRERDLLKQFAEEVARYLAQGESRERALMLSYQIAEDLARAFTERTILQIFLEDE  258

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +  +GSLK++L L+RSMY M  +DE A+FLRYG L+ DN A VRKE+  LCSELRPHAL
Sbjct  259  MNAPAGSLKDVLGLLRSMYVMVCIDESASFLRYGYLSRDNVATVRKEVMILCSELRPHAL  318

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V SFGIPD FLSP+AF+WI++NA SS
Sbjct  319  AIVDSFGIPDAFLSPLAFDWIEANALSS  346


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLAR  661
            REACGGQGLKTENR+G  K+E+DV ST       L  ++++
Sbjct  112  REACGGQGLKTENRLGIFKAEFDVQSTFEGDNNVLLQQVSK  152



>ref|XP_010035824.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Eucalyptus 
grandis]
 gb|KCW47288.1| hypothetical protein EUGRSUZ_K01080 [Eucalyptus grandis]
Length=675

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQ+SK L AEY+  +++ K FKGLGLEHMN PCPV+P +L S  L S QFQ
Sbjct  465  FEGDNNVLMQQISKTLFAEYLVARKRNKPFKGLGLEHMNGPCPVLPQQLPSTVLRSDQFQ  524

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D F +RER LLN FA E+ Q QA GE KE+A L SYQLAEDLGRAF++R +   FV  E
Sbjct  525  VDAFHVRERDLLNRFAEEILQRQAQGERKEHALLSSYQLAEDLGRAFSERCVLQNFVEVE  584

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +  +GSLK++L+L+RSMYA+  ++EDA+FLRYG L+T+NAAAVRKE+A LCSELRPHAL
Sbjct  585  ENSPAGSLKDMLALLRSMYALTCMEEDASFLRYGYLSTENAAAVRKEVAKLCSELRPHAL  644

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV SFGIPD FLSPIAFNW+++N+WSS+
Sbjct  645  ALVNSFGIPDAFLSPIAFNWVEANSWSSV  673


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K E DV ST       L  ++++        A+ R +  K
Sbjct  438  REACGGQGLKTENRIGHLKGEKDVQSTFEGDNNVLMQQISKTLFAEYLVARKRNKPFK  495



>gb|KCW47289.1| hypothetical protein EUGRSUZ_K01080 [Eucalyptus grandis]
Length=678

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQ+SK L AEY+  +++ K FKGLGLEHMN PCPV+P +L S  L S QFQ
Sbjct  468  FEGDNNVLMQQISKTLFAEYLVARKRNKPFKGLGLEHMNGPCPVLPQQLPSTVLRSDQFQ  527

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D F +RER LLN FA E+ Q QA GE KE+A L SYQLAEDLGRAF++R +   FV  E
Sbjct  528  VDAFHVRERDLLNRFAEEILQRQAQGERKEHALLSSYQLAEDLGRAFSERCVLQNFVEVE  587

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +  +GSLK++L+L+RSMYA+  ++EDA+FLRYG L+T+NAAAVRKE+A LCSELRPHAL
Sbjct  588  ENSPAGSLKDMLALLRSMYALTCMEEDASFLRYGYLSTENAAAVRKEVAKLCSELRPHAL  647

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV SFGIPD FLSPIAFNW+++N+WSS+
Sbjct  648  ALVNSFGIPDAFLSPIAFNWVEANSWSSV  676


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K E DV ST       L  ++++        A+ R +  K
Sbjct  441  REACGGQGLKTENRIGHLKGEKDVQSTFEGDNNVLMQQISKTLFAEYLVARKRNKPFK  498



>ref|XP_007132685.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris]
 gb|ESW04679.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris]
Length=674

 Score =   294 bits (752),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQ+SKAL AE V C+++ K F GLGLEHMN+P P+IPS ++S  + S +FQ
Sbjct  465  FEGDNNVLMQQISKALFAENVACQKQNKPFSGLGLEHMNKPLPIIPSHVTSPIIRSSEFQ  524

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+F LRER LL  FA EVS++Q+ GE KE+AF+LSYQLAEDLGRAF++R I  TF++A 
Sbjct  525  IDLFHLRERDLLRRFAEEVSEYQSRGESKESAFILSYQLAEDLGRAFSERAILKTFMDAV  584

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLKN+L L+RS+YA+  +DEDA FLRYG L+T++A+AVRKE+  LC+ELRPHAL
Sbjct  585  STLPAGSLKNVLGLLRSLYAVISVDEDATFLRYGYLSTEDASAVRKEVPKLCAELRPHAL  644

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            ALV+SFGIPD FLSPIA+NW+DSN+WSS
Sbjct  645  ALVSSFGIPDAFLSPIAYNWVDSNSWSS  672



>gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thaliana]
Length=675

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN P PV+P++L+S TL   QFQ
Sbjct  467  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E +FLLS+QLAEDLG+AF ++ I  T ++AE
Sbjct  527  TNVFCLRERDLLEQFTSEVAQLQGRGESREFSFLLSHQLAEDLGKAFTEKAILQTILDAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  L+ED + LRYG L+ DN   VR+E++ LC ELRPHAL
Sbjct  587  AKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD+FLSPIAFNW+++NAWSS+
Sbjct  647  ALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana]
 sp|P0CZ23.1|ACOX3_ARATH RecName: Full=Acyl-coenzyme A oxidase 3, peroxisomal; Short=AOX 
3; Short=Acyl-CoA oxidase 3; AltName: Full=Medium-chain acyl-CoA 
oxidase; Short=AtCX3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF76137.1|AF253474_1 acyl-CoA oxidase [Arabidopsis thaliana]
 gb|AAM20431.1| acyl-CoA oxidase ACX3 [Arabidopsis thaliana]
 gb|AAP37772.1| At1g06290 [Arabidopsis thaliana]
 dbj|BAD44020.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27972.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana]
Length=675

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN P PV+P++L+S TL   QFQ
Sbjct  467  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E +FLLS+QLAEDLG+AF ++ I  T ++AE
Sbjct  527  TNVFCLRERDLLEQFTSEVAQLQGRGESREFSFLLSHQLAEDLGKAFTEKAILQTILDAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  L+ED + LRYG L+ DN   VR+E++ LC ELRPHAL
Sbjct  587  AKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD+FLSPIAFNW+++NAWSS+
Sbjct  647  ALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>gb|EPS63701.1| hypothetical protein M569_11080, partial [Genlisea aurea]
Length=352

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY    +K K +K LGL+HMNEP PVIPS+L+S T+ S +FQ
Sbjct  148  FEGDNNVLMQQVSKALLAEYAAANKKKKPYKELGLDHMNEPRPVIPSQLTSSTIRSSRFQ  207

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             DI CLRER LL+ FAAEV ++QA GE KE+A + SYQLAEDLGRAF+DR+I+  F  AE
Sbjct  208  KDILCLRERDLLDRFAAEVWRYQAQGESKESASMASYQLAEDLGRAFSDRSIFRCFTEAE  267

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +++  SLK ++S+VR++Y  A LDEDAAFLRYG L T++AAAVR+E+  LC E+RPHAL
Sbjct  268  NNLSDPSLKRMVSVVRTLYVAATLDEDAAFLRYGYLNTESAAAVREEMPKLCGEVRPHAL  327

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNA  89
             LVT+FGIPD FLSPIAF+W+ +N+
Sbjct  328  PLVTAFGIPDAFLSPIAFDWVAANS  352


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLKD  607
            REACGGQGLKTENRIGQ K+E+DV ST       L  ++++  L   + A  + +  K+
Sbjct  121  REACGGQGLKTENRIGQLKAEFDVQSTFEGDNNVLMQQVSKALLAEYAAANKKKKPYKE  179



>ref|XP_002889597.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65856.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   291 bits (746),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEH+N P PV+P++L+S TL   QFQ
Sbjct  467  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHLNSPRPVLPTQLTSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E +FLLS+QLAEDLG+AF ++ I  T ++AE
Sbjct  527  TNVFCLRERDLLERFTSEVAQLQGRGESREFSFLLSHQLAEDLGKAFTEKAILQTILDAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  L+ED + LRYG L+ DN   VR+E++ LC ELRPHAL
Sbjct  587  AKLPAGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD+FLSPIAFNW+++NAWSS+
Sbjct  647  ALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>ref|XP_010916040.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Elaeis 
guineensis]
Length=747

 Score =   293 bits (750),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNN+LMQQVSKALL EY+  +++ K FKGLGLEHMN+PCPVIP+ L+S TL SI FQ
Sbjct  536  FEGDNNILMQQVSKALLGEYIAVQKRKKPFKGLGLEHMNDPCPVIPTNLTSCTLRSITFQ  595

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER LLN FA+EVSQ+Q  GE KENA  LSYQLAE+L RAF +R I  TF++ E
Sbjct  596  TDLFCLRERDLLNRFASEVSQYQNHGESKENAVNLSYQLAEELARAFTERKILQTFMDTE  655

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +G LK++L L+RSMYA+  ++EDA+F+RYG L+  NAAAVRKE+  LC+++RPHAL
Sbjct  656  MTLPAGPLKDVLGLLRSMYALICVEEDASFIRYGYLSLSNAAAVRKEVMRLCTDVRPHAL  715

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            A+V SFGIPD FLSP+AF+WI++N+WS L
Sbjct  716  AVVNSFGIPDAFLSPLAFDWIEANSWSFL  744


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K E+DV ST       L  ++++  L      + R +  K
Sbjct  509  REACGGQGLKTENRIGILKGEFDVQSTFEGDNNILMQQVSKALLGEYIAVQKRKKPFK  566



>ref|XP_010522108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Tarenaya hassleriana]
Length=680

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL +EYV+CK++ K FKGLGLEHMN P PV+PS+L+S TL   QFQ
Sbjct  468  FEGDNNVLMQQVSKALFSEYVSCKKRNKPFKGLGLEHMNSPRPVLPSQLTSSTLRCSQFQ  527

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F+AEVSQHQ  GE +E +F+ ++QLAEDLGRAFA++ I  T + AE
Sbjct  528  TNVFCLRERDLLERFSAEVSQHQGKGESREYSFMQNHQLAEDLGRAFAEKAILQTILEAE  587

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L +VR+MY +  ++EDA+FLRY  L+TD   AVR+E++ LC E+RPHAL
Sbjct  588  AKLPAGSVKDVLGMVRAMYGLICIEEDASFLRYEYLSTDGIGAVRREVSKLCGEMRPHAL  647

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            +LVTSFG PD+FLSPIAFNW+++NAW S
Sbjct  648  SLVTSFGFPDSFLSPIAFNWVEANAWPS  675



>ref|XP_008455941.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Cucumis 
melo]
Length=677

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAE++  K+  K FKGLGLEHMNE CPVIPSKL+S  L S QFQ
Sbjct  462  FEGDNNVLMQQVSKALLAEFIAAKKTNKPFKGLGLEHMNEACPVIPSKLTSSILRSCQFQ  521

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLNL AAEVS++ + G  KE A + S+ +AEDLGRAF+++ I   F+  E
Sbjct  522  TDAFCLRERDLLNLLAAEVSRYVSLGNSKEYAIIQSFLVAEDLGRAFSEKAILLYFIKVE  581

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             SV SGS+KN+L L+RSMYA+  L+EDA+FLRYG L+ +N AAVR+E+  LC E+RPHAL
Sbjct  582  NSVPSGSIKNVLGLLRSMYALICLEEDASFLRYGYLSPENIAAVRQEVKKLCGEIRPHAL  641

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FL+PIA+NW++SN+WSS+
Sbjct  642  ALVSSFGIPDAFLAPIAYNWVESNSWSSV  670


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIGQ  SE+DV ST       L  ++++  L     AK   +  K
Sbjct  435  REACGGQGLKTENRIGQLISEFDVQSTFEGDNNVLMQQVSKALLAEFIAAKKTNKPFK  492



>gb|KJB31620.1| hypothetical protein B456_005G198300 [Gossypium raimondii]
Length=674

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 172/209 (82%), Gaps = 1/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNN+LMQQ+SKALLAEYV  K++ KAFKGLGLEHMN+PCPVIPS+L+S  L S QFQ
Sbjct  465  FEGDNNILMQQISKALLAEYVAAKKRKKAFKGLGLEHMNKPCPVIPSQLTSTALRSSQFQ  524

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D  CLRER LLN FAAE+S +QA G  KE+AF +SYQ+AEDLGRAF DR+I+  F  AE
Sbjct  525  MDALCLRERDLLNRFAAEISHYQAKGPSKEHAFNMSYQIAEDLGRAFTDRSIFQAFAEAE  584

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ + SLK++L +VRS+Y + I  EDA+FLRYG L+ +NAAAVR EI  +C ELRPHAL
Sbjct  585  ATLAASSLKDVLGMVRSLYGL-ICVEDASFLRYGYLSVENAAAVRSEITKVCGELRPHAL  643

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSPIAFNWID+N+WSS+
Sbjct  644  ALVSSFGIPDAFLSPIAFNWIDANSWSSI  672


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFL  652
            REACGGQGL+TEN +GQ K+E+DV ST       L  ++++  L
Sbjct  438  REACGGQGLRTENHVGQWKAEFDVQSTFEGDNNILMQQISKALL  481



>ref|XP_008784451.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Phoenix 
dactylifera]
Length=689

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALL EY+  +++ K FKGLGLEHMN+P PV+P+ L+S TL SI FQ
Sbjct  478  FEGDNNVLMQQVSKALLGEYIAVQKRKKPFKGLGLEHMNDPSPVVPANLTSCTLRSIMFQ  537

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER LLN FA+EVSQ+Q  GE K NA  LSYQLAE+L RAF +R I  TF++ E
Sbjct  538  TDLFCLRERDLLNRFASEVSQYQNHGESKVNAVNLSYQLAEELARAFTERRILQTFMDTE  597

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +G+LK++  L+RSMYA+  ++EDA+FLRYG L+  NAAAVRKE+  LC++LRPH L
Sbjct  598  MTLPAGALKDVFGLLRSMYALICVEEDASFLRYGYLSLGNAAAVRKEVMKLCTDLRPHVL  657

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            A+V+SFGIPD FLSPIAF+WI++N+WS L
Sbjct  658  AVVSSFGIPDAFLSPIAFDWIEANSWSFL  686


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K EYDV ST       L  ++++  L      + R +  K
Sbjct  451  REACGGQGLKTENRIGILKGEYDVQSTFEGDNNVLMQQVSKALLGEYIAVQKRKKPFK  508



>ref|NP_001057591.1| Os06g0354500 [Oryza sativa Japonica Group]
 dbj|BAD35410.1| putative acyl-CoA oxidase ACX3 [Oryza sativa Japonica Group]
 dbj|BAF19505.1| Os06g0354500 [Oryza sativa Japonica Group]
 dbj|BAG90186.1| unnamed protein product [Oryza sativa Japonica Group]
Length=685

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++T KRK + FKGLGLEH+N PCPVIP  L+S TL S  FQ
Sbjct  475  FEGDNNVLMQQVSKALYAEFLTAKRKNQPFKGLGLEHLNGPCPVIPDYLTSGTLRSSSFQ  534

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+ CLRER LL  F  EVS + A GE +E A +LSYQLAEDL RAF +RTI   F+  E
Sbjct  535  MDLLCLRERDLLKRFTTEVSNYLAQGENREKALMLSYQLAEDLARAFTERTILQIFLEDE  594

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK+IL L+RS+Y M  +DE A+FLRYGCL+ +N AA RKE+ TLCSELRPHAL
Sbjct  595  KNIPTGSLKDILGLLRSLYVMVCIDESASFLRYGCLSRENVAAARKEVMTLCSELRPHAL  654

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V+SFGIPD FLSP+AF+WI++NA SS
Sbjct  655  AIVSSFGIPDAFLSPLAFDWIEANARSS  682


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K+E+DV ST       L  ++++        AK + +  K
Sbjct  448  REACGGQGLKTENRIGIFKAEFDVQSTFEGDNNVLMQQVSKALYAEFLTAKRKNQPFK  505



>gb|EAZ00875.1| hypothetical protein OsI_22900 [Oryza sativa Indica Group]
Length=688

 Score =   288 bits (736),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++T KRK + FKGLGLEH+N PCPVIP  L+S TL S  FQ
Sbjct  478  FEGDNNVLMQQVSKALYAEFLTAKRKNQPFKGLGLEHLNGPCPVIPDYLTSGTLRSSSFQ  537

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+ CLRER LL  F  EVS + A GE +E A +LSYQLAEDL RAF +RTI   F+  E
Sbjct  538  MDLLCLRERDLLKRFTTEVSNYLAQGENREKALMLSYQLAEDLARAFTERTILQIFLEDE  597

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK+IL L+RS+Y M  +DE A+FLRYGCL+ +N AA RKE+ TLCSELRPHAL
Sbjct  598  KNIPTGSLKDILGLLRSLYVMVCIDESASFLRYGCLSRENVAAARKEVMTLCSELRPHAL  657

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V+SFGIPD FLSP+AF+WI++NA SS
Sbjct  658  AIVSSFGIPDAFLSPLAFDWIEANARSS  685


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K+E+DV ST       L  ++++        AK + +  K
Sbjct  451  REACGGQGLKTENRIGIFKAEFDVQSTFEGDNNVLMQQVSKALYAEFLTAKRKNQPFK  508



>gb|EAZ36947.1| hypothetical protein OsJ_21282 [Oryza sativa Japonica Group]
Length=685

 Score =   288 bits (736),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++T KRK + FKGLGLEH+N PCPVIP  L+S TL S  FQ
Sbjct  475  FEGDNNVLMQQVSKALYAEFLTAKRKNQPFKGLGLEHLNGPCPVIPDYLTSGTLRSSSFQ  534

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+ CLRER LL  F  EVS + A GE +E A +LSYQLAEDL RAF +RTI   F+  E
Sbjct  535  MDLLCLRERDLLKRFTTEVSNYLAQGENREKALMLSYQLAEDLARAFTERTILQIFLEDE  594

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK+IL L+RS+Y M  +DE A+FLRYGCL+ +N AA RKE+ TLCSELRPHAL
Sbjct  595  KNIPTGSLKDILGLLRSLYVMVCIDESASFLRYGCLSRENVAAARKEVMTLCSELRPHAL  654

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V+SFGIPD FLSP+AF+WI++NA SS
Sbjct  655  AIVSSFGIPDAFLSPLAFDWIEANARSS  682


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K+E+DV ST       L  ++++        AK + +  K
Sbjct  448  REACGGQGLKTENRIGIFKAEFDVQSTFEGDNNVLMQQVSKALYAEFLTAKRKNQPFK  505



>ref|XP_011013714.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Populus 
euphratica]
Length=643

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  673  QVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQNDIFCLRERH  494
            +VSKALL+EYV  K+K K FKGLGLEHMN P PVI S L+S TL + QFQ ++ CLRER 
Sbjct  443  RVSKALLSEYVAAKKKNKPFKGLGLEHMNGPVPVIQSNLTSTTLRNSQFQMNVHCLRERD  502

Query  493  LLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAEPSVNSGSLKN  314
            LLN FAAE S +Q+ GE KE AF+LSYQLAEDLGRAF+DR I  TF++AE +V++  LKN
Sbjct  503  LLNRFAAEASLYQSKGESKERAFILSYQLAEDLGRAFSDRAILQTFIDAEANVSASPLKN  562

Query  313  ILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPD  134
            +L L+RSMYA+  L+EDAAFLRYG L+TDNAAAVR E+  LC ELRPHALALV+S GIPD
Sbjct  563  VLGLLRSMYALICLEEDAAFLRYGYLSTDNAAAVRNEVTKLCGELRPHALALVSSLGIPD  622

Query  133  TFLSPIAFNWIDSNAWSSL  77
             FLSPIAFNWID+N+WSS+
Sbjct  623  AFLSPIAFNWIDANSWSSV  641



>ref|XP_009405080.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=683

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 166/209 (79%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+   ++   FKGLGLEHMN+PCP+IPS L+S TL S +FQ
Sbjct  472  FEGDNNVLMQQVSKALLAEYIAAHKRKSPFKGLGLEHMNDPCPIIPSNLNSCTLRSSKFQ  531

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER L   +A EVSQ+QA GE KE A LLSYQLA DL RAFA+R+I   F++ E
Sbjct  532  LDLFCLRERDLFGRYANEVSQYQAQGETKEKAVLLSYQLAGDLARAFAERSILQIFIDDE  591

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +  +G LK+IL L+RSMYA+   +EDA+FLRYG L+ DNAA  RKE+  LC ELRPHAL
Sbjct  592  MAQPAGPLKDILGLLRSMYALICTEEDASFLRYGYLSLDNAAVARKEVMKLCYELRPHAL  651

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ++V+SFGIPD FLSPIAF+WI +N+WSSL
Sbjct  652  SVVSSFGIPDAFLSPIAFDWIQANSWSSL  680


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K EYDV ST       L  ++++  L     A  R    K
Sbjct  445  REACGGQGLKTENRVGILKGEYDVQSTFEGDNNVLMQQVSKALLAEYIAAHKRKSPFK  502



>ref|XP_006306351.1| hypothetical protein CARUB_v10012245mg [Capsella rubella]
 gb|EOA39249.1| hypothetical protein CARUB_v10012245mg [Capsella rubella]
Length=675

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN   P +P++L+S TL   QFQ
Sbjct  467  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNSSRPELPTQLTSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E +FLLS+QLAEDLG+AF ++ I  T ++AE
Sbjct  527  TNVFCLRERDLLERFTSEVAQLQGRGESREISFLLSHQLAEDLGKAFTEKAILQTILDAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  L+ED + LRYG L+ DN   VR+E++ LC ELRPHAL
Sbjct  587  AKLPAGSVKDVLGLVRSMYALISLEEDPSMLRYGYLSRDNVGDVRREVSKLCKELRPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD+FLSPIAFNW+++NAWSS+
Sbjct  647  ALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>emb|CDY10192.1| BnaC05g04350D [Brassica napus]
Length=677

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K F+GLGLEHMN   PV+P++LSS TL   QFQ
Sbjct  469  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFRGLGLEHMNSSRPVLPTQLSSSTLRCSQFQ  528

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E++FL++++LAEDLG+AF ++ I  T ++AE
Sbjct  529  KNVFCLRERDLLERFTSEVAQLQGRGESRESSFLVNHELAEDLGKAFTEKAILQTILDAE  588

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GSLK++L LVRSMYA+  ++ED +FLRYG L+ DN   VR+E++ LC E+RPHAL
Sbjct  589  AKLPAGSLKDVLGLVRSMYALISIEEDPSFLRYGYLSRDNVGDVRREVSKLCGEVRPHAL  648

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD FL PIAFNW+++NAWSS+
Sbjct  649  ALVTSFGIPDAFLGPIAFNWVEANAWSSV  677



>ref|XP_006417937.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum]
 gb|ESQ36290.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum]
Length=675

 Score =   286 bits (731),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN P PV+P++L+S TL   QFQ
Sbjct  467  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E +FL+++Q+AEDLG+AF ++ I  T ++ E
Sbjct  527  TNVFCLRERDLLERFTSEVAQLQGRGESRELSFLVNHQIAEDLGKAFTEKAILQTILDTE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              +++G +K++L LVRSMYA+  L+ED + LRYG L+ DN   VR+E++ LC ELRPHAL
Sbjct  587  AKLSAGPVKDVLGLVRSMYALICLEEDPSLLRYGYLSRDNVGDVRREVSKLCGELRPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD FL+PIAFNW+++NAWSS+
Sbjct  647  ALVTSFGIPDAFLAPIAFNWVEANAWSSV  675



>ref|XP_010485961.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Camelina sativa]
Length=623

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 167/209 (80%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN   PV+P++L+S TL   QFQ
Sbjct  415  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNSSRPVLPTQLTSSTLRCSQFQ  474

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E +FL S+QLAEDLG+AF ++ I  T ++AE
Sbjct  475  TNVFCLRERDLLEQFTSEVAQLQGRGESREISFLQSHQLAEDLGKAFTEKAILQTILDAE  534

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMY +  L+ED + LRYG L+ +N   VR+E++ LC ELRPHAL
Sbjct  535  AKLPAGSVKDVLGLVRSMYTLISLEEDPSLLRYGYLSRENVGDVRREVSKLCGELRPHAL  594

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD+FLSPIAFNW+++NAWSS+
Sbjct  595  ALVTSFGIPDSFLSPIAFNWVEANAWSSV  623



>ref|XP_009119069.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal [Brassica rapa]
 emb|CDY57818.1| BnaA10g28060D [Brassica napus]
Length=675

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K F+GLGLEHMN   PV+P++LSS TL   QFQ
Sbjct  467  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFRGLGLEHMNSSRPVLPTQLSSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E++FL++++LAEDLG+AF ++ I  T ++AE
Sbjct  527  KNVFCLRERDLLERFTSEVAQLQGRGESRESSFLVNHELAEDLGKAFTEKAILQTILDAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  ++ED +FLRYG L+ DN   VR+E++ LC ELRPHAL
Sbjct  587  AKLPAGSMKDVLGLVRSMYALISIEEDPSFLRYGYLSRDNVGDVRREVSKLCGELRPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FL PIAFNW+++NAWSS+
Sbjct  647  ALVSSFGIPDAFLGPIAFNWVEANAWSSV  675



>ref|XP_010475360.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Camelina 
sativa]
Length=676

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN   PV+P++L+S TL   QFQ
Sbjct  468  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNGSRPVLPTQLTSSTLRCSQFQ  527

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +E++Q Q  GE +E +FL S+QLAEDLG+AF ++ I  T ++AE
Sbjct  528  TNVFCLRERDLLEQFTSEIAQLQGRGESREISFLQSHQLAEDLGKAFTEKAILQTILDAE  587

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  L+ED + LRYG L+ +N   VR+E++ LC ELRPHAL
Sbjct  588  AKLPAGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSRENVGDVRREVSKLCGELRPHAL  647

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD+FLSPIAFNW+++NAWSS+
Sbjct  648  ALVTSFGIPDSFLSPIAFNWVEANAWSSV  676



>ref|XP_010457756.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Camelina 
sativa]
Length=675

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN   PV+P++L+S TL   QFQ
Sbjct  467  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNTSRPVLPTQLTSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F +EV+Q Q  GE +E +FL S+QLAEDLG+AF ++ +  T ++AE
Sbjct  527  TNVFCLRERDLLERFTSEVAQLQGRGESREISFLQSHQLAEDLGKAFTEKALLQTILDAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  L+ED + LRYG L+ +N   VR+E++ LC ELRPHAL
Sbjct  587  AKLPAGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSRENVGDVRREVSKLCGELRPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD+FLSPIAFNW+++NAWSS+
Sbjct  647  ALVTSFGIPDSFLSPIAFNWVEANAWSSV  675



>gb|KFK42952.1| hypothetical protein AALP_AA1G060500 [Arabis alpina]
Length=675

 Score =   284 bits (727),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN   PV+P++L+S TL   QFQ
Sbjct  467  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNSSRPVLPTQLTSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
            +++FCLRER LL  F +EV+Q Q  GE +E++FL+++QLAEDLG+AF ++ I  T ++AE
Sbjct  527  SNVFCLRERDLLERFTSEVAQLQGRGESRESSFLVTHQLAEDLGKAFTEKAILKTILDAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  L+ED + LRYG L+ DN   VR+E++ LC EL+PHAL
Sbjct  587  VKLPAGSVKDVLGLVRSMYALICLEEDPSLLRYGYLSRDNVGDVRREVSKLCGELKPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV SFGIPD FLSPIAFNW+++NAWSS+
Sbjct  647  ALVDSFGIPDAFLSPIAFNWVEANAWSSV  675



>ref|XP_006417936.1| hypothetical protein EUTSA_v10009440mg, partial [Eutrema salsugineum]
 gb|ESQ36289.1| hypothetical protein EUTSA_v10009440mg, partial [Eutrema salsugineum]
Length=648

 Score =   283 bits (725),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 165/209 (79%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN   PV+P++L+S TL   QFQ
Sbjct  440  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNSSRPVLPTQLTSSTLRCSQFQ  499

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++F LRER LL  + +EV+Q Q  GE +E +FLL++QL+EDL RAF ++ I  TF++AE
Sbjct  500  KNVFSLRERDLLERYTSEVAQLQGRGESREFSFLLNHQLSEDLSRAFTEKAILQTFLDAE  559

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K++L LVRSMYA+  L+ED + LRYG L+ DN   VR+E++ LC ELRPHAL
Sbjct  560  AKIRAGSIKDVLGLVRSMYALICLEEDPSLLRYGYLSRDNVGDVRREVSKLCGELRPHAL  619

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD FL PIAFNW+D NAWSS+
Sbjct  620  ALVTSFGIPDAFLGPIAFNWVDVNAWSSV  648



>ref|XP_006656066.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like, partial 
[Oryza brachyantha]
Length=647

 Score =   283 bits (723),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++  KRK + FKGLGLEH+N PCPVIP  L+S  L S  FQ
Sbjct  437  FEGDNNVLMQQVSKALYAEFLAAKRKNQPFKGLGLEHLNGPCPVIPDYLTSGILRSSNFQ  496

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+ CLRER LL  F  EVS H A G+ +E A +LSYQLAEDL RAF +RTI   F+  E
Sbjct  497  MDLLCLRERDLLKQFTTEVSNHLAQGKSREKALMLSYQLAEDLARAFTERTILQIFLEDE  556

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK+IL L+RS+Y M  +DE A+FLRYGCL+ +N AA RKE+ TLCSELRPHAL
Sbjct  557  KNIPTGSLKDILGLLRSLYVMVCIDESASFLRYGCLSKENVAAARKEVMTLCSELRPHAL  616

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWS  83
            A+V+SFGIPD FLSP+AF+WI++NA S
Sbjct  617  AIVSSFGIPDAFLSPLAFDWIEANARS  643


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K+E+DV ST       L  ++++        AK + +  K
Sbjct  410  REACGGQGLKTENRIGIFKAEFDVQSTFEGDNNVLMQQVSKALYAEFLAAKRKNQPFK  467



>gb|EMT28672.1| Acyl-coenzyme A oxidase 3, peroxisomal [Aegilops tauschii]
Length=594

 Score =   281 bits (720),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVL+QQVSKAL AE++T +RK K+FKGLGLEH+N PCPVIP  L+S  L S +FQ
Sbjct  384  FEGDNNVLLQQVSKALYAEFLTTQRKKKSFKGLGLEHLNGPCPVIPHSLTSVILRSSKFQ  443

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER LL  FA EV++H A GE +E A +LSYQ+AEDL RAF +RTI   F+  E
Sbjct  444  MDLFCLRERDLLKQFAEEVARHLAQGESRERALMLSYQIAEDLARAFTERTILQIFLEDE  503

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +  +GSLK++L L+RSMY M  +DE A+FLRYG L+ DN   VRKE+  LCSELRPHAL
Sbjct  504  MNAPAGSLKDVLVLLRSMYVMVCIDESASFLRYGYLSRDNVTTVRKEVMILCSELRPHAL  563

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V SFGIPD FLSP+AF+WI++NA SS
Sbjct  564  AIVGSFGIPDAFLSPLAFDWIEANALSS  591


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLAR  661
            REACGGQGLKTENR+G  K+E+DV ST       L  ++++
Sbjct  357  REACGGQGLKTENRVGIFKAEFDVQSTFEGDNNVLLQQVSK  397



>gb|KHG26832.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=670

 Score =   283 bits (724),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDN +LMQQVSKAL AEY+  +++ K FKGLGLEHMN+PCPVIP +L+S TL   QFQ
Sbjct  463  FEGDNLILMQQVSKALFAEYMAAQKRNKVFKGLGLEHMNKPCPVIPLQLTSTTLRCSQFQ  522

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D  CLRER LLN F A+VS+ +A GE  E AF++ Y+LA+DLG+AF+DR I+ TFV+AE
Sbjct  523  MDALCLRERDLLNRFVADVSKCKAKGESSEQAFMICYELAQDLGKAFSDRAIFQTFVDAE  582

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK++L  +RS+YA+ I  ED +FL+YG L+ DN A VR+EI  LC+ELRPHAL
Sbjct  583  TTLPAGSLKDVLGTLRSLYAL-ICIEDVSFLQYGYLSVDNGANVRREITKLCTELRPHAL  641

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FL PIAFNWI++NAWSS+
Sbjct  642  ALVSSFGIPDAFLGPIAFNWIEANAWSSV  670


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+GQ K EYDV ST     + L  ++++        A+ R +  K
Sbjct  436  REACGGQGLKTENRVGQLKGEYDVQSTFEGDNLILMQQVSKALFAEYMAAQKRNKVFK  493



>gb|KJB12478.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
 gb|KJB12479.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
Length=694

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 168/209 (80%), Gaps = 1/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDN +LMQQVSKAL AEY+  +++ K FKGLGLEHMN+PCPVIP +L+S TL   QFQ
Sbjct  487  FEGDNLILMQQVSKALFAEYMAAQKRNKVFKGLGLEHMNKPCPVIPLQLTSTTLRCSQFQ  546

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D  CLRER LLN F A+VS+ +A GE  E AF++ Y+LA+DLG+AF+DR I+ TFV+AE
Sbjct  547  MDALCLRERDLLNRFVADVSKCKAKGESNEQAFMMCYELAQDLGKAFSDRAIFQTFVDAE  606

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK++L  +RS+YA+ I  ED +FL+YG L+ DN A VR+EI  LC+ELRPHAL
Sbjct  607  TTLPAGSLKDVLGTLRSLYAL-ICIEDVSFLQYGYLSVDNGANVRREITKLCTELRPHAL  665

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FL PIAFNWI++NAWSS+
Sbjct  666  ALVSSFGIPDAFLGPIAFNWIEANAWSSV  694


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+GQ K EYDV ST     + L  ++++        A+ R +  K
Sbjct  460  REACGGQGLKTENRVGQLKGEYDVQSTFEGDNLILMQQVSKALFAEYMAAQKRNKVFK  517



>ref|XP_010689759.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 166/211 (79%), Gaps = 0/211 (0%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L FEGDNNVLMQQVSKAL  EY+  +++ + FKGL LEHMN   P+IP +L+   L S Q
Sbjct  452  LTFEGDNNVLMQQVSKALFGEYMATQKQNRPFKGLWLEHMNSSSPIIPDQLTGSILRSSQ  511

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
             Q DIF LRER LL+ F AEVS +Q  G  +E+AF+L+YQLAEDLGRAFAD+ +  TF+ 
Sbjct  512  IQTDIFYLRERDLLHRFVAEVSAYQKQGRNREHAFVLAYQLAEDLGRAFADKAVLLTFIE  571

Query  349  AEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPH  170
            AE  V  G LK++L+L+R++YA+ +L+ED +FLRYG LT +NAA VR+E+  LCSELRPH
Sbjct  572  AEAKVPVGPLKDVLALLRTLYALIVLEEDVSFLRYGYLTVENAAVVRQEVIRLCSELRPH  631

Query  169  ALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALALV+SFGIPD FLSPIAF+WID+N+WSS+
Sbjct  632  ALALVSSFGIPDAFLSPIAFDWIDANSWSSV  662


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLAR  661
            REACGGQGLKTENR+G  K EYDV  T       L  ++++
Sbjct  427  REACGGQGLKTENRVGHLKGEYDVQLTFEGDNNVLMQQVSK  467



>ref|XP_010689760.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=688

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 166/211 (79%), Gaps = 0/211 (0%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L FEGDNNVLMQQVSKAL  EY+  +++ + FKGL LEHMN   P+IP +L+   L S Q
Sbjct  476  LTFEGDNNVLMQQVSKALFGEYMATQKQNRPFKGLWLEHMNSSSPIIPDQLTGSILRSSQ  535

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
             Q DIF LRER LL+ F AEVS +Q  G  +E+AF+L+YQLAEDLGRAFAD+ +  TF+ 
Sbjct  536  IQTDIFYLRERDLLHRFVAEVSAYQKQGRNREHAFVLAYQLAEDLGRAFADKAVLLTFIE  595

Query  349  AEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPH  170
            AE  V  G LK++L+L+R++YA+ +L+ED +FLRYG LT +NAA VR+E+  LCSELRPH
Sbjct  596  AEAKVPVGPLKDVLALLRTLYALIVLEEDVSFLRYGYLTVENAAVVRQEVIRLCSELRPH  655

Query  169  ALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALALV+SFGIPD FLSPIAF+WID+N+WSS+
Sbjct  656  ALALVSSFGIPDAFLSPIAFDWIDANSWSSV  686


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLAR  661
            REACGGQGLKTENR+G  K EYDV  T       L  ++++
Sbjct  451  REACGGQGLKTENRVGHLKGEYDVQLTFEGDNNVLMQQVSK  491



>ref|XP_010689758.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=686

 Score =   282 bits (721),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 166/211 (79%), Gaps = 0/211 (0%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L FEGDNNVLMQQVSKAL  EY+  +++ + FKGL LEHMN   P+IP +L+   L S Q
Sbjct  474  LTFEGDNNVLMQQVSKALFGEYMATQKQNRPFKGLWLEHMNSSSPIIPDQLTGSILRSSQ  533

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
             Q DIF LRER LL+ F AEVS +Q  G  +E+AF+L+YQLAEDLGRAFAD+ +  TF+ 
Sbjct  534  IQTDIFYLRERDLLHRFVAEVSAYQKQGRNREHAFVLAYQLAEDLGRAFADKAVLLTFIE  593

Query  349  AEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPH  170
            AE  V  G LK++L+L+R++YA+ +L+ED +FLRYG LT +NAA VR+E+  LCSELRPH
Sbjct  594  AEAKVPVGPLKDVLALLRTLYALIVLEEDVSFLRYGYLTVENAAVVRQEVIRLCSELRPH  653

Query  169  ALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALALV+SFGIPD FLSPIAF+WID+N+WSS+
Sbjct  654  ALALVSSFGIPDAFLSPIAFDWIDANSWSSV  684


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLAR  661
            REACGGQGLKTENR+G  K EYDV  T       L  ++++
Sbjct  449  REACGGQGLKTENRVGHLKGEYDVQLTFEGDNNVLMQQVSK  489



>ref|NP_172120.2| putative acyl-CoA oxidase [Arabidopsis thaliana]
 sp|Q9LMI7.1|ACO32_ARATH RecName: Full=Putative acyl-coenzyme A oxidase 3.2, peroxisomal; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82160.1|AC068143_2 Contains similarity to an acyl-CoA oxidase (ASX2) mRNA from Arabidopsis 
thaliana gb|AF057043 and contains an acyl-CoA oxidase 
PF|01756 domain [Arabidopsis thaliana]
 gb|AEE27973.1| acyl-CoA oxidase [Arabidopsis thaliana]
Length=675

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 163/209 (78%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQ VSKAL AEYV+CK++ K FKGLGLEHMN P PV+P++L+S TL   QFQ
Sbjct  467  FEGDNNVLMQLVSKALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
              +FCLRER LL  F +EV++ Q  GE +E  FLL++QL+EDL +AF ++ I  T ++AE
Sbjct  527  KSVFCLRERDLLERFTSEVAELQGRGESREFLFLLNHQLSEDLSKAFTEKAILQTVLDAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              +  GS+K++L LVRSMYA+  L+ED + LRYG L+ DN   VRKE++ LC ELRPHAL
Sbjct  587  AKLPPGSVKDVLGLVRSMYALISLEEDPSLLRYGHLSRDNVGDVRKEVSKLCGELRPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV SFGIPD FLSPIAFNW+++NAWSSL
Sbjct  647  ALVASFGIPDAFLSPIAFNWVEANAWSSL  675



>ref|XP_003573815.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Brachypodium 
distachyon]
Length=686

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 161/208 (77%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVL+QQVSKAL AE++  +RK K FKGLGLEH+N PCP+IP  L+S  L S +FQ
Sbjct  476  FEGDNNVLLQQVSKALYAEFIATQRKKKPFKGLGLEHLNGPCPIIPDSLTSGILRSSKFQ  535

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER+LL  F  +VS H A GE +E A +LSYQ+AEDL RAF +RTI   F+  E
Sbjct  536  MDLFCLRERNLLKQFTEDVSHHLAQGESREKALMLSYQIAEDLARAFTERTILQIFLEDE  595

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +  +GSLK++L L+RSMY M  +DE A+FLRYG L+ DN A VRKE+ TLCS LRPH L
Sbjct  596  MNATAGSLKDVLGLLRSMYVMTCIDESASFLRYGYLSRDNVATVRKEVMTLCSNLRPHVL  655

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V+SFGIPD FLSP+AF+WI++NA SS
Sbjct  656  AIVSSFGIPDAFLSPLAFDWIEANALSS  683


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLAR  661
            REACGGQGLKTENR+G  K+E+DV ST       L  ++++
Sbjct  449  REACGGQGLKTENRVGIFKAEFDVQSTFEGDNNVLLQQVSK  489



>ref|XP_009388733.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=679

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAEY+  ++   +F+GLGLEHMN+PCP+IP+ L+S TL SI+FQ
Sbjct  468  FEGDNNVLMQQVSKALLAEYLAAEKMKSSFEGLGLEHMNDPCPIIPANLTSCTLRSIKFQ  527

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+ CLRER LL  +A+EVSQ+QA GE K+ A LLS+QLA++L RAF +RTI   F + E
Sbjct  528  LDLLCLRERDLLGRYASEVSQYQAQGESKQKAMLLSHQLADELARAFTERTILQIFADDE  587

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             + ++G LK +L L+RSMYA+  ++EDA+FLRYG L+ ++AAA RKE+  LC +LRPHAL
Sbjct  588  MTQSAGPLKELLGLLRSMYALICVEEDASFLRYGYLSLESAAAARKEVMKLCGDLRPHAL  647

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ++V+SFGIPD FLSPIAF+WI +N+W+SL
Sbjct  648  SVVSSFGIPDAFLSPIAFDWIQANSWASL  676



>gb|KHG11955.1| Acyl-coenzyme A oxidase 3, peroxisomal -like protein [Gossypium 
arboreum]
Length=671

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 162/207 (78%), Gaps = 1/207 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDN +LMQ VSKAL AEY+  +++ K FKGLGLEHMN+PCPVIPS+L+S TL   QFQ
Sbjct  464  FEGDNFLLMQLVSKALFAEYMAAQKRNKVFKGLGLEHMNKPCPVIPSQLTSTTLRCSQFQ  523

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D  CLRER LLN F A+V + +A GE  E AF   Y+LA+DLGRAF++R I+  FV AE
Sbjct  524  MDALCLRERDLLNRFVADVLKCKAKGENTEQAFNTCYELAKDLGRAFSERAIFQKFVEAE  583

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLKN+L  +RS+YA +I  ED +FLRYG L+ DN A VR+EI  LC+ELRPHAL
Sbjct  584  STLPAGSLKNVLGTLRSLYA-SICIEDVSFLRYGYLSVDNGANVRREITKLCNELRPHAL  642

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWS  83
            AL++SFGIPD FLSPIAFNWID+N+WS
Sbjct  643  ALISSFGIPDAFLSPIAFNWIDTNSWS  669


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGL+TENR+G  K EYDV ST       L   +++        A+ R +  K
Sbjct  437  REACGGQGLRTENRVGHLKGEYDVQSTFEGDNFLLMQLVSKALFAEYMAAQKRNKVFK  494



>ref|XP_002889598.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65857.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 160/209 (77%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQ VSKAL AEYV+CK++ K FKGLGLEHMN P PV+P++L+S TL   QFQ
Sbjct  467  FEGDNNVLMQLVSKALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             ++FCLRER LL  F  E+++ Q  GE +E + LL++QL+EDL +AF ++ I  T ++AE
Sbjct  527  KNVFCLRERDLLERFTCEIAELQGRGESREFSILLNHQLSEDLSKAFTEKAILQTVLDAE  586

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              +  GS+K +L LVRSMYA+  L+ED + LRYG L+ DN   VR+E+  LC ELRPHAL
Sbjct  587  AKLPPGSVKEVLGLVRSMYALISLEEDPSLLRYGHLSRDNVGDVRREVCKLCGELRPHAL  646

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV SFGIPD FLSPIAFNW+ +NAWSSL
Sbjct  647  ALVASFGIPDAFLSPIAFNWVKANAWSSL  675



>ref|XP_004965421.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Setaria 
italica]
Length=687

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 160/208 (77%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++  ++K K FKGLGLEH+N P PVIP KL+   L S +FQ
Sbjct  477  FEGDNNVLMQQVSKALYAEFLAAQKKKKPFKGLGLEHLNGPSPVIPDKLTGSILRSSKFQ  536

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER LL  FA EVS H A GE +E A +LS+QLAEDL RAF +RTI   F+  E
Sbjct  537  MDLFCLRERDLLKQFAEEVSLHLARGESREKALMLSFQLAEDLARAFTERTILQIFLEDE  596

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V SGSLK +L L+RS+Y M  +DE A+FLRYG L+  N A VRKE+  LCSELRPHAL
Sbjct  597  MNVPSGSLKELLGLLRSLYVMVSIDESASFLRYGYLSRGNVAGVRKEVLKLCSELRPHAL  656

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V+SFGIPD FLSP+AF+WI++NA S+
Sbjct  657  AVVSSFGIPDAFLSPLAFDWIEANALST  684


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K+E+DV ST       L  ++++        A+ + +  K
Sbjct  450  REACGGQGLKTENRVGIFKAEFDVQSTFEGDNNVLMQQVSKALYAEFLAAQKKKKPFK  507



>ref|XP_006852548.1| hypothetical protein AMTR_s00021p00193270 [Amborella trichopoda]
 gb|ERN14015.1| hypothetical protein AMTR_s00021p00193270 [Amborella trichopoda]
Length=678

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 165/209 (79%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDN+VLMQQVSK LL +Y+  ++  K +KGLGLEH+NEP PVIPS L+S  L S QF+
Sbjct  468  FEGDNHVLMQQVSKVLLGDYMAAQKTKKPYKGLGLEHLNEPSPVIPSVLTSSVLRSSQFE  527

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
              +FCLRER LL  FAAEVSQ+ + G  KENAF+L+YQLAEDL RAF +RTI    ++ E
Sbjct  528  VGLFCLRERDLLGRFAAEVSQYMSQGYHKENAFMLTYQLAEDLARAFTERTILQYILDVE  587

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             S+  G LKN+L L+R+MYA+  ++EDA+FL+YG L++ N+  +RKE+  LCSELRPH+L
Sbjct  588  TSMPGGPLKNVLGLLRTMYAVVTIEEDASFLQYGYLSSANSITIRKELMKLCSELRPHSL  647

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD +LSPIAF+WI +N+W+S+
Sbjct  648  ALVSSFGIPDAYLSPIAFDWIVANSWASV  676


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K+E+DV ST       L  ++++  L +   A+   +  K
Sbjct  441  REACGGQGLKTENRVGHLKAEHDVQSTFEGDNHVLMQQVSKVLLGDYMAAQKTKKPYK  498



>gb|KJB12486.1| hypothetical protein B456_002G020700 [Gossypium raimondii]
Length=672

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 162/207 (78%), Gaps = 1/207 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDN +LMQ VSKAL AEY+  +++ K FKGLGLEHMN+PCPVIPS+L+S T+   QFQ
Sbjct  465  FEGDNFLLMQLVSKALFAEYMAAQKRNKVFKGLGLEHMNKPCPVIPSQLTSTTVRCSQFQ  524

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D  CLRER LLN F A V + +A GE  E AF   Y+LA+DLGRAF++R I+ TFV AE
Sbjct  525  MDALCLRERDLLNRFVANVLKCKAKGENTEQAFNSCYELAKDLGRAFSERAIFQTFVEAE  584

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             ++ +GSLK++L  +RS+YA +I  ED +FLRYG L+ DN A VR+EI  LC+ELRPHAL
Sbjct  585  STLPAGSLKDVLGTLRSLYA-SICIEDVSFLRYGYLSVDNGANVRREITKLCNELRPHAL  643

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWS  83
            AL++SFGIPD FLSPIAFNWID+N+WS
Sbjct  644  ALISSFGIPDAFLSPIAFNWIDTNSWS  670


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGL+TENR+G  K EYDV ST       L   +++        A+ R +  K
Sbjct  438  REACGGQGLRTENRVGHLKGEYDVQSTFEGDNFLLMQLVSKALFAEYMAAQKRNKVFK  495



>ref|XP_002456627.1| hypothetical protein SORBIDRAFT_03g039670 [Sorghum bicolor]
 gb|EES01747.1| hypothetical protein SORBIDRAFT_03g039670 [Sorghum bicolor]
Length=684

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 160/208 (77%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++  ++K + FKGLGLEH+N   PVIP KL+S+ L S +FQ
Sbjct  474  FEGDNNVLMQQVSKALYAEFLGAQKKKRPFKGLGLEHLNGSTPVIPDKLTSNILRSSKFQ  533

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER LL  FA EVS H A GE +E A +LSYQLAEDL RAF +RTI   F+  E
Sbjct  534  MDLFCLRERDLLKQFAEEVSLHLAQGESREKALMLSYQLAEDLARAFTERTILQIFLEDE  593

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V SGSLK +L L+RS+Y M  +DE  +FLRYG L+ DN A VRKE+  +CSELRPHAL
Sbjct  594  RNVPSGSLKEVLGLLRSLYVMVNIDESTSFLRYGYLSRDNVALVRKEVLKMCSELRPHAL  653

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V+SFGIPD FLSP+AF+WI++N  S+
Sbjct  654  AVVSSFGIPDAFLSPLAFDWIEANTLST  681


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K+E+DV ST       L  ++++        A+ + R  K
Sbjct  447  REACGGQGLKTENRVGVFKAEFDVQSTFEGDNNVLMQQVSKALYAEFLGAQKKKRPFK  504



>emb|CDY10194.1| BnaC05g04370D [Brassica napus]
Length=674

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 163/208 (78%), Gaps = 1/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEYV+CK++ K FKGLGLEHMN P PV+P++L+S TL    FQ
Sbjct  467  FEGDNNVLMQQVSKALFAEYVSCKKRNKPFKGLGLEHMNSPLPVLPTQLTSSTLRCSHFQ  526

Query  523  N-DIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNA  347
              ++FCLRER LL  +  EV++ Q  GE +E +FLLS+QL+EDL +AFA++ I    ++A
Sbjct  527  QKNVFCLRERDLLERYTCEVAELQERGESRELSFLLSHQLSEDLSKAFAEKAILQAVLDA  586

Query  346  EPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHA  167
            E  + +GS+K+++ LVRSMYA+  ++ED +FLRYG  + D+   VR+E++ LC ELRPHA
Sbjct  587  EAKLPAGSIKDVVGLVRSMYALICMEEDPSFLRYGYHSRDSVGDVRREVSKLCIELRPHA  646

Query  166  LALVTSFGIPDTFLSPIAFNWIDSNAWS  83
            LALVTSFGIPD FL PIAFNWI++NAWS
Sbjct  647  LALVTSFGIPDAFLGPIAFNWIEANAWS  674


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQG+KTENR+G  K +YDV +T       L  ++++         K R +  K
Sbjct  440  REACGGQGVKTENRVGHLKGDYDVQTTFEGDNNVLMQQVSKALFAEYVSCKKRNKPFK  497



>ref|XP_009119067.1| PREDICTED: putative acyl-coenzyme A oxidase 3.2, peroxisomal 
[Brassica rapa]
Length=676

 Score =   270 bits (691),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 160/209 (77%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEY++CK++ K FKGLGLEHMN P PV+P++L+S  L    FQ
Sbjct  468  FEGDNNVLMQQVSKALFAEYISCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSALRCSHFQ  527

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             + F +RER LL  + +EV + Q  GE +E +FLLS+QL EDL +AFA++ I    ++AE
Sbjct  528  KNAFSIRERDLLERYTSEVEEIQGKGESREFSFLLSHQLYEDLSKAFAEKAILQAVLDAE  587

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              +  GS K++L +VRSMYA+  ++ED +FLRYG L+ DN   VR+E++ LC ELRPHAL
Sbjct  588  AKLPIGSTKDVLGIVRSMYALICMEEDPSFLRYGYLSRDNVGDVRREVSKLCGELRPHAL  647

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALVTSFGIPD FL PIAFNW+++NAWSS+
Sbjct  648  ALVTSFGIPDAFLGPIAFNWVEANAWSSV  676



>emb|CDY57822.1| BnaA10g28090D [Brassica napus]
Length=675

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 164/208 (79%), Gaps = 1/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSK+L AEYV+CK++ K FKGLGLEHMN P PV+P++L+S TL    FQ
Sbjct  468  FEGDNNVLMQQVSKSLFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSHFQ  527

Query  523  N-DIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNA  347
              ++FCLRER LL  +  EV++ Q  G+ +E +FLLS+QL+EDL +AFA++ I    ++A
Sbjct  528  QKNVFCLRERDLLERYTCEVAELQERGKSREFSFLLSHQLSEDLSKAFAEKAILQAVLDA  587

Query  346  EPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHA  167
            E  + +GS+K+++ LVRSMYA+  ++ED +FLRYG L+ D+   VR+E++ LC ELRPHA
Sbjct  588  EAKLPAGSIKDVVGLVRSMYALICMEEDPSFLRYGYLSRDSVGDVRREVSKLCRELRPHA  647

Query  166  LALVTSFGIPDTFLSPIAFNWIDSNAWS  83
            LALVTSFGIPD FL PIAFNWI++NAWS
Sbjct  648  LALVTSFGIPDAFLGPIAFNWIEANAWS  675


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K +YDV +T       L  ++++         K R +  K
Sbjct  441  REACGGQGLKTENRVGHLKGDYDVQTTFEGDNNVLMQQVSKSLFAEYVSCKKRNKPFK  498



>ref|NP_001152024.1| acyl-coenzyme A oxidase 2 [Zea mays]
 gb|ACG45431.1| acyl-coenzyme A oxidase 2 [Zea mays]
Length=684

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++  ++K + FKGLGLEH+N   PVIP KL+S  L S +FQ
Sbjct  474  FEGDNNVLMQQVSKALYAEFLGAQKKQQPFKGLGLEHLNGSSPVIPDKLTSSILRSSKFQ  533

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER LL  F  EVS H A GE +E A +LSYQ+AEDL RAF +RTI   F+  E
Sbjct  534  MDLFCLRERDLLKQFVEEVSLHLAQGESREKALMLSYQVAEDLARAFTERTILQIFLEDE  593

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V SGSLK +L L+RS+Y M  +DE  +FLRYG L+ DN A VRKE+  LCSELRPHAL
Sbjct  594  MNVPSGSLKEVLGLLRSLYVMVNIDESTSFLRYGHLSRDNVALVRKEVLKLCSELRPHAL  653

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V+SFGIPD FLSP+AF+WI++NA S+
Sbjct  654  AVVSSFGIPDAFLSPLAFDWIEANALST  681


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  KSE+DV ST       L  ++++        A+ + +  K
Sbjct  447  REACGGQGLKTENRIGIFKSEFDVQSTFEGDNNVLMQQVSKALYAEFLGAQKKQQPFK  504



>tpg|DAA56859.1| TPA: putative acyl-CoA oxidase family protein [Zea mays]
Length=684

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++  ++K + FKGLGLEH+N   PVIP KL+S  L S +FQ
Sbjct  474  FEGDNNVLMQQVSKALYAEFLGAQKKQQPFKGLGLEHLNGSSPVIPDKLTSSILRSSKFQ  533

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER LL  F  EVS H A GE +E A +LSYQ+AEDL RAF +RTI   F+  E
Sbjct  534  MDLFCLRERDLLKQFVEEVSLHLAQGESREKALMLSYQVAEDLARAFTERTILQIFLEDE  593

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V SGSLK +L L+RS+Y M  +DE  +FLRYG L+ DN A VRKE+  LCSELRPHAL
Sbjct  594  MNVPSGSLKEVLGLLRSLYVMVNIDESTSFLRYGHLSRDNVALVRKEVLKLCSELRPHAL  653

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V+SFGIPD FLSP+AF+WI++NA S+
Sbjct  654  AVVSSFGIPDAFLSPLAFDWIEANALST  681


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  KSE+DV ST       L  ++++        A+ + +  K
Sbjct  447  REACGGQGLKTENRIGIFKSEFDVQSTFEGDNNVLMQQVSKALYAEFLGAQKKQQPFK  504



>gb|AGT17248.1| acyl-coenzyme A oxidase [Saccharum hybrid cultivar R570]
Length=682

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 159/208 (76%), Gaps = 0/208 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AE++  ++K K FKGLGLEH+N   PV+P KL+S  L S +FQ
Sbjct  472  FEGDNNVLMQQVSKALYAEFLGAQKKKKPFKGLGLEHLNGSSPVMPDKLTSSILRSSKFQ  531

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D+FCLRER LL  FA EVS   A GE +E A +LSYQLAEDL RAF +RTI   F+  E
Sbjct  532  MDLFCLRERDLLKQFAEEVSLQLAQGESREKALMLSYQLAEDLARAFTERTILQIFLEDE  591

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +V SGSLK +L L+RS+Y M  +DE  +FLRYG L+ DN A VRKE+  +CSELRPHAL
Sbjct  592  MNVPSGSLKEVLGLLRSLYVMVNIDESTSFLRYGHLSRDNVALVRKEVLKVCSELRPHAL  651

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSS  80
            A+V+SFGIPD FLSP+AF+WI++NA S+
Sbjct  652  AVVSSFGIPDAFLSPLAFDWIEANALST  679


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K+E+DV ST       L  ++++        A+ + +  K
Sbjct  445  REACGGQGLKTENRVGIFKAEFDVQSTFEGDNNVLMQQVSKALYAEFLGAQKKKKPFK  502



>gb|ACN41105.1| unknown [Picea sitchensis]
Length=680

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 158/209 (76%), Gaps = 0/209 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL +EY   ++K K  +GLGLEHMN   P+IP+ L S TL +I+FQ
Sbjct  470  FEGDNNVLMQQVSKALFSEYSAARKKQKPLRGLGLEHMNNNRPIIPAILDSSTLRNIEFQ  529

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             DIF LRER LL   AAE+SQ  + G     AF +SY+LAEDLGRAF++R +  +F+ AE
Sbjct  530  MDIFHLRERDLLERLAAEISQCVSQGTTTAVAFTMSYELAEDLGRAFSERAVLDSFILAE  589

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              + +GS+K+IL L+R++YA+  L+ED +FLRYG L+   +   RKEIA LC+ELRPHAL
Sbjct  590  TKLAAGSMKDILGLLRTIYALITLEEDISFLRYGYLSPQQSQMGRKEIAKLCNELRPHAL  649

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            +LV SFGIP  +LSPIAF+WI++N+W+++
Sbjct  650  SLVDSFGIPQPYLSPIAFDWIEANSWAAV  678


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K EYDV ST       L  ++++      S A+ + + L+
Sbjct  443  REACGGQGLKTENRIGHLKGEYDVQSTFEGDNNVLMQQVSKALFSEYSAARKKQKPLR  500



>ref|XP_007043727.1| Acyl-CoA oxidase 3 isoform 3 [Theobroma cacao]
 gb|EOX99558.1| Acyl-CoA oxidase 3 isoform 3 [Theobroma cacao]
Length=642

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 147/209 (70%), Gaps = 35/209 (17%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNN+LMQQVSKAL AEYV  ++K KAFKGLGLEHMN+PCPVIPS+L+S TL   QFQ
Sbjct  467  FEGDNNILMQQVSKALFAEYVAAQKKNKAFKGLGLEHMNKPCPVIPSQLTSATLRCSQFQ  526

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D  CLRER LL  F  +VSQHQA GE KE+AF++                         
Sbjct  527  MDALCLRERDLLKCFVLDVSQHQAKGESKEHAFIM-------------------------  561

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
                     ++L ++RS+YA+ I  ED AFLRYG L+ DNAAAVR+EI  +CSELRPHAL
Sbjct  562  ---------DVLGMLRSLYAL-ICIEDVAFLRYGYLSVDNAAAVRREITKVCSELRPHAL  611

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            ALV+SFGIPD FLSP+AFNWID+N+WSS+
Sbjct  612  ALVSSFGIPDAFLSPVAFNWIDANSWSSV  640


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+G  K E+DV ST       L  ++++        A+ + +  K
Sbjct  440  REACGGQGLKTENRVGHLKGEHDVQSTFEGDNNILMQQVSKALFAEYVAAQKKNKAFK  497



>ref|NP_187325.4| putative acyl-coenzyme A oxidase [Arabidopsis thaliana]
 sp|P0CZ24.1|Y3669_ARATH RecName: Full=Putative acyl-coenzyme A oxidase At3g06690; Short=Acyl-CoA 
oxidase [Arabidopsis thaliana]
 gb|AEE74442.1| putative acyl-coenzyme A oxidase [Arabidopsis thaliana]
Length=187

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -2

Query  589  NEPCPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQ  410
            + P PV+P++L+S TL   QFQ ++FCLRER LL  F +EV+Q Q  GE +E +FLLS+Q
Sbjct  17   DSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLERFTSEVAQLQGRGESREFSFLLSHQ  76

Query  409  LAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTT  230
            LAEDLG+AF ++ +  T ++AE  + +GS+K++L LVRSMYA+  L+ED + LRYG L+ 
Sbjct  77   LAEDLGKAFTEKAMLQTILDAEAKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSQ  136

Query  229  DNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            DN   VR+E++ LC ELRPHALALVTSFGIPD+FLSPIAFNW+++N WSS+
Sbjct  137  DNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVEANTWSSV  187



>ref|XP_002994091.1| hypothetical protein SELMODRAFT_187751 [Selaginella moellendorffii]
 gb|EFJ04838.1| hypothetical protein SELMODRAFT_187751 [Selaginella moellendorffii]
Length=678

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 142/208 (68%), Gaps = 3/208 (1%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L FEGDNNVLMQQVSKALL ++ T ++K +  KGLGLEHMNEP P I +  +   +  ++
Sbjct  467  LTFEGDNNVLMQQVSKALLGDFFTSQKKQQPMKGLGLEHMNEPPPTIGTNAN---VRDVK  523

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
            FQ  +F LRER LL   A +V +  + G    NA L SYQLAEDLGRAF++R++  + ++
Sbjct  524  FQLALFRLRERDLLVKLAQQVRELVSKGSTMANATLASYQLAEDLGRAFSERSVLESILS  583

Query  349  AEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPH  170
             E S+     K IL L+RS++    +DED  FLR+  L+ D A +++KE+A+LC E+RP 
Sbjct  584  VENSLAPSPEKTILGLLRSLFVATTVDEDPVFLRHSYLSPDQALSIQKEVASLCREIRPF  643

Query  169  ALALVTSFGIPDTFLSPIAFNWIDSNAW  86
             L+LV +FGIP  FL PIAF+WI +N+W
Sbjct  644  ILSLVDAFGIPAPFLGPIAFDWIAANSW  671


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLK+EN++GQ K+EYDV  T       L  ++++  L +   ++ + + +K
Sbjct  442  REACGGQGLKSENKVGQLKAEYDVQLTFEGDNNVLMQQVSKALLGDFFTSQKKQQPMK  499



>ref|XP_002985513.1| hypothetical protein SELMODRAFT_122536 [Selaginella moellendorffii]
 gb|EFJ13387.1| hypothetical protein SELMODRAFT_122536 [Selaginella moellendorffii]
Length=678

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 140/208 (67%), Gaps = 3/208 (1%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L FEGDNNVLMQQVSKALL ++ T ++K +  KGLGLEHMN P P I +  +   +  + 
Sbjct  467  LTFEGDNNVLMQQVSKALLGDFFTSQKKQQPMKGLGLEHMNGPPPTIGTNAN---VRDVT  523

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
            FQ  +F LRER LL   A +V +  + G    NA L SYQLAEDLGRAF++R++  + ++
Sbjct  524  FQLALFRLRERDLLVKLAQQVRELVSKGSTMANATLASYQLAEDLGRAFSERSVLESILS  583

Query  349  AEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPH  170
             E S+     K IL L+RS++    +DED  FLR+  L+ D A +++KE+A+LC E+RP 
Sbjct  584  VENSLAPSPEKTILGLLRSLFVATTVDEDPVFLRHAYLSPDQALSIQKEVASLCREIRPF  643

Query  169  ALALVTSFGIPDTFLSPIAFNWIDSNAW  86
             L+LV +FGIP  FL PIAF+WI +N+W
Sbjct  644  ILSLVDAFGIPAPFLGPIAFDWIAANSW  671


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLK+EN++GQ K+EYDV  T       L  ++++  L +   ++ + + +K
Sbjct  442  REACGGQGLKSENKVGQLKAEYDVQLTFEGDNNVLMQQVSKALLGDFFTSQKKQQPMK  499



>ref|XP_001772379.1| predicted protein [Physcomitrella patens]
 gb|EDQ62850.1| predicted protein [Physcomitrella patens]
Length=678

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 146/211 (69%), Gaps = 1/211 (0%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L FEGDNNVLMQQVSKALLA+YV+ KR+GK  KG+GLEH+N   PV+P +L+   L   +
Sbjct  468  LTFEGDNNVLMQQVSKALLADYVSAKRRGKPLKGMGLEHINGSAPVVPEELNRSALRDSK  527

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
            FQ  +F LRER LL L  ++V+     G    +A +  YQ+AEDLG+AF++R++  +F+ 
Sbjct  528  FQLALFQLRERGLLELLTSQVTTLVLKGVSMTDAVISGYQVAEDLGQAFSERSVLESFLK  587

Query  349  AEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPH  170
             E    +GS+K+IL L+RS+Y ++  DE   FLRYG LT   +  +  E+ +LC ELRP 
Sbjct  588  VEQQ-TTGSMKDILGLLRSLYVLSSADETPVFLRYGYLTPKQSQLIHTEVDSLCGELRPQ  646

Query  169  ALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            AL LV +FGIP  FL PIAF+W++ N+WS++
Sbjct  647  ALNLVDAFGIPQAFLGPIAFDWVEYNSWSNV  677


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKT+NR+GQ K+EYDV  T       L  ++++  L +   AK R + LK
Sbjct  443  REACGGQGLKTDNRVGQLKAEYDVQLTFEGDNNVLMQQVSKALLADYVSAKRRGKPLK  500



>ref|XP_011466939.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=596

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKALLAE++T ++K + FK LGLEHMN+PCPVIP  L+S TL SI+FQ
Sbjct  463  FEGDNNVLMQQVSKALLAEFITAQKKNQPFKALGLEHMNKPCPVIPPHLTSSTLQSIEFQ  522

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             D FCLRER LLN FA EVSQ Q  GE KE + LLSYQLAEDLGRAF+DRTI  TF++ E
Sbjct  523  MDAFCLRERDLLNRFALEVSQRQKQGESKEYSVLLSYQLAEDLGRAFSDRTILQTFIDVE  582

Query  343  PSVNSGSLKNILSL  302
             +V +GSLKN+L++
Sbjct  583  ATVPAGSLKNVLAM  596


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENRIG  K E+DV ST       L  ++++  L     A+ + +  K
Sbjct  436  REACGGQGLKTENRIGNLKGEFDVQSTFEGDNNVLMQQVSKALLAEFITAQKKNQPFK  493



>ref|XP_001759376.1| predicted protein [Physcomitrella patens]
 gb|EDQ75678.1| predicted protein [Physcomitrella patens]
Length=680

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 146/211 (69%), Gaps = 1/211 (0%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L FEGDNNVLMQQVSKALLA+Y++ K++GK  KG+GLEH+N P  VIP  L+   L   +
Sbjct  470  LTFEGDNNVLMQQVSKALLADYMSAKKRGKPMKGMGLEHINGPALVIPEDLTRSVLRDSK  529

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
            FQ  +F LRER LL L +++VS   + G    +A + SYQLAEDLG+AF++R+I  + + 
Sbjct  530  FQLALFQLRERGLLELLSSQVSSLVSKGVSMADAVISSYQLAEDLGQAFSERSILESVLR  589

Query  349  AEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPH  170
            AE    +GS K +L L+RS+Y ++  DE   FLRYG L    +  +  E+A+LC ELRP 
Sbjct  590  AEQQ-TTGSTKEVLGLLRSLYVLSAADEGPVFLRYGYLLPKQSQLISTEVASLCGELRPQ  648

Query  169  ALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            A+ LV +FGIP  FL PIAF+W++ N+W+++
Sbjct  649  AVNLVDAFGIPQAFLGPIAFDWVEYNSWNNV  679


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKT+NR+GQ K+EYDV  T       L  ++++  L +   AK R + +K
Sbjct  445  REACGGQGLKTDNRVGQLKAEYDVQLTFEGDNNVLMQQVSKALLADYMSAKKRGKPMK  502



>emb|CDY57819.1| BnaA10g28070D [Brassica napus]
Length=253

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 124/205 (60%), Gaps = 40/205 (20%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDNNVLMQQVSKAL AEY                HMN P PV+P++L+S  L    FQ
Sbjct  75   FEGDNNVLMQQVSKALFAEY----------------HMNSPRPVLPTQLTSSALRCSHFQ  118

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             + F +RER LL  + +E          K    L+ +QL+EDL +AFA++TI    ++A 
Sbjct  119  KNAFSIRERDLLERYTSE----------KFTFLLICHQLSEDLSKAFAEKTILQAVLDAI  168

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
              +  GS+K++L + R MYA+  ++ED +FLR              E++ LC ELRPHAL
Sbjct  169  TKLPIGSIKDVLGIARLMYALICMEEDPSFLR--------------EVSKLCRELRPHAL  214

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNA  89
            ALVTSFGIPD FL PIAFNW+++NA
Sbjct  215  ALVTSFGIPDAFLGPIAFNWVEANA  239



>ref|XP_010038681.1| PREDICTED: putative acyl-coenzyme A oxidase At3g06690 [Eucalyptus 
grandis]
Length=140

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 110/172 (64%), Gaps = 34/172 (20%)
 Frame = -2

Query  592  MNEPCPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSY  413
            MN PCPV+  +L S  L S QFQ D F +RER LLN FA E+ Q QA GE KE+A L   
Sbjct  1    MNGPCPVLLQQLPSTVLRSGQFQVDAFHVRERDLLNRFAEEILQRQARGERKEHALL---  57

Query  412  QLAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLT  233
                                            ++L+L+RSMYA+  +++DA+FLRYG L+
Sbjct  58   -------------------------------SDMLALLRSMYALTCMEDDASFLRYGYLS  86

Query  232  TDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            T+NAA VRKE+A LCSELRPHALALV SFGIPD FLSPIAFNW+++N+W S+
Sbjct  87   TENAADVRKEVAKLCSELRPHALALVNSFGIPDAFLSPIAFNWVEANSWFSV  138



>emb|CBI36628.3| unnamed protein product [Vitis vinifera]
Length=128

 Score =   146 bits (368),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  424  LLSYQLAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRY  245
              SYQLAEDLGRAF+DR I  TF++AE +V+S  LK++LSL+RSM+ + IL+E A+FLRY
Sbjct  3    FFSYQLAEDLGRAFSDRAILQTFLDAEVAVSSSLLKSMLSLLRSMHVLIILEECASFLRY  62

Query  244  GCLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            G L+ DNA  +RKE+  LCSELRPHALALV+SFGIP+ F SPIAFNWI++N+WSS+
Sbjct  63   GYLSPDNAVGIRKEVTILCSELRPHALALVSSFGIPNAFFSPIAFNWINANSWSSV  118



>emb|CAN66151.1| hypothetical protein VITISV_035129 [Vitis vinifera]
Length=272

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 100/146 (68%), Gaps = 19/146 (13%)
 Frame = -2

Query  592  MNEPCPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSY  413
            MN+ CPV+PS+L+S TL S QFQ +IFCLRER LL  FAAE+SQ QA G  +E A L   
Sbjct  1    MNKSCPVVPSQLTSSTLRSSQFQTNIFCLRERDLLIHFAAEISQLQAHGLSREYALL---  57

Query  412  QLAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLT  233
                              F++AE +V+SG LK++LSL+RSM+ + IL+EDA+FLRYG L+
Sbjct  58   ----------------QIFLDAEAAVSSGPLKSMLSLLRSMHVLIILEEDASFLRYGYLS  101

Query  232  TDNAAAVRKEIATLCSELRPHALALV  155
             DNAA + K++  L SELRPHALAL+
Sbjct  102  PDNAAGISKKVTILYSELRPHALALL  127



>gb|AAG50996.1|AC036106_9 unknown protein; 4820-5433 [Arabidopsis thaliana]
Length=98

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATL  191
            +  T ++AE  + +GS+K++L LVRSMYA+  L+ED + LRYG L+ DN   VR+E++ L
Sbjct  1    MLQTILDAEAKLPTGSVKDVLGLVRSMYALISLEEDPSLLRYGYLSQDNVGDVRREVSKL  60

Query  190  CSELRPHALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            C ELRPHALALVTSFGIPD+FLSPIAFNW+++N WSS+
Sbjct  61   CGELRPHALALVTSFGIPDSFLSPIAFNWVEANTWSSV  98



>emb|CAN66343.1| hypothetical protein VITISV_040587 [Vitis vinifera]
Length=82

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  292  MYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIA  113
            M+ + IL+EDA+FLRYG L+ DNAA +RKE+  LCSELRPHALALV+SFGI D FLSPIA
Sbjct  1    MHVLIILEEDASFLRYGYLSPDNAAGIRKEVTILCSELRPHALALVSSFGILDAFLSPIA  60

Query  112  FNWIDSNAWSSL  77
            FNWID+N+WSS+
Sbjct  61   FNWIDANSWSSV  72



>emb|CAN77404.1| hypothetical protein VITISV_009474 [Vitis vinifera]
Length=75

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  292  MYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIA  113
            M+ + IL+ED +FLRYG L+ DNAA +RKE+  LCSELRPHALALV+SFGIPD  LSPIA
Sbjct  1    MHVLIILEEDVSFLRYGYLSPDNAAGIRKEVTILCSELRPHALALVSSFGIPDALLSPIA  60

Query  112  FNWIDSNAWS  83
            FNWID+N+WS
Sbjct  61   FNWIDANSWS  70



>emb|CBI39134.3| unnamed protein product [Vitis vinifera]
Length=84

 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -2

Query  418  SYQLAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGC  239
            +YQL EDLGRAF+DR I HTF++ E +V+SG LK++LSL+RSM+ + IL+EDA+FLRYG 
Sbjct  5    NYQLVEDLGRAFSDRAILHTFLDVEATVSSGPLKSMLSLLRSMHVLIILEEDASFLRYGY  64

Query  238  LTTDNAAAVRKEIATLCSEL  179
            L+ DNAA +RKE+  LCSEL
Sbjct  65   LSPDNAAGIRKEVTILCSEL  84



>gb|AAF63829.1| hypothetical protein [Arabidopsis thaliana]
Length=72

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  292  MYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIA  113
            MYA+  L+ED + LRYG L+ DN   VR+E++ LC ELRPHALALVTSFGIPD+FLSPIA
Sbjct  1    MYALISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIA  60

Query  112  FNWIDSNAWSSL  77
            FNW+++N WSS+
Sbjct  61   FNWVEANTWSSV  72



>emb|CDP21363.1| unnamed protein product [Coffea canephora]
Length=71

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 3/72 (4%)
 Frame = -2

Query  292  MYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIA  113
            MYA+  L+ED+AFLRYG L+ DNAAAVRKE+A    + RPHAL+LV+SFGIPD FLSPIA
Sbjct  1    MYALVTLEEDSAFLRYGFLSVDNAAAVRKEVAK---QSRPHALSLVSSFGIPDAFLSPIA  57

Query  112  FNWIDSNAWSSL  77
            FNW+++N+WSS+
Sbjct  58   FNWLETNSWSSV  69



>ref|XP_005712269.1| unnamed protein product [Chondrus crispus]
 emb|CDF77395.1| unnamed protein product [Chondrus crispus]
Length=672

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/214 (34%), Positives = 110/214 (51%), Gaps = 4/214 (2%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L +EGDN++L+Q V+KA+L E+V   +    F+G    ++N+   +    LS+    S  
Sbjct  460  LTYEGDNHILLQTVTKAVLPEFVRGFKNDGNFEG-HFSYLNDREALRRVDLSTTDPRSAM  518

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADR---TIYHT  359
            +   +   RE  L    AAE+ +  A+G     AF  S  L ED GRA  D     ++H 
Sbjct  519  YALTVMRRREAALFARLAAEIQKKIAAGMSSLQAFNHSAVLVEDAGRAHVDLLMLQLFHQ  578

Query  358  FVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSEL  179
             ++   S     L NIL+L  +++   ++D    FLR G L+  +A  V   +   C +L
Sbjct  579  TLSDLKSRGETELVNILTLCGALHTARLIDSQVIFLRNGALSAKDAQNVHSNVQIFCMQL  638

Query  178  RPHALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            RPH L LV SFG P   L+PIAF+++  N+ S L
Sbjct  639  RPHVLHLVDSFGYPPHLLAPIAFDYVSHNSRSRL  672



>ref|XP_005707013.1| acyl-CoA oxidase isoform 1 [Galdieria sulphuraria]
 ref|XP_005707014.1| acyl-CoA oxidase isoform 2 [Galdieria sulphuraria]
 gb|EME30493.1| acyl-CoA oxidase isoform 1 [Galdieria sulphuraria]
 gb|EME30494.1| acyl-CoA oxidase isoform 2 [Galdieria sulphuraria]
Length=640

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 118/213 (55%), Gaps = 6/213 (3%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L +EGDN VL+QQVS+++L +++   + GK F G  L +MN+    +  +L  D + SI 
Sbjct  432  LTYEGDNLVLLQQVSRSVLNDFLKQMKAGK-FVG-PLSYMNDQS-FLTGRLPED-IRSIT  487

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH--TF  356
            F   I    E  L+   A EV++    G+     +     LA ++GRA  +  I      
Sbjct  488  FSRLILQRLESKLVASLAKEVAKRSKQGKSSFEVWNECLDLAAEVGRAHTELLIAELSEK  547

Query  355  VNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELR  176
            +  + S    S +NIL   ++++ + ++D+ + FLRY CL+ ++A  + + +  LC +LR
Sbjct  548  LIEQASQTDLSTRNILKQCQTLFLLHLIDKQSCFLRYNCLSPEDAQRLHRVVVELCMQLR  607

Query  175  PHALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
              AL LV SFGIP   L+PIAF+WI+ N+ S L
Sbjct  608  EQALPLVDSFGIPPHLLAPIAFDWIEHNSRSKL  640



>ref|XP_005703885.1| acyl-CoA oxidase [Galdieria sulphuraria]
 gb|EME27365.1| acyl-CoA oxidase [Galdieria sulphuraria]
Length=636

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 110/209 (53%), Gaps = 5/209 (2%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L +EGDN VL+QQVS+A+L++++   +KG  F G  L ++N    +   KL      SI+
Sbjct  427  LTYEGDNLVLLQQVSRAVLSDFLRQLKKGH-FIG-SLAYLNSK-DIFSGKLPEHNEVSIE  483

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
            +   IF  RE + L   A E++  +  G+   +A+     LA + GRA  +         
Sbjct  484  YLRTIFRRREANALATLAKELANREHQGKSSFDAWNACLDLAAEAGRAHTELLFVDLSEE  543

Query  349  AEPSVNS--GSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELR  176
               S+N    S+ ++L L + ++   ++D+ + FLR  CLT+  A     ++  L  +LR
Sbjct  544  IISSINEEDASIGSVLKLCQQLFLFHLVDKQSVFLRTSCLTSKEAEYCHDKVIELSKQLR  603

Query  175  PHALALVTSFGIPDTFLSPIAFNWIDSNA  89
              AL +V SFGIP   L PIAFNWI  N+
Sbjct  604  LVALPIVESFGIPSHLLGPIAFNWIAHNS  632



>emb|CBI24556.3| unnamed protein product [Vitis vinifera]
 emb|CBI24557.3| unnamed protein product [Vitis vinifera]
Length=70

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  592  MNEPCPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSY  413
            MN+ CPV+PS+L+S TL S QFQ +IFCLRER LL  FAAE+SQ QA G  +E A L SY
Sbjct  1    MNKSCPVVPSQLTSSTLRSSQFQTNIFCLRERDLLIHFAAEISQLQAHGLSREYALLQSY  60

Query  412  QLAEDLGRAF  383
            QLAEDLGR+F
Sbjct  61   QLAEDLGRSF  70



>emb|CBI31502.3| unnamed protein product [Vitis vinifera]
Length=70

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  592  MNEPCPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSY  413
            MN+ CPV+PS+L+S TL S QFQ DIFCLRE+ LL  FAAE+SQ QA G  +E A L SY
Sbjct  1    MNKSCPVVPSQLTSSTLRSSQFQTDIFCLREQDLLIHFAAEISQLQAHGLSREYALLQSY  60

Query  412  QLAEDLGRAF  383
            QLAEDLGR+F
Sbjct  61   QLAEDLGRSF  70



>ref|XP_005712968.1| acyl-CoA oxidase [Chondrus crispus]
 ref|XP_005712969.1| Acyl-COA oxydase [Chondrus crispus]
 emb|CDF33165.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF33166.1| Acyl-COA oxydase [Chondrus crispus]
Length=672

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/214 (31%), Positives = 105/214 (49%), Gaps = 4/214 (2%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L +EGDN+VL+Q V+K + +E++   R G  FKG    ++ +   +  + LS     S  
Sbjct  460  LTYEGDNHVLLQAVTKTVFSEFMKGVRSGGNFKG-HFAYLKDAEGLRQADLSGMDARSAA  518

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVN  350
            F   +   RE  L    AA++ +  A+G     AF     L ED GRA  +  +   F +
Sbjct  519  FALTVMRRREAALFARLAADLQKRTATGVSSLQAFNDCAVLVEDAGRAHVELLMVELFHH  578

Query  349  AEPSVNSGS---LKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSEL  179
                +  G    + ++L L  +++    +DE   FLR G ++   A  +   +   C  L
Sbjct  579  TLGDLQRGGETEVADMLRLCGALHTARTVDEQVVFLRCGAVSVGEAQMMHANVGRFCETL  638

Query  178  RPHALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            RPH L+LV SFG P   L+PIAF+++  N+ S L
Sbjct  639  RPHVLSLVESFGYPPHLLAPIAFDYVAHNSKSRL  672



>ref|XP_005712270.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF77396.1| acyl-CoA oxidase [Chondrus crispus]
Length=672

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 105/219 (48%), Gaps = 22/219 (10%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGL--------GLEHMNEPCPVIPSKLS  554
            L +EGDN+VL+Q V+K + +E++   + G  F+G         GL+ MN         LS
Sbjct  460  LTYEGDNHVLLQAVTKTVFSEFMKGIQSGGNFRGHFAYLKDAEGLKKMN---------LS  510

Query  553  SDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFAD-  377
                 S  F   +   RE  L  + AA++ +  A+G     AF     L ED GRA  + 
Sbjct  511  GMDPRSAAFALTVMRRREAALFAMLAADLQKRTAAGLTPLKAFNHCAVLVEDAGRAHVEL  570

Query  376  ---RTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRK  206
                  +HT  + +    +  L ++LSL  +++    +DE   FLR G ++   A  +  
Sbjct  571  LMVELFHHTLSDLQRRGET-ELADMLSLCGALHTARTVDEQPVFLRCGAVSVAEAQMMHT  629

Query  205  EIATLCSELRPHALALVTSFGIPDTFLSPIAFNWIDSNA  89
             +   C  LRPH L LV SFG P   L+PIAF+++  N+
Sbjct  630  NVGRFCGTLRPHVLTLVESFGYPPHLLAPIAFDYVAHNS  668



>ref|XP_005716306.1| acyl-CoA oxidase [Chondrus crispus]
 emb|CDF36487.1| acyl-CoA oxidase [Chondrus crispus]
Length=656

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 101/214 (47%), Gaps = 20/214 (9%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            L +EGDN++L+Q V+K +L E++   + G  F G    ++N+   +    L         
Sbjct  460  LTYEGDNHILLQAVTKTVLPEFMRGFKNGGDFDG-HFSYLNDRAALQKVDLR--------  510

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFAD---RTIYHT  359
                    RE  L    A E+ +   +G+    AF  S  L ED GRA  +     ++H 
Sbjct  511  --------REAALFARLATEIKKKVEAGQSSLQAFNHSAVLVEDTGRAHVELLMMELFHQ  562

Query  358  FVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSEL  179
             ++   S     L +ILSL  +++   ++D  A F+R G LT   A      +   C +L
Sbjct  563  TLSNLQSRGESELFDILSLCGALHIARLVDSQAVFIRSGALTALEAQNAHNNVQIFCQQL  622

Query  178  RPHALALVTSFGIPDTFLSPIAFNWIDSNAWSSL  77
            RP  L LV SFG P   L+PIAF+++  N+ S L
Sbjct  623  RPQVLHLVDSFGYPPHLLAPIAFDYVRHNSRSRL  656



>ref|WP_020534466.1| hypothetical protein [Lewinella cohaerens]
Length=769

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 100/215 (47%), Gaps = 24/215 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY--------------VTCKRKGKAFKGLGLEHMNEPCPVIP  566
            FEGDN VLMQ V+K LL +Y              +  +R   AF        +E  P   
Sbjct  563  FEGDNTVLMQLVAKGLLTDYKQSFHEDGNMAILRMLGQRVNTAF--------SETNPFAI  614

Query  565  SKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRA  386
                   L S +FQ   F  RER LL   A  +  H   G+    A L+       L  A
Sbjct  615  RNTDGGHLRSTEFQLAAFQFRERRLLFSLAQRLRGHIKDGKSAYEAGLICQTHMLALAEA  674

Query  385  FADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVR  209
            F +R    +   A       S+ NIL  +RS+YA+  +++ AA +L    L    + A+R
Sbjct  675  FIERVTLESTAKAVSEAKGTSIYNILRKLRSLYALHTIEKHAAWYLEQDYLAGTKSKAIR  734

Query  208  KEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            K++  LC ELRP A+ALV +FGIP++ + +PI  +
Sbjct  735  KQVDQLCGELRPEAVALVEAFGIPESLIAAPIVMD  769



>ref|WP_026707256.1| acyl-CoA oxidase [Flavobacterium frigidarium]
Length=750

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 106/210 (50%), Gaps = 17/210 (8%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL---------EHMNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+       K F  +G+           + E  P+   K  S
Sbjct  547  FEGDNTVLMQLVAKNRLSEF------RKTFGEMGIFNYVYENAVTAITEKNPIATRKTDS  600

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L   QF    F  RER +L   A  + +   SG    +AF +      D+ +A+ DR 
Sbjct  601  EHLLDGQFHLQAFEHRERTILASAARRLKKLIESGLEAYDAFNVVQHQMIDVAQAYLDRV  660

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  +V     KNIL  +  +YA++ ++++ + +L  G +      A+RK +  
Sbjct  661  VLEQFQVAIATVKDSDEKNILDKLAQLYALSQIEKNKSWYLEDGYMEAVKTKAIRKMVNQ  720

Query  193  LCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            LC ++RP A+ALV +F IPD+ L +PIAFN
Sbjct  721  LCWDIRPSAVALVDAFAIPDSCLAAPIAFN  750



>gb|AEW08613.1| hypothetical protein CL814Contig1_06, partial [Pinus radiata]
 gb|AFB34598.1| hypothetical protein CL814Contig1_06, partial [Pinus mugo]
 gb|AFB34599.1| hypothetical protein CL814Contig1_06, partial [Pinus mugo]
 gb|AFG46042.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46043.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46044.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46045.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46046.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46047.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46048.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46049.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46050.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46051.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46052.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46053.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46054.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46055.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46056.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46057.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46058.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
 gb|AFG46059.1| hypothetical protein CL814Contig1_06, partial [Pinus taeda]
Length=66

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -2

Query  319  KNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGI  140
            K+I+ L+R+ YA+  L+ED AFLRYG L+   +  +RKEIA LC ELRPHALALV SFGI
Sbjct  1    KDIIGLLRNTYALITLEEDIAFLRYGYLSPQQSQMIRKEIAKLCDELRPHALALVDSFGI  60

Query  139  PDTFLS  122
            P  +LS
Sbjct  61   PQPYLS  66



>ref|WP_022834726.1| acyl-CoA oxidase [Salisaeta longa]
Length=758

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 101/208 (49%), Gaps = 14/208 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL---------EHMNEPCPVIPSKLSS  551
            FEGDN VLM QV+K LL+++   +R+ +    LG+           + E  P++     +
Sbjct  553  FEGDNTVLMLQVAKGLLSDF---QREFRDLNVLGMMRFVAGEVTTRVTEMNPIVKRATDT  609

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L     Q D    RER L+   A  +     +G    +AF+        L  A A+R 
Sbjct  610  EHLREADMQGDALRFRERALVQSAAQRLKHRMDNGAAPFDAFVEVQDHLLTLAHAHAERV  669

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILD-EDAAFLRYGCLTTDNAAAVRKEIAT  194
            ++  FV+   +V   S +++L+ +R +Y +  L+   A FL  G      + A+R E+ T
Sbjct  670  VFERFVDRIATVEDASSRSVLNTIRCLYGLHRLEAHRAWFLEKGYFEAPKSKAIRTEVNT  729

Query  193  LCSELRPHALALVTSFGIPDTFL-SPIA  113
            LC E+RP A AL  ++ IP   L +PIA
Sbjct  730  LCGEIRPWARALTDAWQIPSGALQAPIA  757



>ref|WP_015352554.1| acyl-CoA dehydrogenase [Myxococcus stipitatus]
 ref|YP_007363984.1| acyl-CoA dehydrogenase [Myxococcus stipitatus DSM 14675]
 gb|AGC48300.1| acyl-CoA dehydrogenase [Myxococcus stipitatus DSM 14675]
Length=780

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 98/206 (48%), Gaps = 7/206 (3%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL-----EHMNEPCPVIPSKLSSDTLG  539
            FEGDN VLMQ V+K+LL +Y       + +  L L       M +  P    +  S+ L 
Sbjct  571  FEGDNTVLMQLVAKSLLTDYRQRFEDDRVYAVLKLIADKAAAMADRNPFAARRTDSEHLR  630

Query  538  SIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHT  359
               FQ  +   RE  LL   A  + +  A+G     AF         L  A  +R +   
Sbjct  631  DGDFQLRLLRYREEDLLASVAKRLRKRMAAGVEAFTAFNQVQAHLVALSEAHVERVVLEQ  690

Query  358  FVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLR-YGCLTTDNAAAVRKEIATLCSE  182
            F+     V    LK +L  +  +Y ++ L+  + + + +G +    A A+RKE+  LC+E
Sbjct  691  FLLGVEKVQDPGLKTVLGRLCDLYGLSCLESGSGWFQEHGLVEASKALAIRKEVVKLCTE  750

Query  181  LRPHALALVTSFGIPDTFL-SPIAFN  107
            LRP A+ALV +FGIPDT L +PI   
Sbjct  751  LRPDAVALVDAFGIPDTCLAAPIGLG  776



>gb|KJB12480.1| hypothetical protein B456_002G020600 [Gossypium raimondii]
Length=548

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDN +LMQQVSKAL AEY+  +++ K FKGLGLEHMN+PCPVIP +L+S TL   QFQ
Sbjct  487  FEGDNLILMQQVSKALFAEYMAAQKRNKVFKGLGLEHMNKPCPVIPLQLTSTTLRCSQFQ  546


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  783  REACGGQGLKTENRIGQAKSEYDVHSTLRATTMFLCNRLARRFLQNMSHAKGRARHLK  610
            REACGGQGLKTENR+GQ K EYDV ST     + L  ++++        A+ R +  K
Sbjct  460  REACGGQGLKTENRVGQLKGEYDVQSTFEGDNLILMQQVSKALFAEYMAAQKRNKVFK  517



>ref|WP_011404446.1| acyl-CoA oxidase [Salinibacter ruber]
 ref|YP_445820.1| acyl-coenzyme A oxidase I [Salinibacter ruber DSM 13855]
 gb|ABC46051.1| acyl-coenzyme A oxidase I, putative [Salinibacter ruber DSM 13855]
Length=786

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 64/208 (31%), Positives = 98/208 (47%), Gaps = 14/208 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHM---------NEPCPVIPSKLSS  551
            FEGDN VLM QV+K LL+++   +R+ +     G+  +          E  PV+      
Sbjct  574  FEGDNTVLMLQVAKGLLSDF---QREFRDMNLWGMARLVADEVATQVQELNPVVTRTTDP  630

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            D L ++ FQ      R    L      + +    G    +AF+          RA A+R 
Sbjct  631  DHLRALPFQQSALTYRAEKQLQNVGRRLQRRIDDGMEPFDAFVDVQDHLVQCARADAERV  690

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            I   F +A   V    L+  L+ +R ++A++ ++ D   FL  G ++   A A+R  +  
Sbjct  691  ILERFADAVEGVEDADLRETLTTLRRLFALSRIEADLDWFLEAGYVSGSKAKAIRGAVND  750

Query  193  LCSELRPHALALVTSFGIPDTFL-SPIA  113
            LC E+RP A ALV +FGIPD  L +PIA
Sbjct  751  LCDEVRPQAEALVNAFGIPDALLGAPIA  778



>ref|WP_013062161.1| acyl-CoA oxidase [Salinibacter ruber]
 emb|CBH24828.1| acyl-Coenzyme A oxidase [Salinibacter ruber M8]
Length=768

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 97/211 (46%), Gaps = 20/211 (9%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHM------------NEPCPVIPSK  560
            FEGDN VLM QV+K LL+++       + F+ + L  M             E  PV+   
Sbjct  556  FEGDNTVLMLQVAKGLLSDFQ------REFRDMNLWGMARLVADEVATQVQELNPVVTRT  609

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFA  380
               D L ++ FQ      R    L      + +    G    +AF+          RA A
Sbjct  610  TDPDHLRALPFQQSALTYRAEKQLQNVGRRLQRRIDDGMEPFDAFVDVQDHLVQCARADA  669

Query  379  DRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRKE  203
            +R I   F +A   V    L+  L+ +R ++A++ ++ D   FL  G ++   A A+R  
Sbjct  670  ERVILERFADAVEGVEDADLRETLTTLRRLFALSRIEADLDWFLEAGYVSGSKAKAIRGA  729

Query  202  IATLCSELRPHALALVTSFGIPDTFL-SPIA  113
            +  LC E+RP A ALV +FGIPD  L +PIA
Sbjct  730  VNDLCDEVRPQAEALVNAFGIPDALLGAPIA  760



>ref|WP_043324301.1| acyl-CoA oxidase, partial [Corallococcus coralloides]
Length=781

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 98/209 (47%), Gaps = 12/209 (6%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------EHMNEPCPVIPSKLSSDTL  542
            FEGDN VLMQ V+K LL  Y       + F  L L          +  P+   +  +D L
Sbjct  571  FEGDNTVLMQLVAKGLLTGYRQRFEDDRVFAVLRLIVDQAATVFTDRNPIAGRRTDTDHL  630

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAF--LLSYQLAEDLGRAFADRTI  368
                FQ      RE  LL   +  + +   +G     AF  + ++ LA  L  A  +R +
Sbjct  631  RDSDFQLRALRFREEALLASVSKRIRKRLTAGVEAFEAFNQVQAHLLA--LAHASVERIV  688

Query  367  YHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATL  191
               F+     V   +LK +L  +  ++ ++ L+  +  FL +G LT   A A+RKE   L
Sbjct  689  LEQFLRGVADVKDEALKPVLGRMADLFGLSCLESASGWFLEHGWLTAPKAQAIRKERVKL  748

Query  190  CSELRPHALALVTSFGIPDTFL-SPIAFN  107
            C ELRP A+ LV +FGIPDT L +PI   
Sbjct  749  CEELRPDAVGLVDAFGIPDTCLAAPIGLG  777



>ref|WP_043716325.1| acyl-CoA oxidase [Kutzneria sp. 744]
 gb|EWM11475.1| acyl-CoA oxidase [Kutzneria sp. 744]
Length=639

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 102/209 (49%), Gaps = 24/209 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT----------CKRKGKAFKGLGLEHMNEPCPVI-PSKL  557
            FEGDN VL+Q V+K LL  Y +           +   + F GL    + E  P + P + 
Sbjct  414  FEGDNTVLLQLVAKGLLTNYRSQFEELGTLGLARFVAEQFVGL----VTERLPSLSPGRD  469

Query  556  SSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LGR  389
              D L    +Q   F  RE H+++  A  + Q   +  G  + F + +  A+D     GR
Sbjct  470  DPDVLHDRGWQLRAFEDREAHVVDGLARRLRQ---AASGAADPFEV-FNSAQDHVLRAGR  525

Query  388  AFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAV  212
               +R +   F  A        +K++L  V ++YA+ I++ED A FL +G LT+    AV
Sbjct  526  VHTERVVLQAFAEAVEGCADPEVKHLLDRVCTLYALHIVNEDLAWFLAHGRLTSGRGKAV  585

Query  211  RKEIATLCSELRPHALALVTSFGIPDTFL  125
               +  LC+ELRPHA  LV +F IP+ FL
Sbjct  586  NGAVNALCAELRPHARTLVDAFAIPERFL  614



>gb|AFE09438.1| putative acyl-CoA dehydrogenase [Corallococcus coralloides DSM 
2259]
Length=804

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 98/209 (47%), Gaps = 12/209 (6%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------EHMNEPCPVIPSKLSSDTL  542
            FEGDN VLMQ V+K LL  Y       + F  L L          +  P+   +  +D L
Sbjct  571  FEGDNTVLMQLVAKGLLTGYRQRFEDDRVFAVLRLIVDQAATVFTDRNPIAGRRTDTDHL  630

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAF--LLSYQLAEDLGRAFADRTI  368
                FQ      RE  LL   +  + +   +G     AF  + ++ LA  L  A  +R +
Sbjct  631  RDSDFQLRALRFREEALLASVSKRIRKRLTAGVEAFEAFNQVQAHLLA--LAHASVERIV  688

Query  367  YHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATL  191
               F+     V   +LK +L  +  ++ ++ L+  +  FL +G LT   A A+RKE   L
Sbjct  689  LEQFLRGVADVKDEALKPVLGRMADLFGLSCLESASGWFLEHGWLTAPKAQAIRKERVKL  748

Query  190  CSELRPHALALVTSFGIPDTFL-SPIAFN  107
            C ELRP A+ LV +FGIPDT L +PI   
Sbjct  749  CEELRPDAVGLVDAFGIPDTCLAAPIGLG  777



>ref|WP_006946147.1| acyl-CoA oxidase [Dermacoccus sp. Ellin185]
 gb|EFP57525.1| acyl-CoA dehydrogenase, middle domain protein [Dermacoccus sp. 
Ellin185]
Length=680

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 105/217 (48%), Gaps = 33/217 (15%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY-----------VTCKRKGKAFKGL--------GLEHMNEP  581
            FEGDN VLMQ V+K LL EY              K   +  +GL        GL+ + + 
Sbjct  457  FEGDNTVLMQLVAKGLLTEYKDQWGDLDIAGTIAKVTAQTVEGLVENTLKRAGLQRLIDG  516

Query  580  CPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAE  401
                  + + D+ G   +Q  +F  R  HLL   A  + +      GK + F + +  A+
Sbjct  517  ATPRNDETALDSRG---WQESMFSERASHLLETAAMRLRK-----AGKSDGFAV-FNAAQ  567

Query  400  D----LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCL  236
            D      +A  D  I+  F     ++  G  + +++ V  +YA+A ++ED   F+ +G +
Sbjct  568  DHILAAAKADIDLRIFEAFKEGLEAMPEGEARKLMAKVFDLYALASIEEDKGWFIEHGRI  627

Query  235  TTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFL  125
            TT  + AV   I  LC+ELRPHA+ L  +FGIP+++L
Sbjct  628  TTSRSKAVTTRINELCAELRPHAVDLTKAFGIPESWL  664



>ref|WP_038570380.1| acyl-CoA oxidase [Dermacoccus nishinomiyaensis]
 gb|AIF40185.1| acyl-CoA oxidase [Dermacoccus nishinomiyaensis]
Length=680

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 105/217 (48%), Gaps = 33/217 (15%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY-----------VTCKRKGKAFKGL--------GLEHMNEP  581
            FEGDN VLMQ V+K LL EY              K   +  +GL        GL+ + + 
Sbjct  457  FEGDNTVLMQLVAKGLLTEYKDQWGDLDIAGTIAKVTAQTVEGLVENTLKRAGLQRLIDG  516

Query  580  CPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAE  401
                  + + D+ G   +Q  +F  R  HLL   A  + +      GK + F + +  A+
Sbjct  517  ATPRNDETALDSRG---WQESMFSERASHLLETAAMRLRK-----AGKSDGFAV-FNAAQ  567

Query  400  D----LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCL  236
            D      +A  D  I+  F     ++  G  + +++ V  +YA+A ++ED   F+ +G +
Sbjct  568  DHILAAAKADIDLRIFEAFKEGLEAMPEGEARKLMAKVFDLYALASIEEDKGWFIEHGRI  627

Query  235  TTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFL  125
            TT  + AV   I  LC+ELRPHA+ L  +FGIP+++L
Sbjct  628  TTSRSKAVTTRINELCAELRPHAVDLTKAFGIPESWL  664



>ref|XP_004365565.1| acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89168.1| acyl-coenzyme A oxidase 3 [Capsaspora owczarzaki ATCC 30864]
Length=705

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/241 (27%), Positives = 114/241 (47%), Gaps = 36/241 (15%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPC----------------  578
            + FEGDNNVL+ QV++ L+ EY     KG+A    G+    +P                 
Sbjct  454  MTFEGDNNVLLVQVARQLVKEYARAMEKGQA----GIPQFAKPTDRLAHMAGTARGVPLS  509

Query  577  ---PVI---------PSKLSSDTLGS----IQFQNDIFCLRERHLLNLFAAEVSQHQASG  446
               PV+            LS+   GS     +FQ  IF +RE   +    A +S  +A+G
Sbjct  510  AAKPVVWDASAQRFVEVNLSAFDNGSKHRNAEFQMRIFEIREYDAIKRLIAALSAKKAAG  569

Query  445  EGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDE  266
               ++A+ L  +LA   G+A+ +R +   F+    + +S   + +L  +R+++AM  +  
Sbjct  570  HNDDSAWNLCGELAAVCGQAYIERFVLTRFIEDIQTESSAPERLVLEKLRALHAMWRITT  629

Query  265  DAAFLRYGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIAFNWIDSNAW  86
              +FL Y  +   +   +  E+  + +ELRPH   LV +FG+P   L  I  +++ +++W
Sbjct  630  QPSFLAYQFIPRQDIEIMADEVNVILAELRPHLANLVKAFGVPQHLLPAITSDYVAAHSW  689

Query  85   S  83
            +
Sbjct  690  A  690



>gb|AAB97825.1| acyl-CoA oxidase [Myxococcus xanthus DK 1622]
Length=433

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 93/206 (45%), Gaps = 7/206 (3%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL-----EHMNEPCPVIPSKLSSDTLG  539
            FEGDN VLMQ V+K LL  Y       + F  L L       + +  P    +  SD L 
Sbjct  224  FEGDNTVLMQLVAKGLLTGYRQRFEDDRVFAVLKLLADRATAVVDRNPFAARRTDSDHLR  283

Query  538  SIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHT  359
               +       RE  LL   +  + +  ++G     AF        +L  A  +R +   
Sbjct  284  DNDYHLRALRFREEELLATVSQRIRKRLSAGVEAFEAFNQVQVHLLELAHAHVERLVLEQ  343

Query  358  FVNAEPSVNSGSLKNILSLVRSMYAMAILDE-DAAFLRYGCLTTDNAAAVRKEIATLCSE  182
            F+     V    LK +L  +  +Y ++ L+  +  F  +G L      A+RKE+  LC+E
Sbjct  344  FLKGVADVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEGTKVKAIRKEVTRLCAE  403

Query  181  LRPHALALVTSFGIPDTFL-SPIAFN  107
            LRP A+ALV +FG+PDT L +PI   
Sbjct  404  LRPDAVALVNAFGVPDTCLAAPIGLG  429



>ref|WP_033441505.1| acyl-CoA oxidase [Saccharothrix sp. NRRL B-16314]
Length=617

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 101/210 (48%), Gaps = 22/210 (10%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT--------CKRKGKAFKGLGLEHMNEPCPVIPSKL---  557
            FEGDN VL+Q V+K LL  Y             +  A + +G+         I  +L   
Sbjct  409  FEGDNTVLLQLVAKGLLTSYRDHVGDLDPWGMARFVADQAVGVVIERTAARAIIDRLVSG  468

Query  556  SSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LGR  389
            SSD L    +Q   F  RE+H+L   A  + +       KENAF + +  A+D      R
Sbjct  469  SSDALLDRGWQVRQFEDREKHVLEGLARRLRRAS-----KENAFDV-FNAAQDHVLHAAR  522

Query  388  AFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAV  212
            A  DR +   FV A       S   +L  V  +YA++ ++ D A FL +G LT   A AV
Sbjct  523  AHVDRVVLEAFVAAVDRCGDPSTSALLDEVCDLYALSTIEADRAWFLEHGRLTPQRAKAV  582

Query  211  RKEIATLCSELRPHALALVTSFGIPDTFLS  122
             + +  LC  LRPHA ALV +FGIP++ L+
Sbjct  583  SQAVNELCGRLRPHARALVDAFGIPESLLT  612



>ref|WP_016988806.1| acyl-CoA oxidase [Flavobacterium sp. ACAM 123]
Length=752

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 102/206 (50%), Gaps = 8/206 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMN------EPCPVIPSKLSSDTL  542
            FEGDN VLMQ V+K  L+E+     K  A   +   + N      E  P++  K     L
Sbjct  547  FEGDNTVLMQLVAKNRLSEFRKSFGKMDAMGMINYVYENAKTAISEKNPIVTRKTDDSHL  606

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
               +F  D F  RE+  L   A  + +   SG    +AF +      D+ +A+ +R +  
Sbjct  607  IDEEFHLDAFQYREKTTLASAAKRIKKLIDSGLDPYDAFNIVQHQMIDVAQAYLERVVLE  666

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLCS  185
             F  A  ++   + K ++  +  +YA++ ++++   +L  G +      A+RK +  LC 
Sbjct  667  QFQEAVQNIEDKNSKEVMLKLYQLYALSQIEKNKGWYLEDGYMEAVKTKAIRKMVNQLCW  726

Query  184  ELRPHALALVTSFGIPDTFL-SPIAF  110
            E+RP A++LV +F IPD+ L +PIAF
Sbjct  727  EIRPDAVSLVKAFDIPDSCLAAPIAF  752



>ref|WP_008611975.1| acyl-CoA oxidase [Joostella marina]
 gb|EIJ38714.1| acyl-CoA dehydrogenase [Joostella marina DSM 19592]
Length=752

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 102/204 (50%), Gaps = 8/204 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT---CKRKGKAFKGLGLE---HMNEPCPVIPSKLSSDTL  542
            FEGDN VL+Q  +K +L  + T           K +G +    +    P+  +K   + L
Sbjct  548  FEGDNTVLIQLAAKGILTNFKTEFNSDNFMDVLKYVGTQLSDRLTTINPIFTNKTDKEHL  607

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
               +F  + F  R R L    A+ V ++   G     AFL        LG+A+++   Y+
Sbjct  608  FDTEFHKEAFEYRTRRLTFSVASRVQKYIKKGIPSYQAFLKVQTHMVMLGKAYSEELSYN  667

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLCS  185
             F+N    +    L+ +   + +++A++ ++  AA +L +G ++ + + A+RK++  +CS
Sbjct  668  EFLNFVEKIQEEELRFLFKKLGALFALSEINHHAAWYLEHGYISANKSKAIRKQVERICS  727

Query  184  ELRPHALALVTSFGIPDTFL-SPI  116
            ELRPH   LV  FGIP + L +PI
Sbjct  728  ELRPHVNTLVDGFGIPKSCLKTPI  751



>gb|ABF87186.1| putative acyl-CoA dehydrogenase [Myxococcus xanthus DK 1622]
Length=660

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 93/206 (45%), Gaps = 7/206 (3%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL-----EHMNEPCPVIPSKLSSDTLG  539
            FEGDN VLMQ V+K LL  Y       + F  L L       + +  P    +  SD L 
Sbjct  451  FEGDNTVLMQLVAKGLLTGYRQRFEDDRVFAVLKLLADRATAVVDRNPFAARRTDSDHLR  510

Query  538  SIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHT  359
               +       RE  LL   +  + +  ++G     AF        +L  A  +R +   
Sbjct  511  DNDYHLRALRFREEELLATVSKRIRKRLSAGVEAFEAFNQVQVHLLELAHAHVERLVLEQ  570

Query  358  FVNAEPSVNSGSLKNILSLVRSMYAMAILDE-DAAFLRYGCLTTDNAAAVRKEIATLCSE  182
            F+     V    LK +L  +  +Y ++ L+  +  F  +G L      A+RKE+  LC+E
Sbjct  571  FLKGVADVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEGTKVKAIRKEVTRLCAE  630

Query  181  LRPHALALVTSFGIPDTFL-SPIAFN  107
            LRP A+ALV +FG+PDT L +PI   
Sbjct  631  LRPDAVALVNAFGVPDTCLAAPIGLG  656



>ref|WP_017497064.1| acyl-CoA oxidase [Flavobacterium sp. WG21]
Length=752

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 103/209 (49%), Gaps = 14/209 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+   ++       LG+ +         + E  P+   K   
Sbjct  547  FEGDNTVLMQLVAKNRLSEF---RKSFGEMGSLGIINYVYENAKTALTEKNPIATRKTDD  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L    F    F  RE+ +L   A  + +    G    +AF +      D+ +A+ DR 
Sbjct  604  EHLLDGDFHLQAFVHREKTILASAARRIKKLVDGGLEPYDAFNVVQHQMIDVAQAYLDRV  663

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  SV     K IL+ +  +YA++ L+++ A +L  G +      A+RK +  
Sbjct  664  VLEQFQLAIKSVEDSKTKEILTKLNQLYALSQLEKNKAWYLEDGYMEAVKTKAIRKIVNQ  723

Query  193  LCSELRPHALALVTSFGIPDTFLS-PIAF  110
            LC ++RP A+ALV +F IP++ LS PIAF
Sbjct  724  LCWDIRPDAVALVNAFDIPESCLSAPIAF  752



>ref|WP_005440921.1| acyl-CoA oxidase [Saccharomonospora azurea]
 gb|EHY88843.1| acyl-CoA dehydrogenase [Saccharomonospora azurea NA-128]
Length=640

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 102/222 (46%), Gaps = 27/222 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K LL  Y           T +   + F G  +E       +      
Sbjct  425  FEGDNTVLLQLVAKGLLTHYRSQFQDLSPLATARFVAEQFVGAVIERTAARRVVERIVDA  484

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P++   D +    +Q  +F  RE H+L+  A  +        G++NAF + +  A+D  
Sbjct  485  SPARDDDDAVFDRAWQLKLFTDRESHVLDGLARRLR-----AAGRDNAFDV-FNAAQDHV  538

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTD  227
                R   +R +  +FV A     +  +K +L  V  ++ +A ++ D A FL +G LT+ 
Sbjct  539  LRAARVHVERVVLDSFVAAVDRCENAEVKALLDKVCDLHVLATIEADRAWFLEHGRLTSG  598

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIAFNWI  101
             A AV   +  LC ELRPHA  LV +F +P+        +W+
Sbjct  599  RAKAVVAGVNRLCGELRPHARTLVDAFAVPERLWRVPMLDWV  640



>ref|WP_020478009.1| acyl-CoA dehydrogenase [Myxococcus xanthus]
Length=777

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 93/206 (45%), Gaps = 7/206 (3%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL-----EHMNEPCPVIPSKLSSDTLG  539
            FEGDN VLMQ V+K LL  Y       + F  L L       + +  P    +  SD L 
Sbjct  568  FEGDNTVLMQLVAKGLLTGYRQRFEDDRVFAVLKLLADRATAVVDRNPFAARRTDSDHLR  627

Query  538  SIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHT  359
               +       RE  LL   +  + +  ++G     AF        +L  A  +R +   
Sbjct  628  DNDYHLRALRFREEELLATVSKRIRKRLSAGVEAFEAFNQVQVHLLELAHAHVERLVLEQ  687

Query  358  FVNAEPSVNSGSLKNILSLVRSMYAMAILDE-DAAFLRYGCLTTDNAAAVRKEIATLCSE  182
            F+     V    LK +L  +  +Y ++ L+  +  F  +G L      A+RKE+  LC+E
Sbjct  688  FLKGVADVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEGTKVKAIRKEVTRLCAE  747

Query  181  LRPHALALVTSFGIPDTFL-SPIAFN  107
            LRP A+ALV +FG+PDT L +PI   
Sbjct  748  LRPDAVALVNAFGVPDTCLAAPIGLG  773



>ref|WP_033431876.1| acyl-CoA oxidase [Saccharothrix syringae]
Length=617

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 72/214 (34%), Positives = 104/214 (49%), Gaps = 23/214 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT--------CKRKGKAFKGLGLEHMNEPCPVIPSKL---  557
            FEGDN VL+Q V+K LL  Y             +  A + +G+         +  +L   
Sbjct  409  FEGDNTVLLQLVAKGLLTSYRDHVGDLDPWGMARFVADQAVGVVIERTAARALIDRLVSG  468

Query  556  SSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LGR  389
            SSD L    +Q   F  RERH+L   A  + +        ENAF + +  A+D      R
Sbjct  469  SSDALLDRGWQVRQFEDRERHVLEGLARRLRRAS-----PENAFDV-FNAAQDHVLHAAR  522

Query  388  AFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAV  212
            A  DR +   FV A        +  +L  V  +YA+++++ D A FL +G LT   A AV
Sbjct  523  AHVDRVVLEAFVAALERGTDPEVTALLGKVCDLYALSVIEADRAWFLEHGRLTPQRAKAV  582

Query  211  RKEIATLCSELRPHALALVTSFGIPDTFL-SPIA  113
             + +  LC +LRPHA  LV +FGIP+ +L +PIA
Sbjct  583  SQAVNELCGQLRPHARDLVDAFGIPEPWLAAPIA  616



>ref|XP_003294150.1| hypothetical protein DICPUDRAFT_58874 [Dictyostelium purpureum]
 gb|EGC29318.1| hypothetical protein DICPUDRAFT_58874 [Dictyostelium purpureum]
Length=638

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 98/206 (48%), Gaps = 10/206 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDN +L QQV+K +L+E     RK              P   I  K  S  L S +F 
Sbjct  443  FEGDNILLYQQVAKFVLSE----SRKNPP------PEYEAPSDSIKQKTDSQFLRSFEFL  492

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             +    R    +     ++S+  A G+   +++  +      LG+ + ++ I   F+   
Sbjct  493  QNALNARFAQSVAYVTEKLSESVAEGKPIMDSWNDNSPFIVKLGQVYTEKIILRKFIEGI  552

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
               +    +  L L+ S+Y + I+++D  FL+YG ++++ A A+  ++  +C EL PH +
Sbjct  553  SGYSDEKAQAALQLLVSLYTLNIIEKDPWFLKYGYISSEQAEAITVQVLEICKELVPHCI  612

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAW  86
            +L  + G  +  L PIA +WI  N +
Sbjct  613  SLTDALGFDNETLGPIANDWISKNKF  638



>ref|WP_025744009.1| acyl-CoA oxidase [Aquimarina sp. SW150]
Length=754

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 100/205 (49%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKG---KAFKGLGL---EHMNEPCPVIPSKLSSDTL  542
            FEGDN+VL+Q  +K +L+++ +           K LG    + +N   PV  + +  D L
Sbjct  549  FEGDNHVLLQLAAKGVLSDFKSEFNSAGFTAVLKLLGARIGDKLNTINPVYTNNVDKDHL  608

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
             S +F    F  R R L    A  +  +   G     AFL        LG+A++    Y 
Sbjct  609  YSSKFHKHAFDFRTRRLTYTIAMRIRDYVKKGMPSYQAFLKVQTHLLALGKAYSVELAYA  668

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLCS  185
            TFV+   ++     + +   +  +YA+  L +DA+ +L  G ++   + A+R+ +  LC+
Sbjct  669  TFVDFTDTIEDEKNRLLFQKLGVLYALHELRKDASWYLEQGYISGTKSKAMRQRVERLCT  728

Query  184  ELRPHALALVTSFGIPDTFLS-PIA  113
            ELRPH   L+  FGIPD  +S PIA
Sbjct  729  ELRPHLGILIDGFGIPDHCMSAPIA  753



>ref|WP_040407217.1| acyl-CoA oxidase, partial [Amycolatopsis nigrescens]
Length=642

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 104/218 (48%), Gaps = 23/218 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K LL  Y           T K   + F G+ +E       +      
Sbjct  425  FEGDNTVLLQLVAKGLLTSYKDHFEDLSPLATAKFAAEQFMGVVIERTAARKLIERLVDA  484

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P +   D L    +Q  +F  RE H+L+  A  + +  +S +   + F + +  A+D  
Sbjct  485  SPGRDDEDALFDRGWQVKLFEDREEHVLDGVARRLRRAASSSDDAFSVFSV-FNDAQDHV  543

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
               GRA  DR +   FV A         K +L  +  +Y ++ ++ D A FL +G LT+ 
Sbjct  544  LRAGRAHVDRVVLEAFVAAIDRCADQDAKLLLDRLCDLYVLSNIEADRAWFLEHGRLTSA  603

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPI  116
             + AV   +  LC++LRPHA  LV +F IP+ FL +PI
Sbjct  604  RSKAVVSAVNELCAQLRPHARTLVDAFAIPEQFLAAPI  641



>ref|WP_040459667.1| acyl-CoA oxidase [Galbibacter marinus]
Length=754

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 97/205 (47%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT---CKRKGKAFKGLGLE---HMNEPCPVIPSKLSSDTL  542
            FEGDN VL+Q  +K +L  + T           K LG +    +    P+  +K   D L
Sbjct  548  FEGDNTVLIQLAAKGILTNFKTEFNSDHYRDILKYLGTQLSDRLTTFNPIFTNKTDKDHL  607

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
               +F  +    + R L    A+ +  +   G     AFL       +LG+A+++   Y 
Sbjct  608  YDSEFHVNALEYKRRRLTFSVASRIQNYTKKGIPSYQAFLKVQTHLVELGKAYSEELSYK  667

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMA-ILDEDAAFLRYGCLTTDNAAAVRKEIATLCS  185
             F++   ++ S  LK +   + +++A++ I D  A +L  G ++   + A+R  +  LCS
Sbjct  668  AFLDFTKTIQSNDLKFLFGKLGTLFALSEIHDNAAWYLEQGYISGTKSKAIRNRVERLCS  727

Query  184  ELRPHALALVTSFGIPDT-FLSPIA  113
            ELRPH   LV  FGIP++   +PI 
Sbjct  728  ELRPHVNTLVDGFGIPNSCITTPIT  752



>gb|EKF56589.1| acyl-CoA oxidase [Galbibacter marinus]
Length=790

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 97/205 (47%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT---CKRKGKAFKGLGLE---HMNEPCPVIPSKLSSDTL  542
            FEGDN VL+Q  +K +L  + T           K LG +    +    P+  +K   D L
Sbjct  584  FEGDNTVLIQLAAKGILTNFKTEFNSDHYRDILKYLGTQLSDRLTTFNPIFTNKTDKDHL  643

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
               +F  +    + R L    A+ +  +   G     AFL       +LG+A+++   Y 
Sbjct  644  YDSEFHVNALEYKRRRLTFSVASRIQNYTKKGIPSYQAFLKVQTHLVELGKAYSEELSYK  703

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMA-ILDEDAAFLRYGCLTTDNAAAVRKEIATLCS  185
             F++   ++ S  LK +   + +++A++ I D  A +L  G ++   + A+R  +  LCS
Sbjct  704  AFLDFTKTIQSNDLKFLFGKLGTLFALSEIHDNAAWYLEQGYISGTKSKAIRNRVERLCS  763

Query  184  ELRPHALALVTSFGIPDT-FLSPIA  113
            ELRPH   LV  FGIP++   +PI 
Sbjct  764  ELRPHVNTLVDGFGIPNSCITTPIT  788



>ref|WP_026812503.1| acyl-CoA oxidase [Arenibacter certesii]
Length=754

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 66/216 (31%), Positives = 100/216 (46%), Gaps = 9/216 (4%)
 Frame = -2

Query  760  LEN*KPDRPSKK*I*CTLYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------  599
            LEN  PD  +   I  T  FEGDN VL+Q  +K +L+++ +    G     L L      
Sbjct  532  LENRIPDLKNDVDIFTT--FEGDNTVLLQLAAKGILSDFNSELNSGGFTAVLKLISAQIK  589

Query  598  EHMNEPCPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLL  419
            + M    P   +K+  D L + +F    F  R R L    A  +  +   G     AFL 
Sbjct  590  DKMVAINPAYSNKVDKDHLYNPKFHQHAFKFRTRRLTYSLAMRIKDYIKKGVPSYQAFLK  649

Query  418  SYQLAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYG  242
                   LG+A++    Y TFVN+  S+     + +   +  ++A+  + EDA+ FL  G
Sbjct  650  VQTHLLALGKAYSCELAYSTFVNSTDSIEDLKYQELFRKLGILFALHEIREDASWFLEQG  709

Query  241  CLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPD  134
             +    + A+R+ +  L +ELRPH   LV  FGIPD
Sbjct  710  YIGGTKSKAIRQRVERLSTELRPHIEVLVDGFGIPD  745



>ref|WP_002637005.1| acyl-CoA dehydrogenase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK90529.1| Acyl-coenzyme A oxidase 1, peroxisomal protein [Myxococcus sp. 
(contaminant ex DSM 436)]
Length=777

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 93/206 (45%), Gaps = 7/206 (3%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL-----EHMNEPCPVIPSKLSSDTLG  539
            FEGDN VLMQ V+K LL  Y       + F  L +       + +  P    +  SD L 
Sbjct  568  FEGDNTVLMQLVAKGLLTGYRQRFEDDRVFAVLRILADRATSVVDRNPFAARRTDSDHLR  627

Query  538  SIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHT  359
               +       RE  LL   +  + +   +G     AF        +L  A  +R     
Sbjct  628  DNDYHLRALRFREEELLATVSKRIRKRLGAGVEAFEAFNQVQVHMLELAHAHVERLALEQ  687

Query  358  FVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLR-YGCLTTDNAAAVRKEIATLCSE  182
            F+     V    LK +L  +  +Y ++ L+  + + + +G L    A A+RKE+  LC+E
Sbjct  688  FLKGVAQVKDPGLKTVLGRLCDLYGLSCLEAASGWFQEHGWLEGAKAKAIRKEVTRLCAE  747

Query  181  LRPHALALVTSFGIPDTFL-SPIAFN  107
            LRP A+ALV +FGIPDT L +PI   
Sbjct  748  LRPDAVALVDAFGIPDTCLAAPIGLG  773



>ref|WP_042180408.1| acyl-CoA oxidase [Kibdelosporangium sp. MJ126-NF4]
 emb|CEL14379.1| Acyl-coenzyme A oxidase 1, peroxisomal [Kibdelosporangium sp. 
MJ126-NF4]
Length=619

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 99/208 (48%), Gaps = 19/208 (9%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPVIPSKLS  554
            FEGDN VL+Q V+K LL +Y           T K   +   G  LE +      + ++  
Sbjct  414  FEGDNTVLLQLVAKGLLTDYRDNFADLSPLATAKLVAEQLMGTVLERI--AARQVIARFD  471

Query  553  SDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDL---GRAF  383
             D   S  +Q  +F  RE+H+L+  A  +   +A+     + F +   + + +   GR  
Sbjct  472  DDDPRSRDWQRSLFEDREQHVLSGLAGRL---RAAASSDADPFDVFNDVQDHVLLAGRTH  528

Query  382  ADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRK  206
             DR ++  F  A        +K +L  V  ++A+A ++ D A FL +G +T   A  V  
Sbjct  529  IDRLVFDAFDAAVEHCADEEVKALLGQVLDLHALATIEADRAWFLEHGRITAARAKKVIA  588

Query  205  EIATLCSELRPHALALVTSFGIPDTFLS  122
            E+  LC ELRPHA  LV +F +P  FL+
Sbjct  589  EVNALCKELRPHAATLVDAFAVPRQFLA  616



>ref|WP_013937938.1| acyl-CoA dehydrogenase [Myxococcus fulvus]
 gb|AEI64784.1| putative acyl-CoA dehydrogenase [Myxococcus fulvus HW-1]
Length=777

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 95/207 (46%), Gaps = 9/207 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL-----EHMNEPCPVIPSKLSSDTLG  539
            FEGDN VLMQ V+K LL  Y       + F  L L       M +  P    +  SD L 
Sbjct  568  FEGDNTVLMQLVAKGLLTGYKQRFEDDRVFAVLKLLTDRATSMMDRNPFAARRTDSDHLR  627

Query  538  SIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAF-LLSYQLAEDLGRAFADRTIYH  362
               +       R   LL   +  + +  ++G     AF  +   L E L  A  +R    
Sbjct  628  DNDYHLRALRFRVEELLATVSRRIRKRLSAGVEAFEAFNQVQVHLLE-LAHAHVERLALE  686

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLR-YGCLTTDNAAAVRKEIATLCS  185
             F+     V    LK +L  +  +Y ++ L+  + + + +G L    A A+RKE+  LC+
Sbjct  687  QFLAGVAEVKEPGLKTVLGRLCDLYGLSCLEAASGWFQEHGWLEGTKAKAIRKEVTRLCA  746

Query  184  ELRPHALALVTSFGIPDTFL-SPIAFN  107
            ELRP A+ALV +FG+PDT L +PI   
Sbjct  747  ELRPDAVALVDAFGVPDTCLAAPIGLG  773



>ref|WP_013154234.1| acyl-CoA oxidase [Nocardiopsis dassonvillei]
 gb|ADH68627.1| acyl-CoA dehydrogenase domain protein [Nocardiopsis dassonvillei 
subsp. dassonvillei DSM 43111]
Length=656

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/223 (31%), Positives = 113/223 (51%), Gaps = 30/223 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---------VTCKR--KGKAFKGLGLEHMNEPCPVI----  569
            FEGDN VL+QQ++K LL  +         +   R   GK F+ + +E      P+I    
Sbjct  426  FEGDNTVLLQQLTKGLLTNFKDSFGDLDQLGLARFMAGKVFETV-IER-TAAIPLIERLV  483

Query  568  ---PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED  398
               P +    +L +  +Q ++   RE+H++   AA + +   SG   E+AF + +  A+D
Sbjct  484  AAAPGRGEEASLYNRGWQLELLEDREKHVIEGLAARLRR---SGRNGEDAFDV-FNRAQD  539

Query  397  ----LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLT  233
                 GRA  DR +   FV         +   +L+ +  +Y M++++ED A FL +  L+
Sbjct  540  HVLAAGRAHMDRVVLEAFVAGIDRCGDTATAKLLNRLCDLYVMSVVEEDRAWFLEHERLS  599

Query  232  TDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            T  A AV + +  LC  LRP+A+ LV +FG+ D +L +PIA  
Sbjct  600  TSRAKAVTQAVNDLCRGLRPYAVQLVNAFGLRDEWLAAPIALG  642



>ref|WP_019609734.1| acyl-CoA oxidase [Nocardiopsis sp. CNS639]
Length=656

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/223 (31%), Positives = 113/223 (51%), Gaps = 30/223 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---------VTCKR--KGKAFKGLGLEHMNEPCPVI----  569
            FEGDN VL+QQ++K LL  +         +   R   GK F+ + +E      P+I    
Sbjct  426  FEGDNTVLLQQLTKGLLTNFKDSFGDLDQLGLARFMAGKVFETV-IER-TAAIPLIERLV  483

Query  568  ---PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED  398
               P +    +L +  +Q ++   RE+H++   AA + +   SG   E+AF + +  A+D
Sbjct  484  AAAPGRGEEASLYNRGWQLELLEDREKHVIEGLAARLRR---SGRNGEDAFDV-FNRAQD  539

Query  397  ----LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLT  233
                 GRA  DR +   FV         +   +L+ +  +Y M++++ED A FL +  L+
Sbjct  540  HVLAAGRAHMDRVVLEAFVAGIDRCGDTATAKLLNRLCDLYVMSVVEEDRAWFLEHERLS  599

Query  232  TDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            T  A AV + +  LC  LRP+A+ LV +FG+ D +L +PIA  
Sbjct  600  TSRAKAVTQAVNDLCRGLRPYAVQLVNAFGLRDEWLAAPIALG  642



>ref|WP_024874955.1| acyl-CoA oxidase [Saccharomonospora sp. CNQ490]
Length=641

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 100/214 (47%), Gaps = 27/214 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K LL  Y           T +   + F G  +E       +      
Sbjct  428  FEGDNTVLLQLVAKGLLTHYKHQFQDLSPLATARFAAEQFVGAMIERTAARKVVERLIDA  487

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P++   + +    +Q  +F  RE H+L+  A      +    G++NAF + +  A+D  
Sbjct  488  TPARDDDEVVFDRAWQCKLFTDRESHVLDGLA-----RRLRAAGRDNAFEV-FNNAQDHV  541

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
                R   +R +  +FV A   V     + +LS +  +Y ++ ++ D A FL +G LT+ 
Sbjct  542  LRAARVHVERVVLDSFVAAIERVEDADARTLLSRLCDLYVLSTVEADRAWFLEHGRLTSP  601

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL  125
             A AV   +  LC ELRPHA  LV +F IP+  L
Sbjct  602  RAKAVVAGVNRLCRELRPHARTLVDAFAIPEPLL  635



>ref|WP_042564417.1| acyl-CoA oxidase [Flavobacterium sp. MEB061]
 gb|KIQ22343.1| acyl-CoA oxidase [Flavobacterium sp. MEB061]
Length=753

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 106/213 (50%), Gaps = 20/213 (9%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLG--------LEH----MNEPCPVIPSK  560
            FEGDN VLMQ V+K  LAE+       KAF  +G         E+    ++E  P+   +
Sbjct  547  FEGDNTVLMQLVAKNRLAEF------RKAFGEMGSLGIINYVYENAKVAISEKNPIATRR  600

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFA  380
               + L   +F    F  RE+ +L   A  + +    G    +AF +      D+ +A+ 
Sbjct  601  TDDEHLLDSEFHLQAFIHREKTILASAARRIKKLVDGGLEPYDAFNVVQHQMIDVAQAYL  660

Query  379  DRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKE  203
            +R +   F  A  +V     K IL+ +  +YA++ ++++ A +L  G +      AVRK 
Sbjct  661  ERIVLEQFQEAIKTVEDEKSKEILTKLYQLYALSQIEKNKAWYLEDGYMEAVKTKAVRKI  720

Query  202  IATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            +  LC ++RP A+ALV +F IP++ L +PIA N
Sbjct  721  VNQLCWDIRPDAVALVNAFDIPESCLAAPIAVN  753



>ref|WP_039751994.1| acyl-CoA oxidase [Hassallia byssoidea]
 gb|KIF31115.1| acyl-CoA oxidase [Hassallia byssoidea VB512170]
Length=769

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 99/214 (46%), Gaps = 26/214 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAE---------------YVTCKRKGKAFKGLGLEHMNEPCPVI  569
            FEGDN VLMQ V+K+ L+E               YVT K K           + E  P+I
Sbjct  562  FEGDNTVLMQLVAKSRLSEFRQEFANMNVFTMLNYVTDKAK---------TSITELNPII  612

Query  568  PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGR  389
                  D L   +F  + F  RER +L   A  + +H  SG    +AF +S      +G 
Sbjct  613  VRNTDDDHLMDPEFHLNAFKYRERDILTSAAKRLKRHIDSGMDSFDAFNVSQHHLVQVGH  672

Query  388  AFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAV  212
            A+ +R I   F+           K IL  + +++A++ ++++   +L  G +      A+
Sbjct  673  AYIERVILEQFIKQVDQTKDAGCKAILKKLCALFALSQIEKNKGWYLEQGYMEGVKTKAI  732

Query  211  RKEIATLCSELRPHALALVTSFGIPDTFLS-PIA  113
            RK +  LC ++R  A+ LV +F IP+  LS PIA
Sbjct  733  RKLMNQLCWDIRQEAVPLVDAFNIPNELLSAPIA  766



>ref|WP_036151893.1| acyl-CoA oxidase [Maribacter forsetii]
Length=754

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 99/205 (48%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------EHMNEPCPVIPSKLSSDTL  542
            FEGDNNVL+Q  +K +L+++            L L      + ++   P+  +K   D L
Sbjct  549  FEGDNNVLLQLAAKGVLSDFKAEFNSAGFSTVLKLLSSQLSDKLSTINPLYTNKTDKDHL  608

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
             + +F    F  R R L    A  +  +   G     AFL        LG+A++    Y 
Sbjct  609  YNPKFHVHAFEHRTRRLTYTIAMRIRGYIKKGIPSYQAFLKVQTHLMTLGKAYSAELAYK  668

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLCS  185
            +F+    ++     K +   + ++YA+  + +DA+ +L  G ++   + A+R+ +  LC+
Sbjct  669  SFIAHNDTMTDPEYKALFEKLGTLYALHEIRKDASWYLEQGYISGTKSKAIRQRVERLCT  728

Query  184  ELRPHALALVTSFGIPDTFLS-PIA  113
            ELRPH  +LV  FGIPD  ++ PIA
Sbjct  729  ELRPHLNSLVDGFGIPDHLMTAPIA  753



>ref|WP_026985441.1| acyl-CoA oxidase [Flavobacterium sp. URHB0058]
Length=753

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 104/210 (50%), Gaps = 14/210 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+   ++       LG+ +         + E  P+   +   
Sbjct  547  FEGDNTVLMQLVAKNRLSEF---RKSFGEMGSLGIINYVYENAKVAITEKNPIATRRTDD  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L   QF    F  RE+ +L   A  + +   +G    +AF +      D+ +A+ +R 
Sbjct  604  EHLLDDQFHLQAFIHREKTILASAAQRIKKLVDNGLEPYDAFNVVQHQMIDVAQAYLERV  663

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  +V     K IL+ +  +YA++ L+++   +L  G +      A+RK +  
Sbjct  664  VLEQFQAAIKTVQDEKSKEILTKLNQLYALSQLEKNKGWYLEDGYMEAVKTKAIRKMVNQ  723

Query  193  LCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            LC ++RP A+ALV +F IP++ L +PIA N
Sbjct  724  LCWDIRPDAVALVNAFDIPESCLAAPIAVN  753



>ref|WP_044187894.1| acyl-CoA oxidase [Hyalangium minutum]
 gb|KFE69122.1| Acyl-coenzyme A oxidase 1, peroxisomal [Hyalangium minutum]
Length=781

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 95/207 (46%), Gaps = 8/207 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------EHMNEPCPVIPSKLSSDTL  542
            FEGDN VLMQ V+K+LL  Y       + F  +          + +  P    +  S+ L
Sbjct  571  FEGDNTVLMQLVAKSLLTGYRQQFEDDRVFTVMKFIVERASGALTDRNPFQVRRTGSEHL  630

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
                FQ      RE  LL   AA + +   +G     AF+      + L  A  +R +  
Sbjct  631  RDGDFQVRALRFRESDLLASAAARLRKRLGTGVDSFQAFIQVQDHLQALAHAHVERVVLE  690

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLCS  185
             F+     V   ++K +L  +  +Y +  L E +  FL    + +  A A+RKE+  LC+
Sbjct  691  QFLAGVEQVEDPAVKAVLGKLCDLYGLGCLVEASGWFLENDHIESGKAKAIRKEVTRLCA  750

Query  184  ELRPHALALVTSFGIPDTFL-SPIAFN  107
            ELRP A+ALV +F IPD+ L +PI   
Sbjct  751  ELRPDAVALVRAFDIPDSALAAPIGLG  777



>ref|WP_035847687.1| acyl-CoA oxidase [Cryptosporangium arvum]
 gb|EXG79190.1| acyl-CoA dehydrogenase [Cryptosporangium arvum DSM 44712]
Length=645

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 106/212 (50%), Gaps = 24/212 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL---------EHMNEPCPVIPSKLSS  551
            FEGDN VL+Q V+K LL  Y   + +      LG+         + + E   V+  +   
Sbjct  422  FEGDNRVLLQLVAKGLLTGY---RDQLGDLDALGMVRFIADQVWDAVTERTSVL-RRFGE  477

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LGRAF  383
              L   ++   +F  RE+H+L   A  + +   +GE   +AF + +  A+D    L R  
Sbjct  478  GDLRDREWHLALFEDREKHVLEGLAKRLRK---AGEPDADAFAV-FNDAQDHVLRLARVH  533

Query  382  ADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRK  206
             +R +   F  A      G L+++L  V +++A++ ++ D A FL +G +T   A  V  
Sbjct  534  VERVLLEAFTEAVAEAPDG-LRDVLGRVCALFALSTIEADLAWFLGHGRMTPSRAKRVTS  592

Query  205  EIATLCSELRPHALALVTSFGIPDTFL-SPIA  113
             +  LC ELRPHAL LV  FGIP+ +L +PIA
Sbjct  593  TVNELCRELRPHALFLVDGFGIPEEWLDAPIA  624



>ref|WP_017565178.1| acyl-CoA oxidase [Nocardiopsis synnemataformans]
Length=656

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 113/223 (51%), Gaps = 30/223 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---------VTCKR--KGKAFKGLGLEHMNEPCPVI----  569
            FEGDN VL+QQ++K LL  +         +   R   GK F+ + +E      P+I    
Sbjct  426  FEGDNTVLLQQLTKGLLTNFKDSFGDLDQLGLARFMAGKVFETV-IER-TAAIPLIERLV  483

Query  568  ---PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED  398
               P +    +L +  +Q ++   RE+H++   AA + +   SG   ++AF + +  A+D
Sbjct  484  AAAPGRGEEASLYNRGWQLELLEDREKHVIEGLAARLRR---SGRNGDDAFEV-FNRAQD  539

Query  397  ----LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLT  233
                 GRA  DR +   FV         S   +L+ +  +Y M++++E+ A FL +  L+
Sbjct  540  HVLTAGRAHMDRVVLEAFVAGIDRCGDTSTAKLLNRLCDLYVMSVIEENRAWFLEHERLS  599

Query  232  TDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            T  A AV + +  LC  LRP+A+ LV +FG+ D +L +PIA  
Sbjct  600  TSRAKAVTQAVNDLCRGLRPYAVQLVNAFGLRDEWLAAPIALG  642



>ref|WP_017588837.1| acyl-CoA oxidase [Nocardiopsis ganjiahuensis]
Length=664

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 110/221 (50%), Gaps = 26/221 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---------VTCKR--KGKAFKGL-----GLEHMNEPCPV  572
            FEGDN VL+QQ++K LL  +         +   R   GK F+ +      +  ++     
Sbjct  432  FEGDNTVLLQQLTKGLLTNFKDSFGDLDQLGLARFMAGKVFETVIERTAAIPLIDRLIAA  491

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P +    +L +  +Q ++   RE+H++   A  + +   SG+   +AF + +  A+D  
Sbjct  492  APGRGEEASLYNRGWQLELLEDREKHVIEGLAGRLRR---SGKDGSDAFDV-FNRAQDHV  547

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
               GRA  DR +   FV         S   +L+ +  +Y M++++ED A FL +  L+T 
Sbjct  548  LAAGRAHMDRVVLEAFVAGIDRCGDKSTAKLLNRLCDLYVMSVVEEDRAWFLEHERLSTS  607

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
             A AV + +  LC  LRP+A+ LV +FG+ D +L +PIA  
Sbjct  608  RAKAVTQAVNDLCRGLRPYAVQLVDAFGLRDEWLGAPIALG  648



>ref|WP_035644791.1| acyl-CoA oxidase [Flavobacterium sp. Fl]
Length=753

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 107/208 (51%), Gaps = 14/208 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+   ++       LG+ +         ++E  P+   +   
Sbjct  547  FEGDNTVLMQLVAKNRLSEF---RKSFGEMGSLGIINYVYENAKTALSEKNPIATRRTED  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L   +F +  F  RE+ +L   A  + +    G    +AF +      D+ +A+ +R 
Sbjct  604  EHLLDAEFHHQAFVHREKTILASAAKRIKKLVDGGLEAYDAFNVVQHQMIDVAQAYLERI  663

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  +++  + K IL+ +  ++A++ ++++ A +L  G +      A+RK +  
Sbjct  664  VLEQFQEALKTISDENSKQILTKLYQLFALSQIEKNKAWYLEDGYMEAVKTKAIRKIVNQ  723

Query  193  LCSELRPHALALVTSFGIPDTFLS-PIA  113
            LC ++RP A+ALV +F IP++ LS PIA
Sbjct  724  LCWDIRPDAVALVNAFDIPESCLSAPIA  751



>ref|WP_035680554.1| acyl-CoA oxidase [Flavobacterium reichenbachii]
 gb|KFF04375.1| acyl-CoA oxidase [Flavobacterium reichenbachii]
Length=753

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 108/209 (52%), Gaps = 16/209 (8%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ  +K  L+E+   ++       LG+ +         ++E  P+   K   
Sbjct  547  FEGDNTVLMQLTAKNRLSEF---RKSFGEMGSLGIINYVYENAKTAISEKNPIATRKTDE  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASG-EGKENAFLLSYQLAEDLGRAFADR  374
            + L   +F    F  RE+ +L   A  + +   SG E  +   ++ +Q+  D+ +A+ +R
Sbjct  604  EHLLDGEFHLQAFVHREKTILASAARRIKKLVDSGLEPYDAVNVVQHQMI-DVSQAYLER  662

Query  373  TIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIA  197
             +   F  A  ++    +KNIL  +  +YA++ ++++ A +L  G +      A+RK + 
Sbjct  663  VVLEQFQKAIETIEDQQVKNILQKLNQLYALSQIEKNKAWYLEDGYMEAVKTKAIRKMVN  722

Query  196  TLCSELRPHALALVTSFGIPDTFL-SPIA  113
             LC ++RP A+ALV +F IP++ L +PIA
Sbjct  723  QLCWDIRPDAVALVNAFDIPESCLAAPIA  751



>ref|WP_007810516.1| acyl-CoA oxidase [Flavobacterium sp. CF136]
 gb|EJL60869.1| acyl-CoA dehydrogenase [Flavobacterium sp. CF136]
Length=753

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 103/211 (49%), Gaps = 20/211 (9%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLG-LEHMN-----------EPCPVIPSK  560
            FEGDN VLMQ V+K  L+E+       KAF  +G L  +N           E  P+I  K
Sbjct  547  FEGDNTVLMQLVAKNRLSEF------RKAFGEMGSLGIINYVYENAKTAIAEKNPIITRK  600

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFA  380
               + L   QF    F  RE+ +L   A  + +    G    +AF +      D+ +A+ 
Sbjct  601  TDGEHLLDNQFHLQAFHHREKTILASAARRIKKLIDEGLEAYDAFNVVQHQMIDVAQAYL  660

Query  379  DRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKE  203
            +R +   F  A  SV     K IL  +  +YA++ ++++   +L  G +      A+RK 
Sbjct  661  ERVVLEQFQEAVKSVEDEKSKEILIKLNQLYALSQIEKNKGWYLEDGYMEAVKTKAIRKM  720

Query  202  IATLCSELRPHALALVTSFGIPDTFL-SPIA  113
            +  LC ++RP A++LV +F IP++ L +PIA
Sbjct  721  VNQLCWDIRPDAVSLVNAFDIPESCLAAPIA  751



>ref|WP_035657136.1| acyl-CoA oxidase [Flavobacterium sp. EM1321]
 gb|KDN56812.1| acyl-CoA oxidase [Flavobacterium sp. EM1321]
Length=755

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 101/210 (48%), Gaps = 20/210 (10%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLG-LEHMN-----------EPCPVIPSK  560
            FEGDN VLMQ V+K  LAE+       KAF  +G L  +N           E  PV+  K
Sbjct  547  FEGDNTVLMQLVAKNRLAEF------RKAFGEMGSLGIINYVYENAKSAIAEKNPVVIRK  600

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFA  380
               + L   QF    F  RE+ +L   A  + +   SG    +AF +      D+  A+ 
Sbjct  601  TDDEHLLDSQFHLQAFQHREKTILASAAKRIKKLVDSGLDAYDAFNVVQHQMIDVAEAYL  660

Query  379  DRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILD-EDAAFLRYGCLTTDNAAAVRKE  203
            D  +   F  A  +V     K IL+ +  ++A++ ++   A +L  G +      A+RK 
Sbjct  661  DSVVLEQFQIAIEAVKDEKSKAILTKLNQLFALSQIEINKAWYLEDGYMEAVKTKAIRKM  720

Query  202  IATLCSELRPHALALVTSFGIPDTFL-SPI  116
            +  LC ++RP A+ALV +F IPD+ L +PI
Sbjct  721  VNQLCWDIRPDAVALVDAFAIPDSCLAAPI  750



>ref|WP_042212501.1| acyl-CoA oxidase [Lysinimicrobium mangrovi]
Length=613

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 94/214 (44%), Gaps = 23/214 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY--------------VTCKRKG-----KAFKGLGLEHMNEP  581
            FEGDN VLMQ V+KALL +Y               T +  G     +   GL LE +   
Sbjct  397  FEGDNTVLMQLVAKALLTDYKQAWSALDRTGVVQATTRAVGGMVMERTSAGLMLERLAAT  456

Query  580  CPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAE  401
                P +    TL    +   +F  RERH L   A  +     SG     AF       +
Sbjct  457  ARRRPDET---TLVDRGWHALMFEERERHSLESLARRMRSAAKSGGDGFEAFNRLGPHVQ  513

Query  400  DLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDN  224
             + RA  +R     FV    +      + +L    S+YA++ + ED A FL +  +TT  
Sbjct  514  FVARAHMERVTLAAFVALIDACEDPEARAVLETTCSLYALSSIAEDRAWFLEHSRMTTAR  573

Query  223  AAAVRKEIATLCSELRPHALALVTSFGIPDTFLS  122
            +  +  +I  LC ELRPHALALV   GIP+ +L 
Sbjct  574  SKVIGDQIDALCRELRPHALALVEGLGIPEAWLG  607



>ref|WP_006239330.1| acyl-CoA oxidase [Saccharomonospora xinjiangensis]
 gb|EID55185.1| acyl-CoA dehydrogenase [Saccharomonospora xinjiangensis XJ-54]
Length=643

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 99/221 (45%), Gaps = 27/221 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K LL  Y           T +   + F G  +E       +      
Sbjct  428  FEGDNTVLLQLVAKGLLTNYRLQFQDLSPLATARFVAEQFVGAVIERTAARKVVERIVDA  487

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P +   D +    +Q  +F  RE H+L+  A  +        G++NAF + +  A D  
Sbjct  488  SPVRDDDDAVFDRAWQCKLFTDRESHVLDGLARRLR-----AAGRDNAFEV-FNAAGDHV  541

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTD  227
                R   DR +  +FV A    +    + +L+ V  ++ ++ ++ D   FL +G LT+ 
Sbjct  542  LRAARVHVDRLVLDSFVAAVERCDDDEARALLNKVCDLHVLSTIEADRGWFLEHGRLTSG  601

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIAFNW  104
             A AV   +  LC ELRPHA  LV +F +P+  +     +W
Sbjct  602  RAKAVVAGVNRLCGELRPHARTLVDAFAVPEALVQVPMLDW  642



>ref|WP_019809905.1| acyl-CoA oxidase [Saccharomonospora halophila]
Length=631

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/214 (29%), Positives = 101/214 (47%), Gaps = 27/214 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K+LL  Y           T +   + F G  +E       +      
Sbjct  417  FEGDNTVLLQLVAKSLLTNYKDQFEDLSPLATARFVAEQFMGTVIERTAARQVVERLVEA  476

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P++   + +    +Q  +F  RE H+L+     +        G+++AF  ++  A+D  
Sbjct  477  TPARDDDEVVFDRGWQCKLFEDREEHILDGLVRRLRS-----AGRDDAFA-AFNDAQDHV  530

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
                RA  DR +   FV A    +  + +++L  V  +Y ++ ++ D A FL +G L+  
Sbjct  531  LHAARAHVDRLVLEAFVAAVDRCSDDTARDLLGRVCDLYVLSTVEADRAWFLEHGRLSGS  590

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL  125
             A AV   +  LC+ELRPHA  LV +F +P+  L
Sbjct  591  RAKAVSAGVNRLCAELRPHARTLVDAFAVPEDLL  624



>ref|WP_026810093.1| acyl-CoA oxidase [Arenibacter latericius]
Length=754

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 99/216 (46%), Gaps = 9/216 (4%)
 Frame = -2

Query  760  LEN*KPDRPSKK*I*CTLYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------  599
            LEN  PD  +   I  T  FEGDN VL+Q  +K +L+E+ +    G     L L      
Sbjct  532  LENRIPDLKNDVDIFTT--FEGDNTVLLQLAAKGILSEFNSEFNGGGFTAVLKLISTQIK  589

Query  598  EHMNEPCPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLL  419
            + +    P   +K+  D L + +F    F  R R L    A  +  +   G     AFL 
Sbjct  590  DKIVTINPAYSNKVDKDHLYNPKFHLHAFKYRTRRLTYTLAMRIKDYIEKGVPTYQAFLK  649

Query  418  SYQLAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYG  242
                   LGRA++    YHTFV    ++     + +   +  ++A+  + E+A+ FL  G
Sbjct  650  VQTHLLALGRAYSCELAYHTFVKFTENIEDQKKQALFRKLGVLFALHEIRENASWFLEQG  709

Query  241  CLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPD  134
             +    + A+R+ +  L SELRPH   LV  FGIP+
Sbjct  710  YIGGTKSKAIRQRVERLSSELRPHIEVLVDGFGIPE  745



>ref|WP_015780052.1| acyl-CoA oxidase [Kytococcus sedentarius]
 gb|ACV07116.1| acyl-CoA dehydrogenase [Kytococcus sedentarius DSM 20547]
Length=663

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 98/215 (46%), Gaps = 24/215 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTC----------KRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K LL  Y             +     F G+ +E       +N     
Sbjct  436  FEGDNTVLLQLVAKGLLTNYSKAIGSLNMTGMLRFGATQFSGVVIERTAAKGFVNRLVEA  495

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQ----LA  404
               + + D +    +Q + F  RE+HLL   A  + +     E ++ A     Q    LA
Sbjct  496  ARRRDTEDVVMDRAWQVECFEFREKHLLETAAQRMRRADRGTEAEQFAAFNDVQDHLLLA  555

Query  403  EDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTD  227
                RA  DR +   F          +L  +L  V  +YA+++++E+AA FL +  +   
Sbjct  556  ---ARAHIDRVVLEAFAQQVEECEDPALTELLDQVCDLYALSVIEENAAWFLEHEHMRPA  612

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFLS  122
             + +V   I  LC++LRPHA+ LV +F IPD +L+
Sbjct  613  KSKSVTSTINALCADLRPHAVTLVDAFAIPDAWLA  647



>ref|WP_033293761.1| acyl-CoA oxidase [Amycolatopsis jejuensis]
Length=613

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 95/201 (47%), Gaps = 10/201 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY------VTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTL  542
            FEGDN VL+Q V+K LL +Y      ++     +      ++ + E        L    L
Sbjct  410  FEGDNTVLLQLVAKGLLTQYKEHFEDLSPLATARFVAEQVVDAVRERTAAFIEPLMESGL  469

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
               ++Q  +F  RE H+L+  A  + +      G  NA      LA   GR   +R +  
Sbjct  470  FDREWQQRLFEDREEHVLDGVANRLRRAAEDPFGTFNAAQDHVLLA---GRVHVERVVLS  526

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRKEIATLCS  185
             F  A      G  + +L+ +  +YA++ ++ D A FL +G ++   A AV   + +LC+
Sbjct  527  AFARAVDDCPDGDAQVLLARLCDLYALSTIEADRAWFLEHGRISAGRAKAVTAAVNSLCA  586

Query  184  ELRPHALALVTSFGIPDTFLS  122
             LRPHA  LV  FGIP+ FL+
Sbjct  587  ALRPHARTLVDGFGIPEQFLA  607



>ref|WP_027064968.1| acyl-CoA oxidase [Maribacter sp. Hel_I_7]
Length=754

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 99/205 (48%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------EHMNEPCPVIPSKLSSDTL  542
            FEGDNNVL+Q  +K +L+++            L L      + ++   P+  +K   D L
Sbjct  549  FEGDNNVLLQLAAKGVLSDFKAEFNSAGFSTVLKLLSSQLSDKLSTINPLYTNKTDKDHL  608

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
             + +F       R R L    A  +  +   G     AFL        LG+A++    Y 
Sbjct  609  YNPKFHVHALEHRTRRLTYTIAMRIRGYIKKGIPSYQAFLKVQTHLMTLGKAYSTELAYK  668

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLCS  185
            +F+    ++     K +   + ++YA+  + +DA+ +L  G ++ + + A+R+ +  LC+
Sbjct  669  SFIEHNSTIADLEYKALFEKLGTLYALHEIRKDASWYLEQGYISGNKSKAIRQRVERLCT  728

Query  184  ELRPHALALVTSFGIPDTFLS-PIA  113
            ELRPH  +LV  FGIP+  ++ PIA
Sbjct  729  ELRPHLDSLVDGFGIPEHLMTAPIA  753



>ref|WP_026155732.1| acyl-CoA oxidase [Dehalobacter sp. FTH1]
Length=631

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 105/211 (50%), Gaps = 21/211 (10%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTC----KRKG------KAFKGLGLEHMNEPCPV------  572
            FEGDN VL+QQV+KALL +Y        R G      + F    +E  +    V      
Sbjct  419  FEGDNTVLLQQVAKALLGDYSKLWGELDRAGMVQAAARVFGDTVIERTSASVLVERLVST  478

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLG  392
            +  +  S TL    +Q   F  RERH L+  A  + +   +G+  E+   L+  +   + 
Sbjct  479  VSRQPESTTLTDRAWQAWAFTERERHSLDSLARRMRR---AGKRFESVNRLTPHMVF-VA  534

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            RA  +R     F+ A  + +   ++ +L  + S+YA++ ++ED   F  +  ++   + A
Sbjct  535  RAHLERIALEAFIAAIEASDDPEVRPVLERLCSLYALSSINEDRGWFSEHSRISAGRSKA  594

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFLS  122
            + ++I  LC+ELRP ALALV  FGIP ++L 
Sbjct  595  LGEQIDRLCAELRPDALALVEGFGIPASWLG  625



>ref|WP_002612916.1| acyl-CoA dehydrogenase [Stigmatella aurantiaca]
 gb|EAU67561.1| acyl-coenzyme A oxidase, peroxisomal [Stigmatella aurantiaca 
DW4/3-1]
 gb|ADO74925.1| acyl-CoA dehydrogenase [Stigmatella aurantiaca DW4/3-1]
Length=777

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 92/207 (44%), Gaps = 8/207 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------EHMNEPCPVIPSKLSSDTL  542
            FEGDN VLMQ V+K++L  Y       + F  + L        + +  P    +  S+ L
Sbjct  567  FEGDNTVLMQLVAKSVLTGYRQQFEDERVFTVMKLIVERASAALTDRNPFQARRTGSEHL  626

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
                FQ      RE  L+   A  + +   SG     AF         L  A  +R +  
Sbjct  627  RDGDFQLGALRFREADLVASAARRLRKRLGSGMDSFQAFNECQDHLLALAHAHVERVVLE  686

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMA-ILDEDAAFLRYGCLTTDNAAAVRKEIATLCS  185
             F+     V     + +LS +  +Y +  ++D    F+    L    A A+RKE+A LC+
Sbjct  687  QFIAGIAWVEDLPTRTVLSKLCDLYGLGCLMDAGGWFVENDLLEGAKAKAIRKEVARLCA  746

Query  184  ELRPHALALVTSFGIPDTFL-SPIAFN  107
            ELRP A+AL  +FGIPDT L +PI   
Sbjct  747  ELRPDAVALTHAFGIPDTCLAAPIGLG  773



>ref|WP_012787563.1| acyl-CoA oxidase [Catenulispora acidiphila]
 gb|ACU72270.1| acyl-CoA oxidase domain protein [Catenulispora acidiphila DSM 
44928]
Length=628

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 98/211 (46%), Gaps = 24/211 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKR--------KGKAFKGLGLEHMNEPCPVIPSKLSS-  551
            FEGDN VL+Q V+K LL EY    +        +  A + LG          +  +L+  
Sbjct  420  FEGDNTVLLQLVAKGLLTEYKDAFQNLSPLATVRFAAERVLGAVAERTSARKVVDRLTDG  479

Query  550  ---DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LG  392
               + L    +Q  +F  RE+H+L   A  + +      G  NA       A+D     G
Sbjct  480  DDREALFDRDWQLKLFEDREQHVLGGVADRLRKAAQDPFGVFNA-------AQDHVLRAG  532

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            R   DR +   FV A         K +L  V  +YA+A ++ D A FL +G L+T  + A
Sbjct  533  RVHVDRLVLEAFVRAIARCTDPDAKALLERVCDLYALANIEADRAWFLEHGRLSTGRSKA  592

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFLS  122
            V   + TLC ELRPHA  LV +F IP+ +L+
Sbjct  593  VIAAVNTLCGELRPHARTLVDAFAIPEQYLA  623



>ref|WP_012025377.1| acyl-CoA oxidase [Flavobacterium johnsoniae]
 gb|ABQ06408.1| predicted acyl-CoA oxidase domain protein [Flavobacterium johnsoniae 
UW101]
Length=752

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 104/208 (50%), Gaps = 14/208 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+   ++       LG+ +         + E  P+   +   
Sbjct  547  FEGDNTVLMQLVAKNRLSEF---RKSFGEMGSLGIINYVYENAKTAITEKNPIATRRTDD  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L   +F    F  RE+ +L   A  + +    G    +AF +      D+ +A+ +R 
Sbjct  604  EHLLDKEFHLQAFVHREKTILASAARRIKKLVDGGLEAYDAFNVVQHQMIDVAQAYLERI  663

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  ++   + K IL+ +  +YA++ ++++ A +L  G +      AVRK +  
Sbjct  664  VLEQFQEAVKTIEDENSKQILTKLYQLYALSQIEKNKAWYLEDGYMEAVKTKAVRKIVNQ  723

Query  193  LCSELRPHALALVTSFGIPDTFL-SPIA  113
            LC ++RP A+ALV +F IP++ L +PIA
Sbjct  724  LCWDIRPDAVALVNAFDIPESCLAAPIA  751



>dbj|GAM25056.1| hypothetical protein SAMD00019534_082310 [Acytostelium subglobosum 
LB1]
Length=646

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 96/206 (47%), Gaps = 10/206 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDN ++ QQV+K +L E    +RK            N P     SK  S  L S  F 
Sbjct  451  FEGDNVLMYQQVAKYILTE---SRRKAPP-------EYNVPSDAYRSKTDSKHLRSQDFI  500

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
                  R    +   AA++ +   +G+   +A+     +  +LG  F +R +   F++  
Sbjct  501  MAAMTARVHQYIPAVAAKLMEAVGNGKPVLDAWNDCGNIILNLGIVFTERYLLERFIDGV  560

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
                    ++ +SL+ S+  + I+++D  F+++  ++ D + A+  EIA LC E+ P A+
Sbjct  561  NKCPDAKQRHAMSLLVSLMGLVIIEKDTWFVKHQFISVDQSDAISNEIADLCREVVPLAV  620

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAW  86
             L  +FG      +PI  +WI  N +
Sbjct  621  DLCEAFGFNQLTTAPIGRDWIQHNKY  646



>ref|WP_043394213.1| acyl-CoA oxidase [Cystobacter violaceus]
 gb|KFA92834.1| acyl-CoA oxidase [Cystobacter violaceus Cb vi76]
Length=779

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 93/207 (45%), Gaps = 8/207 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------EHMNEPCPVIPSKLSSDTL  542
            FEGDN VL+Q V+K+LL  Y       + F  + L        + +  P    +  S+ L
Sbjct  569  FEGDNTVLLQLVAKSLLTGYRQQFEDDRVFTVMRLIVDRAAGALGDRNPFSVRRTGSEHL  628

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
                FQ      RE  LL   A  + +  ++G     AF         L  A  +R +  
Sbjct  629  RDGDFQLRALRFRESDLLASAARRLRERLSAGVDSFEAFNQCQDHLLALANAHVERVVLE  688

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAIL-DEDAAFLRYGCLTTDNAAAVRKEIATLCS  185
             F+     V   +LK +L  +  +Y +  L D    FL    +    A A+RKE+  LC+
Sbjct  689  QFLLGVAEVKDPALKTVLGRLCDVYGLGCLQDASGWFLENDHIEGAKAKAIRKEVTRLCA  748

Query  184  ELRPHALALVTSFGIPDTFL-SPIAFN  107
            ELRP A+AL  +FGIPD+ L +PIA  
Sbjct  749  ELRPDAVALTKAFGIPDSCLAAPIALG  775



>ref|WP_034305416.1| acyl-CoA oxidase [Amycolatopsis lurida]
 gb|KFU82670.1| acyl-CoA oxidase [Amycolatopsis lurida NRRL 2430]
 gb|AJK52456.1| acyl-CoA oxidase [Amycolatopsis lurida NRRL 2430]
Length=628

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 95/207 (46%), Gaps = 16/207 (8%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPV--IPSK  560
            FEGDN VL+Q V+K LL  Y           T +   + F    +E  +    V  +   
Sbjct  419  FEGDNTVLLQLVAKGLLTSYKDHFEDLSPLATARFVAEQFVEAVIERTSARKVVERLTEA  478

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFA  380
               D L S ++   +F  RE H+L   A  + +   +G      F  +       GRA  
Sbjct  479  DDGDVLYSREWHLKLFEDREEHVLGGVAQRLRK---AGSDPFGVFNDAQDHVLRAGRAHV  535

Query  379  DRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRKE  203
            DR +   FV+A         + +L  V  +YA+A ++ D   FL +G LT+  + AV   
Sbjct  536  DRVVLEAFVDAIERCADADARELLERVCDLYALANIEADRGWFLEHGRLTSGRSKAVTAA  595

Query  202  IATLCSELRPHALALVTSFGIPDTFLS  122
            +  LC++LRPHA  LV +F IP+ +L+
Sbjct  596  VNALCADLRPHARTLVDAFAIPEQYLA  622



>ref|WP_028496686.1| MULTISPECIES: acyl-CoA dehydrogenase [Microbacterium]
Length=701

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 103/217 (47%), Gaps = 21/217 (10%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALL---------------AEYVTCKRKGKAFKGLGLEHMNEPCPVI  569
            FEGDNNVL+Q V K LL               A+Y   +  GK F G GL  + +     
Sbjct  452  FEGDNNVLLQLVGKRLLSDYAKQFRGADAAKLAKYAVGQTAGKVFHGAGLRQLGQAVADF  511

Query  568  PSKLSSDTLG-SIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAE--D  398
             S   S  LG   + Q+++   R   +++  A  + +  A     E A + +   +E  +
Sbjct  512  GSPARSVELGLRAEQQHELLAGRVEQMISDIAGRM-RPAAKASPVEAAAIFNANQSELIE  570

Query  397  LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAF-LRYGCLTTDNA  221
              RA  +   +  F +A  +V+    K +L+ +R ++ + ++++  A+ L  G L+T  A
Sbjct  571  AARAHGELLQWEAFSDAVNTVDDEGTKQVLTWLRDLFGLTLIEKHLAWHLINGRLSTQRA  630

Query  220  AAVRKEIATLCSELRPHALALVTSFGI-PDTFLSPIA  113
            A V + I  LC  LRPHA  LV +FG  P+   +PIA
Sbjct  631  ATVTRYIDRLCLRLRPHAQDLVDAFGFEPEHVRAPIA  667



>ref|WP_031456312.1| acyl-CoA oxidase [Flavobacterium chungangense]
Length=752

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 98/205 (48%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMN------EPCPVIPSKLSSDTL  542
            FEGDN VLMQ V+K  LAE+     +  +F  +   + N      E  P+I  K   + L
Sbjct  547  FEGDNTVLMQLVAKNRLAEFRKSFGEMGSFGIINYVYENARTAIAEKNPIITRKTDDEHL  606

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
               QF    F  RE+ +L   A  + +    G    +AF +      D+  A+ +R +  
Sbjct  607  LDNQFHLQAFVHREKTILASAARRIKKLIDEGLEAYDAFNVVQHQMIDVAEAYLERVVLE  666

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLCS  185
             F      V     K IL  +  +YA++ ++++   +L  G +      A+RK +  LC 
Sbjct  667  QFQITIEKVEDVKTKEILLKLNQLYALSQIEKNKGWYLEDGYMEAVKTKAIRKMVNQLCW  726

Query  184  ELRPHALALVTSFGIPDTFL-SPIA  113
            ++RP A++LV +F IP++ L +PIA
Sbjct  727  DIRPDAVSLVNAFDIPESCLAAPIA  751



>ref|WP_030531740.1| acyl-CoA oxidase [Prauserella rugosa]
Length=628

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 101/218 (46%), Gaps = 28/218 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---VTCKRKGKAFKGLGLEHMN------EPCPVI------  569
            FEGDN VL+Q V+K LL  Y   V   R  +  + L  + ++          VI      
Sbjct  414  FEGDNTVLLQLVAKGLLTSYKQEVQDLRPIETVRFLAEQVVDVVIERTSARKVIERIMDA  473

Query  568  -PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P +   D+L    +Q  +F  RE H+L+     + +      G++N F + +  A+D  
Sbjct  474  SPRRDDEDSLYDRAWQISMFEDREEHVLDSLVKRLRR-----AGRDNGFEV-FNSAQDHV  527

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
               GR   DR +   FV A         K +L  V  +YA+A ++ D A FL +G  T  
Sbjct  528  LRAGRVHVDRIVLEAFVGAIDRCTDPDTKALLERVCDLYALANIEADRAWFLEHGRFTAQ  587

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPI  116
               AV   +  LC+ELRP A  LV +F +P+ FL +PI
Sbjct  588  RGKAVVAAVNELCAELRPRARELVDAFAVPERFLRAPI  625



>ref|WP_026729518.1| acyl-CoA oxidase [Flavobacterium denitrificans]
Length=753

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 106/208 (51%), Gaps = 14/208 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+   ++       LG+ +         ++E  P+   +   
Sbjct  547  FEGDNTVLMQLVAKNRLSEF---RKSFGEMGSLGIINYVYENAKTALSEKNPIATRRTED  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L   +F +  F  RE+ +L   A  + +    G    +AF +      D+ +A+ +R 
Sbjct  604  EHLLDSEFHHQAFIHREKTILASAARRIKKLVDGGLEAYDAFNVVQHQMIDVAQAYLERI  663

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  ++   + K IL+ +  ++A++ L+++ A +L  G +      A+RK +  
Sbjct  664  VLEQFQEALKTIKDENSKVILTKLYQLFALSQLEKNKAWYLEDGYMEAVKTKAIRKIVNQ  723

Query  193  LCSELRPHALALVTSFGIPDTFL-SPIA  113
            LC ++RP A+ALV +F IP++ L +PIA
Sbjct  724  LCWDIRPDAVALVNAFDIPESCLAAPIA  751



>ref|WP_025104659.1| acyl-CoA dehydrogenase [Microbacterium paraoxydans]
Length=687

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 102/225 (45%), Gaps = 38/225 (17%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALL---------------AEYVTCKRKGKAFKGLGLEHMNEPCPVI  569
            FEGDNNVL+Q V K LL               A Y      GK F G GL  + +     
Sbjct  437  FEGDNNVLLQLVGKRLLTDYAKQFQGKDAAALARYAVGMTAGKVFHGAGLRQLGQAVTDF  496

Query  568  PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQH--------QASGEGKE-NAFLLS  416
                 S   G          LRE    +L A  V Q         +A+G+ K   A L +
Sbjct  497  GQVARSVERG----------LREEQQHDLLAGRVQQMVADIATRLRAAGKDKVLGARLFN  546

Query  415  YQLAE--DLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAF-LRY  245
               AE  +  RA  +   +  F +A  +++    K +++ +R ++ + ++++  A+ L +
Sbjct  547  ENQAELIEAARAHGELLQWEAFTDAVHAMDDAETKKVMTWLRDLFGLQLIEKHLAWHLIH  606

Query  244  GCLTTDNAAAVRKEIATLCSELRPHALALVTSFGI-PDTFLSPIA  113
            G L+T  AAAV   I  LC+ LRP+AL LV +FG  P+   +PIA
Sbjct  607  GRLSTQRAAAVSSYIDRLCARLRPYALDLVDAFGYEPEHVRAPIA  651



>ref|WP_022925252.1| acyl-CoA oxidase [Serinicoccus marinus]
Length=678

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 102/216 (47%), Gaps = 28/216 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYV----------TCKRKGKAFKGLGLEHMNEPCPVI-----  569
            FEGDN VL+Q V+K LL+ Y             +   +AF G  +E      P++     
Sbjct  453  FEGDNTVLLQLVAKGLLSGYKEMWGDLDMRGMVQFAARAFGGQFVE-ATAARPLVERLRT  511

Query  568  --PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED-  398
                K   +TL    +Q  +F  RERH+L   A  + +H    +  E     ++  A+D 
Sbjct  512  AAARKGEDETLLDRGWQLAMFADRERHVLETLATRLRRHADDKDSFE-----AFNSAQDH  566

Query  397  ---LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLR-YGCLTT  230
                 R   DR +   FV    +     ++ +L  + +++A++ +D D+ + + +  ++ 
Sbjct  567  VLLAARTHMDRVVLEAFVAGIEACEDEQVREVLERLCTLHALSSIDADSGWFQAHNRMSA  626

Query  229  DNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLS  122
              A AV  +I  LC+ELRPHAL LV   GIP+ +L+
Sbjct  627  GRAKAVVAQINELCAELRPHALELVEGLGIPEAWLN  662



>ref|WP_028709678.1| acyl-CoA oxidase [Propionicicella superfundia]
Length=653

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 101/213 (47%), Gaps = 22/213 (10%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTC----------KRKGKAFKGLGLEHM-NEP----CPVI  569
            FEGDN VL+Q V+K LL +Y             +   K+  G  ++   N P        
Sbjct  434  FEGDNTVLLQLVAKQLLGDYKQAWVGLDPVKLVQASAKSLGGAVVDRTANLPGVDRLVAA  493

Query  568  PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDL--  395
                 +DT+    +Q  +F  RERH++   AA +     SGE    AF  + +  + +  
Sbjct  494  AQGTGADTVEHRGWQVSMFEERERHVVGRLAARLRSAARSGEA---AFAATNKAQDHMLY  550

Query  394  -GRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILD-EDAAFLRYGCLTTDNA  221
              RA  D+ +  +FV    +    ++K++L  +  +YA+++L+ E A +L  G ++   A
Sbjct  551  AARAHMDKVVLESFVAGIEACPDPAVKDVLGRLCDLYALSVLEAERAWYLERGRISPQRA  610

Query  220  AAVRKEIATLCSELRPHALALVTSFGIPDTFLS  122
             A+ + +  LC ELRP A  LVT  GIP  +L 
Sbjct  611  KALTQAVNRLCGELRPLADDLVTGLGIPTAWLQ  643



>ref|WP_007028884.1| acyl-CoA oxidase domain-containing protein [Amycolatopsis decaplanina]
 gb|EME63893.1| acyl-CoA oxidase domain-containing protein [Amycolatopsis decaplanina 
DSM 44594]
Length=628

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 95/207 (46%), Gaps = 16/207 (8%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPV--IPSK  560
            FEGDN VL+Q V+K LL  Y           T +   +      +E  +    V  +   
Sbjct  419  FEGDNTVLLQLVAKGLLTSYKDHFEDLSPLATARFVAEQLVEAVIERTSARKVVERLTEA  478

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFA  380
              SD L S ++   +F  RE H+L   A  + +   +G      F  +       GRA  
Sbjct  479  DDSDVLYSREWHLKLFEDREEHVLGGVAQRLRK---AGSDPFGVFNDAQDHVLRAGRAHV  535

Query  379  DRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRKE  203
            DR +   FV+A         + +L  V  +YA+A ++ D   FL +G LT+  + AV   
Sbjct  536  DRVVLEAFVDAIERCADAEARELLERVCDLYALANIEADRGWFLEHGRLTSGRSKAVTAA  595

Query  202  IATLCSELRPHALALVTSFGIPDTFLS  122
            +  LC++LRPHA  LV +F IP+ +L+
Sbjct  596  VNALCADLRPHARTLVDAFAIPEQYLA  622



>gb|EJG02802.1| acyl-CoA oxidase [Flavobacterium sp. F52]
Length=765

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 103/209 (49%), Gaps = 14/209 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  LAE+   ++       LG+ +         + E  P+   +   
Sbjct  560  FEGDNTVLMQLVAKNRLAEF---RKSFGEMGSLGIINYVYENAKTAIAEKNPIATRRTED  616

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L   +F    F  RE+ +L   A  + +    G    +AF +      D+ +A+ +R 
Sbjct  617  EHLLDGEFHLQAFVHREKTILASAARRIKKLIDGGLEPYDAFNVVQHQMIDVAQAYLERI  676

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  +V     K IL+ +  +YA++ ++++ A +L  G +      AVRK +  
Sbjct  677  VLEQFQIAIKAVEDEPSKAILTKLNQLYALSTIEKNKAWYLEDGYMEAVKTKAVRKMVNQ  736

Query  193  LCSELRPHALALVTSFGIPDTFL-SPIAF  110
            LC ++RP A+ALV +F IP++ L +PIA 
Sbjct  737  LCWDIRPDAVALVNAFDIPESCLAAPIAI  765



>ref|WP_014773637.1| acyl-CoA oxidase [Belliella baltica]
 gb|AFL85697.1| acyl-CoA dehydrogenase [Belliella baltica DSM 15883]
Length=763

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/214 (29%), Positives = 98/214 (46%), Gaps = 26/214 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAE---------------YVTCKRKGKAFKGLGLEHMNEPCPVI  569
            FEGDN VLMQ V+K  L E               Y+T + K           + E  P+I
Sbjct  556  FEGDNIVLMQLVAKNRLTEFRQEFGDMNMFTIFNYITNQAKTS---------ITEKNPLI  606

Query  568  PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGR  389
                    L  + F    F  RER +L+  A  + +H   G    +AF +      ++G+
Sbjct  607  IRSTEQTHLLDMDFHLSAFKYRERAILSSAAQRIKRHIDDGMDSFDAFNVVQHHLVNVGQ  666

Query  388  AFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAV  212
            A+ +R +   F       N G  K+ L  +  +YA+  ++++   +L  G +      A+
Sbjct  667  AYIERVVLEEFQKEVMDTNDGDCKDALLQLCQLYALNTIEKNRGWYLEQGYMEGVKTKAI  726

Query  211  RKEIATLCSELRPHALALVTSFGIPDTFL-SPIA  113
            RKE+  LC E+R +ALAL  +F IP++ + +PIA
Sbjct  727  RKEVNQLCWEVRKNALALTDAFDIPESCIAAPIA  760



>ref|WP_026716117.1| acyl-CoA oxidase [Flavobacterium gelidilacus]
Length=755

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 105/210 (50%), Gaps = 16/210 (8%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+   ++       +G+ +         + E  P+       
Sbjct  549  FEGDNTVLMQLVAKNRLSEF---RKSFGEMGSMGIINYVYENAKTALAEKNPITTRNTDE  605

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAF-LLSYQLAEDLGRAFADR  374
            + L    F    F  RE+ ++   A  + +    G    +AF ++ +Q+ E + +A+ +R
Sbjct  606  EHLLDNDFHLKAFQYREKSIVASAANRIKKLIDKGMEPYDAFNVVQHQMLE-VAQAYLER  664

Query  373  TIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIA  197
                 F  A  ++   ++K  L+ V  +YA+  ++++ A +L  G +      AVRK + 
Sbjct  665  VTLEQFQQAIETIEDEAVKTALTKVAQLYALHQIEKNKAWYLEQGYMEAVKTKAVRKMVN  724

Query  196  TLCSELRPHALALVTSFGIPDTFL-SPIAF  110
             LC ++RP A+ALV +F IPD+ L +PIAF
Sbjct  725  QLCWDIRPDAIALVDAFAIPDSCLAAPIAF  754



>ref|WP_033229275.1| acyl-CoA oxidase, partial [Serinicoccus profundi]
Length=630

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 99/212 (47%), Gaps = 20/212 (9%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYV----------TCKRKGKAFKGLGLEHMNEPCPVI-----  569
            FEGDN VL+Q V+K LL+ Y             +   +AF G  +E      P++     
Sbjct  418  FEGDNTVLLQLVAKGLLSGYKEMWGDLDMRGMVQFAARAFGGQFVE-ATAARPMVERLRT  476

Query  568  --PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDL  395
                K   +TL    +   +F  RERH+L   A  + + +A  +    AF  +       
Sbjct  477  AAARKGEGETLLDRGWHLAMFADRERHVLETLATRL-RRRADDQDSFEAFNSAQDHVLLA  535

Query  394  GRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAFLR-YGCLTTDNAA  218
             R   DR +   FV         + + +L  + ++YA++ +D D+ + + +  ++   A 
Sbjct  536  ARTHMDRVVLEAFVAGIEGCEDEAARGVLERLCTLYALSSIDADSGWFQAHNRMSAGRAK  595

Query  217  AVRKEIATLCSELRPHALALVTSFGIPDTFLS  122
            AV  +I +LC ELRPHAL LV   GIP+T+L+
Sbjct  596  AVVTQINSLCGELRPHALELVEGMGIPETWLN  627



>ref|WP_035690755.1| acyl-CoA oxidase [Flavobacterium sp. F52]
Length=752

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 103/209 (49%), Gaps = 14/209 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  LAE+   ++       LG+ +         + E  P+   +   
Sbjct  547  FEGDNTVLMQLVAKNRLAEF---RKSFGEMGSLGIINYVYENAKTAIAEKNPIATRRTED  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L   +F    F  RE+ +L   A  + +    G    +AF +      D+ +A+ +R 
Sbjct  604  EHLLDGEFHLQAFVHREKTILASAARRIKKLIDGGLEPYDAFNVVQHQMIDVAQAYLERI  663

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  +V     K IL+ +  +YA++ ++++ A +L  G +      AVRK +  
Sbjct  664  VLEQFQIAIKAVEDEPSKAILTKLNQLYALSTIEKNKAWYLEDGYMEAVKTKAVRKMVNQ  723

Query  193  LCSELRPHALALVTSFGIPDTFL-SPIAF  110
            LC ++RP A+ALV +F IP++ L +PIA 
Sbjct  724  LCWDIRPDAVALVNAFDIPESCLAAPIAI  752



>ref|WP_026453893.1| acyl-CoA oxidase [Actinopolyspora iraqiensis]
Length=631

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/214 (28%), Positives = 101/214 (47%), Gaps = 27/214 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K+LL  Y           T +   + F G  +E       +      
Sbjct  417  FEGDNTVLLQLVAKSLLTNYKDQFEDLSPLATARFVAEQFMGTVIERTAARQVVERLVEA  476

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P++   + +    +Q  +F  RE H+++     +        G+++AF  ++  A+D  
Sbjct  477  TPARDDDEVVFDRGWQCKLFEDREEHIVDGLVRRLRS-----AGRDDAFA-AFNDAQDHV  530

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
                RA  DR +   FV A    +  + +++L  V  +Y ++ ++ D A FL +G L+  
Sbjct  531  LHAARAHVDRLVLEAFVAAVDRCSDDAARDLLGRVCDLYVLSTVEADRAWFLEHGRLSGS  590

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL  125
             A AV   +  LC++LRPHA  LV +F +P+  L
Sbjct  591  RAKAVSAGVNRLCADLRPHARTLVDAFAVPEELL  624



>ref|WP_007023318.1| acyl-CoA oxidase [Saccharomonospora paurometabolica]
Length=631

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/214 (28%), Positives = 101/214 (47%), Gaps = 27/214 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K+LL  Y           T +   + F G  +E       +      
Sbjct  417  FEGDNTVLLQLVAKSLLTNYRDQFEDLSPLATARFVAEQFMGTVIERTAARQAVERLVEA  476

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P++   + +    +Q  +F  RE H+++     +        G+++AF  ++  A+D  
Sbjct  477  TPARDDDEVVFDRGWQCKLFEDREEHIVDGLVRRLRS-----AGRDDAFA-AFNDAQDHV  530

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
                RA  DR +   FV A    +  + +++L  V  +Y ++ ++ D A FL +G L+  
Sbjct  531  LHAARAHVDRLVLEAFVAAVDRCSDDAARDLLGRVCDLYVLSTVEADRAWFLEHGRLSGS  590

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL  125
             A AV   +  LC++LRPHA  LV +F +P+  L
Sbjct  591  RAKAVSAGVNRLCADLRPHARTLVDAFAVPEELL  624



>ref|WP_017619701.1| acyl-CoA oxidase [Nocardiopsis gilva]
Length=660

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 102/221 (46%), Gaps = 26/221 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYV----------TCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K LL +Y             +   + F G  +E       +      
Sbjct  423  FEGDNTVLLQLVAKGLLTDYRDAFGDLDPLPMARLVARQFLGAVIERTAARSVIERLVSA  482

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P +     L    +Q  +   RE+H++   A  + +   +G    +AF + +  A+D  
Sbjct  483  APGRGEEADLYDRGWQLALLEDREKHIVEGLARRLRR---AGAEDADAFEV-FNNAQDHV  538

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
               GRA  DR +   FV A      G  + +L  +  +Y ++I++ED A FL +  L+  
Sbjct  539  LAAGRAHVDRVVLEAFVAAIDRCPEGGTRVLLDRLCDLYVLSIVEEDRAWFLEHERLSAS  598

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
             A AV + +  LC  LRPHA+ LV  FG+ D +L +PIA  
Sbjct  599  RAKAVTQAVNALCQGLRPHAVDLVEGFGLLDEWLAAPIALG  639



>ref|WP_037065914.1| acyl-CoA oxidase [Pseudonocardia acaciae]
Length=624

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 91/216 (42%), Gaps = 37/216 (17%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL----------------------EHM  590
            FEGDN VL+Q V+K LL  Y   +        LG+                      +H+
Sbjct  416  FEGDNTVLLQLVAKGLLTRY---RDHVGDLDTLGMIRFITEQMADIVAEHTAARRLAQHL  472

Query  589  NEPCPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQ  410
            +EP P  P            + + +F  RE H+L      + +  A G      F  +  
Sbjct  473  HEPRPDDPD-----------WHHSLFADREDHILAGLTRRLRRATAPGADPFAVFNAAQD  521

Query  409  LAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLT  233
                  RA  DR +  TF  A        ++ +L  +R+++A+  +  D   FL +G LT
Sbjct  522  HVLAAARAHVDRLVLDTFTAAIQRCPDRGVRELLDRLRALHALDHIAADRGWFLEHGRLT  581

Query  232  TDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFL  125
             + A AV   +  LC+ELRPHA  LV  F IP+ +L
Sbjct  582  PNQAKAVTATLNHLCAELRPHARTLVDGFDIPEAWL  617



>ref|WP_003924602.1| acyl-CoA oxidase [Mycobacterium thermoresistibile]
 gb|EHI13749.1| acyl-CoA dehydrogenase domain-containing protein [Mycobacterium 
thermoresistibile ATCC 19527]
Length=645

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 99/211 (47%), Gaps = 26/211 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---------VTCKRKGKAFKGLGLEHMNEPCPVIPSKLS-  554
            FEGDN V++QQV+K LL  Y         V   R      G  +       P+I + L  
Sbjct  423  FEGDNTVMLQQVAKGLLTAYADDVRSMSPVEWVRFAANTVGTRVLKRTAAQPIIQTILDN  482

Query  553  ---SDTLGSI---QFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
               S+  GS+     Q  +F  RE ++L+  A  +      G+ KE +   +Y   +D  
Sbjct  483  RQDSEEEGSLFNRGTQLQMFSDREEYMLSSVARRLQ-----GKSKEMSEFDAYNAVQDHV  537

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTD  227
                RA  DR I   FV    +       +IL +V  +YA+++++ D A F+++  L+T+
Sbjct  538  LHTARAHIDRVILEAFVAGIDACPDEEAAHILGMVCDLYALSVIERDEAWFIKHRFLSTE  597

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPD  134
             A AV + I   C  LRP+A  LV  FGIP+
Sbjct  598  RAKAVTRGINERCRTLRPYAELLVDGFGIPE  628



>ref|WP_044852233.1| acyl-CoA oxidase [Amycolatopsis orientalis]
Length=631

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 97/211 (46%), Gaps = 24/211 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPV--IPSK  560
            FEGDN VL+Q V+K LL  Y           T +   + F    +E  +    V  +   
Sbjct  422  FEGDNTVLLQLVAKGLLTSYKDHFEDLSPLATARFVAEQFVEAVIERTSARKVVERLTEA  481

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LG  392
              SD L S ++   +F  RE H+L   A  + +  +   G        +  A+D     G
Sbjct  482  DDSDVLYSREWHLKLFEDREEHVLGGVAQRLRKAASDPFG-------VFNDAQDHVLRAG  534

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            R   DR +   FV+A         + +L  V  +YA+A ++ D   FL +G LT+  + A
Sbjct  535  RVHVDRVVLEAFVDAIERCADPDARELLERVCDLYALANIEADRGWFLEHGRLTSGRSKA  594

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFLS  122
            V   +  LC++LRPHA  LV +F IP+ +L+
Sbjct  595  VTAAVNALCADLRPHARTLVDAFAIPEQYLA  625



>ref|WP_029269714.1| acyl-CoA oxidase [Flavobacterium sp. KJJ]
Length=754

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 102/210 (49%), Gaps = 14/210 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+   ++       LG+ +         + E  P+   +   
Sbjct  547  FEGDNTVLMQLVAKNRLSEF---RKSFGEMGSLGIINYVYENAKTAIAEKNPIATRRTDD  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
            + L   +F    F  RE+ +L   A  + +    G    +AF +      D+ +A+ +R 
Sbjct  604  EHLLDGEFHLQAFIHREKTILASAARRIKKLVDGGLEPYDAFNVVQHQMIDVAQAYLERI  663

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F     +V     K IL  +  +YA++ ++++ A +L  G +      AVRK +  
Sbjct  664  VLEQFQEVIKTVEDEKSKEILIKLYQLYALSQIEKNKAWYLEDGYMEAVKTKAVRKIVNQ  723

Query  193  LCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            LC ++RP A+ALV +F IP++ L +PIA N
Sbjct  724  LCWDIRPDAVALVNAFDIPESCLAAPIAVN  753



>ref|WP_039115718.1| acyl-CoA oxidase [Flavobacterium sp. KMS]
 gb|KIA94440.1| acyl-CoA oxidase [Flavobacterium sp. KMS]
Length=752

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 104/207 (50%), Gaps = 14/207 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+   ++       LG+ +         ++E  P+   K+  
Sbjct  547  FEGDNTVLMQLVAKNRLSEF---RKSFGEMGALGIVNYVFENAKTAISEKNPIATRKIED  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
              L   +F    F  RE+  L   A  + +   SG    +AF +      D+ +A+ +R 
Sbjct  604  AHLLDNEFHLLAFQHREKTTLASAAKRIKKLIDSGLEPYDAFNVVQHQMIDVAQAYLERI  663

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  +V   ++K ILS +  +YA+A ++++   +L  G +      A+RK +  
Sbjct  664  VLEQFQIAIETVKDTNVKEILSKLCHLYALAQIEKNKGWYLEDGYMEAVKTKAIRKMVNQ  723

Query  193  LCSELRPHALALVTSFGIPDTFL-SPI  116
            LC ++RP A+ALV +F IP++ L +PI
Sbjct  724  LCWDIRPDAVALVNAFDIPESCLAAPI  750



>ref|WP_027078216.1| acyl-CoA oxidase [Maribacter antarcticus]
Length=754

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 97/211 (46%), Gaps = 20/211 (9%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------------EHMNEPCPVIPSK  560
            FEGDNNVL+Q  +K +L+++       + F   G             + +    P+  +K
Sbjct  549  FEGDNNVLLQLAAKGVLSDF------KEEFNSAGFTAVLKLLSQQLSDKLATVNPLYSNK  602

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFA  380
               + L + +F    F  R R L    A  +  +   G     AFL        LG+A++
Sbjct  603  TDKEHLYNPKFHKHAFNHRTRRLTYTLAMRIRGYIKKGVPSYQAFLKVQTHLLTLGKAYS  662

Query  379  DRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKE  203
                Y T+     S+     + +   + S+YA++ + +DA+ +L  G + +  + A+R+ 
Sbjct  663  IELAYETYSTFTDSIADEKNRELFQKLGSLYALSEITKDASWYLEQGYIGSIKSKAIRRR  722

Query  202  IATLCSELRPHALALVTSFGIPDTFLS-PIA  113
               LC+ELRPH  +LV  FGIP   +S PIA
Sbjct  723  TERLCTELRPHLNSLVDGFGIPTHCMSAPIA  753



>ref|WP_005168178.1| Acyl-coenzyme A oxidase 1, peroxisomal [Amycolatopsis azurea]
 gb|EMD21876.1| Acyl-coenzyme A oxidase 1, peroxisomal [Amycolatopsis azurea 
DSM 43854]
Length=628

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 96/211 (45%), Gaps = 24/211 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPV--IPSK  560
            FEGDN VL+Q V+K LL  Y           T +   + F    +E  +    V  +   
Sbjct  419  FEGDNTVLLQLVAKGLLTSYKDHFEDLSPLATARFVAEQFVEAVIERTSARKVVERLTDA  478

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LG  392
              SD L S ++   +F  RE H+L   A  + +  +   G        +  A+D     G
Sbjct  479  DDSDVLYSREWHLKLFEDREEHVLGGVAQRLRKAASDPFG-------VFNDAQDHVLRAG  531

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            R   DR +   F+ A         + +L  V  +YA+A ++ D   FL +G LT+  + A
Sbjct  532  RVHVDRVVLEAFIGAIERCADAEARELLERVCDLYALANIEADRGWFLEHGRLTSGRSKA  591

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFLS  122
            V   +  LC++LRPHA  LV +F IP+ +L+
Sbjct  592  VTAAVNALCADLRPHARTLVDAFAIPEQYLA  622



>ref|WP_037306481.1| acyl-CoA oxidase [Amycolatopsis orientalis]
Length=628

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 97/211 (46%), Gaps = 24/211 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPV--IPSK  560
            FEGDN VL+Q V+K LL  Y           T +   + F    +E  +    V  +   
Sbjct  419  FEGDNTVLLQLVAKGLLTSYKDHFEDLSPLATARFVAEQFVEAVIERTSARKVVERLTEA  478

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LG  392
              SD L S ++   +F  RE H+L   A  + +  +   G        +  A+D     G
Sbjct  479  DDSDVLYSREWHLKLFEDREEHVLGGVAQRLRKAASDPFG-------VFNDAQDHVLRAG  531

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            R   DR +   FV+A         + +L  V  +YA+A ++ D   FL +G LT+  + A
Sbjct  532  RVHVDRVVLEAFVDAIERCADPDARELLERVCDLYALANIEADRGWFLEHGRLTSARSKA  591

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFLS  122
            V   +  LC++LRPHA  LV +F IP+ +L+
Sbjct  592  VTAAVNALCADLRPHARTLVDAFAIPEQYLA  622



>ref|XP_003293845.1| hypothetical protein DICPUDRAFT_158763 [Dictyostelium purpureum]
 gb|EGC29627.1| hypothetical protein DICPUDRAFT_158763 [Dictyostelium purpureum]
Length=648

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 93/204 (46%), Gaps = 27/204 (13%)
 Frame = -2

Query  709  LYFEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQ  530
            + +EGDN+VL+QQVS+ LL E     +KG+                + S      + S  
Sbjct  451  MTYEGDNHVLLQQVSRNLLVEL----QKGRY--------------TLTSANHDSNIHSYD  492

Query  529  FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTF--  356
            FQ      RE +L+   ++ +      G   E  +     +   LG+AF DR     F  
Sbjct  493  FQIQSLKWRESNLVQTLSSRIMAQLDQGRSLEQGWNTCLDVVTQLGKAFVDRITLEEFQA  552

Query  355  -VNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRKEIATLCSE  182
             +   PS    S K +L L R+++    ++ED   FL +  + T  A  V+  I  LC+E
Sbjct  553  GIKNAPS----STKPVLELCRNLFFSWKVNEDLGYFLCHDGIATQTAQKVQDSINILCAE  608

Query  181  LRPHALALVTSFGIPDTFL-SPIA  113
            + P  L LV SF +P+ F+ +PIA
Sbjct  609  MLPIGLDLVNSFNVPEQFIHAPIA  632



>ref|WP_016693747.1| hypothetical protein, partial [Rhodococcus rhodochrous]
Length=348

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 104/220 (47%), Gaps = 37/220 (17%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLG-LEHMNEPCP----------------  575
            FEGDN+VL Q V+K LL  Y          +G+  +E M                     
Sbjct  120  FEGDNHVLTQLVAKELLTAY------ADEVQGMSPVEWMRFAATTISDIVKKRTAAQQII  173

Query  574  --VIPSKLSSDTLGSI---QFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQ  410
              ++ ++  ++  GS+     Q  +F  RE++LL+  A  +   QA+ + ++N F  ++ 
Sbjct  174  QTIVDTRQDNEEDGSLFNRGTQVTMFEDREQYLLSTAARRL---QAAMKREDNPFD-AFN  229

Query  409  LAED----LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRY  245
              +D      RA  DR +   FV A       + +++LS +  +YA+ I+DED A F+ +
Sbjct  230  FVQDHVLHAARAHIDRVVLEAFVAAIEDCKDETARDLLSELCDLYALTIIDEDKAWFMEH  289

Query  244  GCLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFL  125
              L+ + A AV + I   C  LRPHAL LV   G+PD  L
Sbjct  290  RLLSVERAKAVTRGINERCRSLRPHALTLVDGLGVPDYLL  329



>ref|WP_005466173.1| acyl-CoA oxidase [Saccharomonospora glauca]
 gb|EIF00405.1| acyl-CoA dehydrogenase [Saccharomonospora glauca K62]
Length=640

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 100/221 (45%), Gaps = 27/221 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K LL  Y           T +   + F G  +E       +      
Sbjct  425  FEGDNTVLLQLVAKGLLTNYRLQFEDLSPLATARFVAEQFVGAVIERTAARRVVERIVDA  484

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P++   D +    +Q  +F  RE H+L+  A  +         ++NAF + +  A+D  
Sbjct  485  SPARDDDDVVFDRAWQCKLFTDRETHVLDGLARRLRAAT-----RDNAFDV-FNAAQDHV  538

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTD  227
                R   +R +  +FV A         + +L  V  +YA+++++ D A F+ +G LT+ 
Sbjct  539  LRAARVHVERLVLDSFVAAVERCEDAEARALLDKVCDLYALSVVEADRAWFMEHGRLTSG  598

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIAFNW  104
             A AV   +  LC ELRPHA  LV +F +P+        +W
Sbjct  599  RAKAVIAGVNRLCGELRPHARTLVDAFALPEPLWRVPMLDW  639



>ref|XP_642669.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
 gb|EAL68701.1| acyl-CoA oxidase [Dictyostelium discoideum AX4]
Length=638

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 95/206 (46%), Gaps = 10/206 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTLGSIQFQ  524
            FEGDN +L QQV+K +L+E     RK             +P      +   + + S  F 
Sbjct  443  FEGDNILLYQQVAKFMLSE----SRKNPP------TDYQQPSNEQKQRTDRNYIRSFDFL  492

Query  523  NDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYHTFVNAE  344
             +    R    +     ++S   + G    +A+  +      LG A+ ++TI   F+ A 
Sbjct  493  LEALNSRLNQTIQYVTEKLSDSVSEGSAIMDAWNDNGTYIVRLGVAYTEKTILDKFIAAV  552

Query  343  PSVNSGSLKNILSLVRSMYAMAILDEDAAFLRYGCLTTDNAAAVRKEIATLCSELRPHAL  164
             +    + +N L L+ S+Y + I+D D  FL+Y  ++   + ++  +I  LC E+ P+++
Sbjct  553  NNYPDENTRNALKLLVSLYVLNIIDRDNWFLKYQFISPQQSESISIQILELCKEIVPYSI  612

Query  163  ALVTSFGIPDTFLSPIAFNWIDSNAW  86
            +L  + G     L PIA +WI  N +
Sbjct  613  SLTDALGFDHQRLGPIAGDWISRNKF  638



>ref|WP_038508394.1| acyl-CoA oxidase [Amycolatopsis japonica]
 gb|AIG73837.1| acyl-CoA oxidase [Amycolatopsis japonica]
Length=630

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 94/207 (45%), Gaps = 16/207 (8%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPV--IPSK  560
            FEGDN VL+Q V+K LL  Y           T +   +      +E  +    V  +   
Sbjct  421  FEGDNTVLLQLVAKGLLTSYKDHFQDLSPLATARFVAEQLVEAVIERTSARKVVERLTEA  480

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFA  380
               D L S ++   +F  RE H+L   A  + +   +G      F  +       GRA  
Sbjct  481  DDGDVLYSREWHLKLFEDREEHVLGGVAQRLRK---AGSDPFGVFNDAQDHVLRAGRAHV  537

Query  379  DRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRKE  203
            DR +   FV+A         + +L  V  +YA+A ++ D   FL +G LT+  + AV   
Sbjct  538  DRVVLEAFVDAIERCADAEARELLERVCDLYALANIEADRGWFLEHGRLTSGRSKAVTAA  597

Query  202  IATLCSELRPHALALVTSFGIPDTFLS  122
            +  LC++LRPHA  LV +F IP+ +L+
Sbjct  598  VNALCADLRPHARTLVDAFAIPEPYLA  624



>ref|WP_013993723.1| acyl-CoA oxidase [Zobellia galactanivorans]
 ref|YP_004736804.1| acyl-coenzyme A oxidase [Zobellia galactanivorans]
 emb|CAZ96523.1| Acyl-coenzyme A oxidase [Zobellia galactanivorans]
Length=754

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/197 (26%), Positives = 93/197 (47%), Gaps = 7/197 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT---CKRKGKAFKGLGLE---HMNEPCPVIPSKLSSDTL  542
            FEGDN VL+   +K +L+++ +           K LG++    +    P+  +K+  D L
Sbjct  549  FEGDNTVLLLLAAKGVLSDFKSEFNSAGFSAVLKILGMQINDKLTTINPIYSNKVDKDHL  608

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
             + +F       R R L    A  +  +   G     AFL        LG+A+++   Y+
Sbjct  609  YNPKFHKHALEYRTRRLTYTLAMRIRDYIKQGVPSYQAFLKVQTHLLALGKAYSNELAYN  668

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDA-AFLRYGCLTTDNAAAVRKEIATLCS  185
            TF++    +     + +   + +++A+  + +DA  +L  G +    + A+R+ +  LC+
Sbjct  669  TFIDFIQDIEDDKNRTLFQKLGTLHALHTIRQDAEWYLEQGYIGGTKSKAIRQRVERLCT  728

Query  184  ELRPHALALVTSFGIPD  134
            ELRPH   LV  FGIP+
Sbjct  729  ELRPHIGVLVDGFGIPE  745



>ref|WP_037271082.1| acyl-CoA oxidase [Rhodococcus rhodnii]
Length=621

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 94/204 (46%), Gaps = 14/204 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPVIPSKLS  554
            FEGDN VL+Q V+K LL +Y           T +   +   G  LE +      + S+  
Sbjct  415  FEGDNTVLLQLVAKGLLTDYRDNFADLSPLATARLVAEQLMGAVLERI--AARQVISQFD  472

Query  553  SDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADR  374
             D + S  +   +F  RE+H+L   A  +    +S     + F  +       GR   DR
Sbjct  473  DD-VRSRDWHRSLFEGREQHVLEGLARRLRAAASSDTDPFDVFNDAQDHVLLAGRVHIDR  531

Query  373  TIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRKEIA  197
             ++  FV A  +     +K +L  V  +YA+A ++ D   FL +G +TT  +  V  E+ 
Sbjct  532  LVFDAFVAAIENCADEEVKALLEEVCDLYALATIEADRGWFLEHGRITTARSKRVTAEVN  591

Query  196  TLCSELRPHALALVTSFGIPDTFL  125
             LC  LR HA  LV +F IP+ +L
Sbjct  592  ALCKSLRWHARTLVDAFAIPEQYL  615



>ref|WP_019182355.1| acyl-CoA dehydrogenase [Microbacterium yannicii]
Length=701

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 98/226 (43%), Gaps = 39/226 (17%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---------VTCKR------KGKAFKGLGLEHMNEPCPVI  569
            FEGDNNVL+Q V K LLA+Y          T  R       GK F G GL  + +    +
Sbjct  452  FEGDNNVLLQLVGKRLLADYARQFKGADAATLARFAVSSTAGKLFHGAGLRQLGQAVADL  511

Query  568  PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEG----------KENAFLL  419
             S   S  LG          LRE     L A  V Q  A               E A L 
Sbjct  512  GSTARSVELG----------LREDQQHELLAGRVQQMVADVAAALRPASKLSPAEAAALF  561

Query  418  SYQLAE--DLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLR  248
            +   AE  +  RA A+   +  F +    ++    K +L+ +R ++ + ++++  A +L 
Sbjct  562  NAHQAELIEAARAHAELLQWEAFTDGINRISDAGTKQVLTWLRDLFGLHLIEKHLAWYLI  621

Query  247  YGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGI-PDTFLSPIA  113
             G L+    AAV + I  LC  LRPHA  LV ++G  P+   +PIA
Sbjct  622  NGRLSAHRGAAVTRYIDRLCGRLRPHAQDLVDAYGFAPEHVRAPIA  667



>ref|WP_037816709.1| acyl-CoA oxidase [Streptomyces sp. NRRL F-3213]
Length=631

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 95/221 (43%), Gaps = 34/221 (15%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYV---------------------TCKRKGKAFKGLGLEHMN  587
            FEGDN VL+Q V+K LL +Y                      T K +  A+K L  E + 
Sbjct  422  FEGDNTVLLQLVAKGLLTQYKEHFEDLSPLATARFVAEQLVDTVKERSAAWKFL--ERLT  479

Query  586  EPCPVIPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQL  407
            E          +  L   ++Q  +F  RE H+L+  A  +    +   G  N+      L
Sbjct  480  ESD-------DASVLFDREWQQRLFEDREEHVLSGVANRLRGAASDPFGVFNSVQDHVLL  532

Query  406  AEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTT  230
            A   GR   DR I   F  A P+        +L  V  +YA++ ++ D A FL +G ++ 
Sbjct  533  A---GRVHVDRLILDAFARAVPACPDPDAAALLDRVCDLYALSTIEADRAWFLEHGRISA  589

Query  229  DNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLSPIAFN  107
              + AV   +  LC  LRPHA  LV  F +P+ FL+    N
Sbjct  590  TRSKAVTAAVNALCGALRPHARTLVDGFAVPEQFLAAPMLN  630



>ref|WP_003080258.1| acyl-CoA oxidase [Amycolatopsis vancoresmycina]
 gb|EOD67779.1| acyl-CoA oxidase [Amycolatopsis vancoresmycina DSM 44592]
Length=629

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 99/209 (47%), Gaps = 24/209 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY------VTCKRKGKAFKGLGLEHMNEPCPVIPSKLSSDTL  542
            FEGDN VL+Q V+K LL  Y      ++     + F    +  + E   V  + L S T 
Sbjct  420  FEGDNTVLLQLVAKGLLTSYKQDFEDLSPLATARFFTDQVVSTILERTSVRKA-LESLTE  478

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGK------ENAFLLSYQLAED----LG  392
            GS    +D+F  RE  L  LF  +  QH   G  K      ++ F + +  A+D     G
Sbjct  479  GS---DSDVFFRREWQL-RLFE-DREQHVVEGVAKRLRKAADDPFGV-FNAAQDHVLRAG  532

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            R   +R +   F  A         + +L  V  +YA++ ++ED A FL +G LT     A
Sbjct  533  RVHVERLVLEAFAAAVERCEDPDARTLLERVCDLYALSAIEEDLAWFLGHGRLTASRGKA  592

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTF  128
            V   +  LCSELRPHA ALV +F IP+ F
Sbjct  593  VTSAVNRLCSELRPHARALVDAFAIPEQF  621



>ref|WP_034664791.1| acyl-CoA oxidase [Cellulophaga sp. E6(2014)]
 gb|KGK31907.1| acyl-CoA oxidase [Cellulophaga sp. E6(2014)]
Length=754

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 96/206 (47%), Gaps = 10/206 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKG---LGLEHMNEPC----PVIPSKLSSDT  545
            FEGDNNVL+Q  +K +L+++   +     F     L    +N+      P+  +K   D 
Sbjct  549  FEGDNNVLLQLAAKGVLSDF-KAEFNSAGFASVLKLLTSQLNDKLTTINPIYTNKTDPDH  607

Query  544  LGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIY  365
            L + +F    F  R R L    A  +  +   G     AFL        LG+A++ +  Y
Sbjct  608  LYNPKFHQHAFEYRTRRLTYTLAMRIRDYIKDGVPSYQAFLKVQTHLLALGKAYSCQLSY  667

Query  364  HTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLC  188
              F     ++     K +   + +++A+  +  DA  +L  G + +  + A+R+ +  +C
Sbjct  668  EIFTKFTETIADEKNKALFEKLGTLHALHEIRHDATWYLEQGYIGSTKSKAIRQRVERIC  727

Query  187  SELRPHALALVTSFGIPDTFLS-PIA  113
            +ELRPH   LV  FGIP+  ++ PIA
Sbjct  728  TELRPHINTLVDGFGIPEYLITAPIA  753



>ref|WP_019598670.1| hypothetical protein [Rhodonellum psychrophilum]
 gb|ERM81639.1| hypothetical protein P872_19995 [Rhodonellum psychrophilum GCM71 
= DSM 17998]
Length=767

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 99/205 (48%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAF------KGLGLEHMNEPCPVIPSKLSSDTL  542
            FEGDN VLMQ V+K+ L E+         F          + +++E  P+I    +S+ L
Sbjct  558  FEGDNTVLMQLVAKSRLTEFRQEFGDMNVFGIFNFVTDKAMTYVSEKNPLIIRSTNSEHL  617

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
                F  + F  RE+ +L   A+ + +    G    +AF +      ++G+A+ +R +  
Sbjct  618  LDFDFHLNAFRYREQAILGSAASRLKRLINGGMDSFDAFNVCQHHLINVGQAYIERVVLE  677

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRKEIATLCS  185
             F     S+     K  L+ +  +YA+  L+++   FL    +      A+RK +  LC 
Sbjct  678  QFQEKIKSIADKGSKKALTQMCQLYALHTLEKNRGWFLEQDYMEGVKTKAIRKMVNQLCW  737

Query  184  ELRPHALALVTSFGIPDTFLS-PIA  113
            E+RP A+AL  +F IP++ LS PIA
Sbjct  738  EIRPDAIALTDAFAIPESCLSAPIA  762



>ref|WP_009945757.1| acyl-CoA oxidase [Saccharopolyspora erythraea]
 emb|CAM06528.1| acyl-CoA oxidase [Saccharopolyspora erythraea NRRL 2338]
 gb|EQD87969.1| acyl-CoA oxidase [Saccharopolyspora erythraea D]
Length=653

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 96/219 (44%), Gaps = 26/219 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT----------CKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K LL  Y             +     F G  +E       +      
Sbjct  422  FEGDNTVLLQLVAKGLLTNYKDQFDDIGTLGMARFVADQFVGAVIERTAARPLVQRLADA  481

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P K   + +    +Q  +F  RE+H+L+  A  + +      GK+      +  A+D  
Sbjct  482  APGKDDENVIFDRGWQLRLFDDREKHVLDGLARRLRR----ATGKDADPFEVFNNAQDHV  537

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
                R   DR +   FV             +L  +  +Y ++ ++ED A FL +  L + 
Sbjct  538  LKAARVHVDRVVLEAFVAGIERCRDRDTAAVLERLCDLYVLSTVEEDRAWFLEHERLNSR  597

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFLS-PIA  113
             A +V + +  LC  LRPHA+ LV SFGIPD +L+ PIA
Sbjct  598  RAKSVTEAVNALCGRLRPHAVDLVESFGIPDQWLTAPIA  636



>ref|WP_037340849.1| acyl-CoA oxidase [Amycolatopsis sp. MJM2582]
 gb|KFZ79717.1| acyl-CoA oxidase [Amycolatopsis sp. MJM2582]
Length=628

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 96/208 (46%), Gaps = 18/208 (9%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPV--IPSK  560
            FEGDN VL+Q V+K LL  Y           T +   +      +E  +    V  +   
Sbjct  419  FEGDNTVLLQLVAKGLLTSYKDHFEDLSPLATARFVAEQLVEAVIERTSARKVVERLTEA  478

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQH-QASGEGKENAFLLSYQLAEDLGRAF  383
               D L S ++   +F  RE H+L    A V+Q  + +G      F  +       GRA 
Sbjct  479  DDGDVLYSREWHLKLFEDREEHVL----AGVAQRLRKAGSDPFGVFNDAQDHVLRAGRAH  534

Query  382  ADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRK  206
             DR +   FV+A         + +L  V  +YA+A ++ D   FL +G LT+  + AV  
Sbjct  535  VDRVVLEAFVDAIERCADAEARELLERVCDLYALANIEADRGWFLEHGRLTSGRSKAVTA  594

Query  205  EIATLCSELRPHALALVTSFGIPDTFLS  122
             +  LC++LRPHA  LV +F IP+ +L+
Sbjct  595  AVNALCADLRPHARTLVDAFAIPEPYLA  622



>ref|WP_026126958.1| acyl-CoA oxidase [Nocardiopsis xinjiangensis]
Length=658

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 60/217 (28%), Positives = 101/217 (47%), Gaps = 18/217 (8%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALL---------------AEYVTCKRKGKAF-KGLGLEHMNEPCPV  572
            FEGDN VL+QQ++K LL               A ++  K    A  +   +  ++     
Sbjct  426  FEGDNTVLLQQLTKGLLTNFQDAFGDLDQLGLARFMASKMFETAIERTAAVPLIDRLIAA  485

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLG  392
             P +  S +L +  +Q ++   RE+H++   AA + + +  G      F  +       G
Sbjct  486  APGRGGSTSLYNRGWQIELLEDREKHVVEGLAARLRRARKDGADAFEVFNHAQDHVLRAG  545

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            R   +R +   FV         S   +L+ +  +Y M++++ED A FL +  L+T  A A
Sbjct  546  RVHMERVVLEAFVAGIDRCGDTSTAKLLNRLCDLYVMSVVEEDRAWFLEHERLSTARAKA  605

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            V   +  LC  LRP+A+ LV +FG+ D +L +PIA  
Sbjct  606  VTAAVNELCQGLRPYAVQLVDAFGLRDEWLAAPIALG  642



>ref|WP_020631448.1| acyl-CoA oxidase [Amycolatopsis alba]
Length=628

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 96/211 (45%), Gaps = 24/211 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPV--IPSK  560
            FEGDN VL+Q V+K LL  Y           T +   + F    +E  +    V  +   
Sbjct  419  FEGDNTVLLQLVAKGLLTSYKDHFEDLSPLATARFVAEQFVEAVIERTSARKVVERLTDA  478

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LG  392
              SD L S ++   +F  RE H+L   A  + +  +   G        +  A+D     G
Sbjct  479  DDSDVLYSREWHLKLFEDREEHVLGGVAQRLRKAASDPFG-------VFNDAQDHVLRAG  531

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            R   DR +   F+ A         + +L  V  +YA+A ++ D   FL +G LT+  + A
Sbjct  532  RVHVDRVVLEAFIAAIERCADAEARELLERVCDLYALANIEADRGWFLEHGRLTSGRSKA  591

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFLS  122
            V   +  LC++LRPHA  LV +F IP+ +L+
Sbjct  592  VTAAVNALCADLRPHARTLVDAFAIPEQYLA  622



>ref|WP_027391884.1| acyl-CoA oxidase [Aquimarina latercula]
Length=754

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 96/205 (47%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKG---KAFKGLGL---EHMNEPCPVIPSKLSSDTL  542
            FEGDN+VL+   +K +L+E+ +           K LG    + ++   P   + +  D L
Sbjct  549  FEGDNHVLLLLAAKGILSEFKSEFNSAGFTAVLKLLGARLNDKLSTINPAYTNNVDKDHL  608

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
             + +F    F  R R L    A  +  +   G     AFL        LG+A++    Y 
Sbjct  609  YNPKFHKHAFDYRTRRLTYTLAMRIRDYVKKGIPSYQAFLKVQTHLLSLGKAYSTELAYS  668

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLCS  185
            TF +   ++     + +   + ++YA+  L +DA+ +L  G + +  + A+R  +  L +
Sbjct  669  TFTSFVDTIEDKKYQQLFQKIGTLYALHELRKDASWYLEQGYIGSAKSKAIRNRVERLST  728

Query  184  ELRPHALALVTSFGIPDTFLS-PIA  113
            ELRPH   LV  +GIP+  +S PIA
Sbjct  729  ELRPHIKTLVDGYGIPEHCMSAPIA  753



>ref|WP_029261307.1| MULTISPECIES: acyl-CoA dehydrogenase [Microbacterium]
Length=688

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 65/220 (30%), Positives = 103/220 (47%), Gaps = 28/220 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYV---------------TCKRKGKAFKGLGLEHMNEPCPVI  569
            FEGDNNVL+Q V K LL +Y                     GK F G GL  + +     
Sbjct  438  FEGDNNVLLQLVGKRLLTDYAKQFQGKDAAALAKFAVGMTAGKLFHGAGLRQLGQAVSDF  497

Query  568  PSKLSSDTLG-SIQFQNDIFCLRERHLLNLFAAEV---SQHQASGEGKENAFLLSYQLAE  401
                 S   G   + Q+D+   R + ++   A+ +   ++ +A G     A L +   AE
Sbjct  498  GQVSRSVERGLREEQQHDLLAGRVQQMVADIASRLRPGAKDKALG-----ARLFNENQAE  552

Query  400  --DLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAF-LRYGCLTT  230
              +  RA  +   +  F +A   ++    K +L+ +R ++ + ++++  A+ L  G L+T
Sbjct  553  LIEAARAHGELLQWEAFTDAVHQIDDADTKKVLTWLRDLFGLQLIEKHLAWHLINGRLST  612

Query  229  DNAAAVRKEIATLCSELRPHALALVTSFGI-PDTFLSPIA  113
              AAAV   I  LC+ LRPHAL LV +FG  P+   +PIA
Sbjct  613  QRAAAVSSYIDRLCARLRPHALDLVNAFGYEPEHVRAPIA  652



>ref|WP_039400089.1| acyl-CoA dehydrogenase [Microbacterium mangrovi]
 gb|KHK97182.1| acyl-CoA dehydrogenase [Microbacterium mangrovi]
Length=709

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 102/228 (45%), Gaps = 39/228 (17%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYV---------TCKR------KGKAFKGLGLEHMNEPCPVI  569
            FEGDNN+L+Q V K LL++Y          T  R       G  F G GL  + +    +
Sbjct  460  FEGDNNILLQLVGKRLLSDYAKQFKGKDAATVARIAARQTAGDLFHGAGLRRLGQAVGDL  519

Query  568  PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGK----------ENAFLL  419
             S   S   G          LRE     L A  V Q  A   G+          + A L 
Sbjct  520  GSTARSVERG----------LREDQQHELLAGRVQQMIADIAGRLRPASKLSPADAAGLF  569

Query  418  SYQLAE--DLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLR  248
            +   AE  +  RA  +   +  F +A  +V     +++L+ +R ++ ++++++  A ++ 
Sbjct  570  NANQAELIEAARAHGELLQWEAFTDALATVQDAGTRHVLTWLRDLFGLSLIEKHLAWYII  629

Query  247  YGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGI-PDTFLSPIAFN  107
             G L+T  AAAV   I  LC+ LRPHA  LV ++G  P+   +PIA  
Sbjct  630  NGRLSTQRAAAVSSYIDRLCTRLRPHAQDLVDAWGFEPEHVRAPIALG  677



>ref|WP_017598018.1| acyl-CoA oxidase [Nocardiopsis lucentensis]
Length=650

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 103/217 (47%), Gaps = 18/217 (8%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---------VTCKR--KGKAFKGLGLEHMNEP-----CPV  572
            FEGDN VL+QQ++K LL ++         +   R   G+ F+G+      +P        
Sbjct  426  FEGDNTVLVQQLTKGLLTDFRESFGDLDQLALARFMAGRVFEGVIERTAAKPLIDRLIAA  485

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLG  392
             P +     L +  +Q ++   RE+H++   A  + + +  G      F  +       G
Sbjct  486  APGRGEEADLYNRGWQLELLEDREKHVVEGLARRLRRARRDGSDAFEVFNRAQDHVLAAG  545

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            RA  DR +   FV         +   +LS V  +Y +++++E+ A FL +  L+T  A A
Sbjct  546  RAHMDRVVLEAFVAGIDRCGDQATAKLLSRVCDLYVLSVVEEERAWFLEHERLSTARAKA  605

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
            V + +  LC  LRP+A+ LV +FG+ D +L +PIA  
Sbjct  606  VSQAVNDLCRGLRPYAVTLVDAFGLRDEWLGAPIALG  642



>ref|WP_038237921.1| acyl-CoA oxidase [Zobellia uliginosa]
Length=754

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 99/205 (48%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKG---KAFKGLGLE---HMNEPCPVIPSKLSSDTL  542
            FEGDN VL+   +K +L+++ +           K LG++    +    P+  +K+  D L
Sbjct  549  FEGDNTVLLLLAAKGVLSDFKSEFNSAGFSAVLKILGIQINDKLTTINPIYSNKVDKDHL  608

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
             + +F    F  R R L    A  +  +  +G     AFL        LG+A+++   Y+
Sbjct  609  YNPKFHKHAFEYRTRRLTYTLAMRIRDYIKTGVPSYQAFLKVQSHLLALGKAYSNELAYN  668

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDA-AFLRYGCLTTDNAAAVRKEIATLCS  185
            T+ +   ++     + +   + +++A+  + +DA  +L  G +    + A+R+ +  L S
Sbjct  669  TYSDFAETIPDTKNRALFQKLGTLHALHTIRQDAEWYLEQGYIGGTKSKAIRQRVERLSS  728

Query  184  ELRPHALALVTSFGIPDTFLS-PIA  113
            ELRPH   LV  FGIP+  +S PIA
Sbjct  729  ELRPHIGVLVDGFGIPEYCMSAPIA  753



>ref|WP_026468560.1| acyl-CoA oxidase [Amycolatopsis balhimycina]
Length=629

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 95/211 (45%), Gaps = 24/211 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEH--MNEPCPVIPSK  560
            FEGDN VL+Q V+K LL  Y           T +          LE   + +   ++   
Sbjct  420  FEGDNTVLLQLVAKGLLTSYKQDFEDLSPLATARFFTDQVVNTILERTSVRKAVELLTEA  479

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LG  392
              +D      +Q  +F  RE H++   A  + +  +   G  N+       A+D     G
Sbjct  480  SDTDAFFRRDWQLRLFEDREDHVVEGVAKRLRKAASDPFGVFNS-------AQDHVLRAG  532

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            R   +R +   F +A         + +L  V  +YA++ ++ED A FL +G LT   A A
Sbjct  533  RVHVERLVLEAFASAIERCEDPDARALLERVCDLYALSAIEEDLAWFLGHGRLTASRAKA  592

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFLS  122
            V   +  LCSELRPHA  LV +F IPD FL+
Sbjct  593  VTSAVNRLCSELRPHARTLVDAFAIPDQFLA  623



>ref|WP_025615938.1| acyl-CoA oxidase [Cellulophaga baltica]
 gb|AIY13089.1| acyl-CoA oxidase [Cellulophaga baltica NN016038]
Length=754

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 95/206 (46%), Gaps = 10/206 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKG---LGLEHMNEPC----PVIPSKLSSDT  545
            FEGDNNVL+Q  +K +L+++   +     F     L    +N+      P+  +K   D 
Sbjct  549  FEGDNNVLLQLAAKGVLSDF-KAEFNSAGFASVLKLLTSQLNDKLTTINPIYTNKTDPDH  607

Query  544  LGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIY  365
            L + +F    F  R R L    A  +  +   G     AFL        LG+A++ +  Y
Sbjct  608  LYNPKFHQHAFEYRTRRLTYTLAMRIRDYIKDGVPSYQAFLKVQTHLLALGKAYSCQLSY  667

Query  364  HTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLC  188
              F     ++     K +   + +++A+  +  DA  +L  G +    + A+R+ +  +C
Sbjct  668  EIFTKFTETIGDEKNKALFEKLGTLHALHEIRHDATWYLEQGYIGGPKSKAIRQRVERIC  727

Query  187  SELRPHALALVTSFGIPDTFLS-PIA  113
            +ELRPH   LV  FGIP+  ++ PIA
Sbjct  728  TELRPHINTLVDGFGIPEYLITAPIA  753



>ref|WP_029450063.1| acyl-CoA oxidase [Cellulophaga baltica]
Length=754

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 95/206 (46%), Gaps = 10/206 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKG---LGLEHMNEPC----PVIPSKLSSDT  545
            FEGDNNVL+Q  +K +L+++   +     F     L    +N+      P+  +K   D 
Sbjct  549  FEGDNNVLLQLAAKGVLSDF-KAEFNSAGFASVLKLLTSQLNDKLTTINPIYTNKTDPDH  607

Query  544  LGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIY  365
            L + +F    F  R R L    A  +  +   G     AFL        LG+A++ +  Y
Sbjct  608  LYNPKFHQHAFEYRTRRLTYTLAMRIRDYIKDGVPSYQAFLKVQTHLLALGKAYSCQLSY  667

Query  364  HTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDA-AFLRYGCLTTDNAAAVRKEIATLC  188
              F     ++     K +   + +++A+  +  DA  +L  G +    + A+R+ +  +C
Sbjct  668  EIFTKFTETIGDEKNKALFEKLGTLHALHEIRHDANWYLEQGYIGGTKSKAIRQRVERIC  727

Query  187  SELRPHALALVTSFGIPDTFLS-PIA  113
            +ELRPH   LV  FGIP+  ++ PIA
Sbjct  728  TELRPHINTLVDGFGIPEYLITAPIA  753



>ref|WP_006552333.1| acyl-CoA oxidase [Rhodococcus pyridinivorans]
 gb|EHK83492.1| acyl-CoA oxidase [Rhodococcus pyridinivorans AK37]
Length=648

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 66/221 (30%), Positives = 104/221 (47%), Gaps = 37/221 (17%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLG-LEHMNEPCP----------------  575
            FEGDN+VL Q V+K LL  Y          +G+  +E M                     
Sbjct  420  FEGDNHVLTQLVAKELLTAYA------DEVQGMSPVEWMRFAATTISDIVKKRTAAQQII  473

Query  574  --VIPSKLSSDTLGSI---QFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQ  410
              ++ ++  S+  GS+     Q  +F  RE++LL+  A  +   QA+ + ++N F  ++ 
Sbjct  474  QTIVDTRQDSEEDGSLFDRGTQVTMFEDREQYLLSTAARRL---QAAMKREDNPFD-AFN  529

Query  409  LAED----LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRY  245
              +D      RA  DR +   FV A       + +++LS +  +YA+ I+DED A F+ +
Sbjct  530  FVQDHVLHAARAHIDRVVLEAFVAAIEDCKDETARDLLSELCDLYALTIIDEDKAWFMEH  589

Query  244  GCLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFLS  122
              L+ + A AV + I   C  LRPHAL LV   G+PD  L 
Sbjct  590  RLLSVERAKAVTRGINERCRSLRPHALTLVDGLGVPDYLLG  630



>ref|WP_040270575.1| acyl-CoA oxidase [Streptomonospora alba]
 gb|KIH99953.1| acyl-CoA oxidase [Streptomonospora alba]
Length=659

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 100/218 (46%), Gaps = 19/218 (9%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYV----------TCKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V+K LL +Y             +     F G  +E       +      
Sbjct  424  FEGDNTVLLQLVAKGLLTDYRQEFGELDPLGVARFAAGQFLGAVIERTAARSLIERLVNA  483

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKE-NAFLLSYQLAEDL  395
             P +     L +  +Q  +   RE+H+L+  A  + +  +S + +  + F  +       
Sbjct  484  APGRDDESDLYNRGWQLRLLEDREKHVLDGLARRLRRAGSSSDPQAWDVFNEAQDHVLSA  543

Query  394  GRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAA  218
             RA  +R +   FV A    +    + +L  V  ++ ++ ++ED A FL +  LT   A 
Sbjct  544  ARAHMERVVLEAFVAAIDRCSDERTRELLDTVCDLFVLSAVEEDRAWFLEHERLTATRAK  603

Query  217  AVRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
             V +++  LC+ LRPHA ALV +FG PD +L +PIA  
Sbjct  604  TVTQQVDRLCARLRPHAGALVDAFGFPDEWLAAPIALG  641



>ref|WP_039119472.1| acyl-CoA oxidase [Flavobacterium sp. JRM]
 gb|KIC00790.1| acyl-CoA oxidase [Flavobacterium sp. JRM]
Length=752

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 103/207 (50%), Gaps = 14/207 (7%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH---------MNEPCPVIPSKLSS  551
            FEGDN VLMQ V+K  L+E+   ++       LG+ +         ++E  P+   K   
Sbjct  547  FEGDNTVLMQLVAKNRLSEF---RKSFGEMGALGIVNYVFENAKTAISEKNPIATRKTED  603

Query  550  DTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRT  371
              L   +F    F  RE+  L   A  + +   SG    +AF +      D+ +A+ +R 
Sbjct  604  AHLLDNEFHLLAFQHREKTTLASAAKRIKKLIDSGLEPYDAFNVVQHQMIDVAQAYLERI  663

Query  370  IYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIAT  194
            +   F  A  +V   ++K ILS +  +YA+A ++++   +L  G +      A+RK +  
Sbjct  664  VLEQFQIAIETVKDTNVKEILSKLCHLYALAQIEKNKGWYLEDGYMEAVKTKAIRKMVNQ  723

Query  193  LCSELRPHALALVTSFGIPDTFL-SPI  116
            LC ++RP A+ALV +F IP++ L +PI
Sbjct  724  LCWDIRPDAVALVNAFDIPESCLAAPI  750



>ref|WP_029447141.1| acyl-CoA oxidase [Cellulophaga baltica]
 gb|AIZ41457.1| acyl-CoA oxidase [Cellulophaga baltica 18]
Length=754

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 95/206 (46%), Gaps = 10/206 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKG---LGLEHMNEPC----PVIPSKLSSDT  545
            FEGDNNVL+Q  +K +L+++   +     F     L    +N+      P+  +K   D 
Sbjct  549  FEGDNNVLLQLAAKGVLSDF-KAEFNSAGFASVLKLLTSQLNDKLTTINPIYTNKTDPDH  607

Query  544  LGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIY  365
            L + +F    F  R R L    A  +  +   G     AFL        LG+A++ +  Y
Sbjct  608  LYNPKFHQHAFEYRTRRLTYTLAMRIRDYIKDGVPSYQAFLKVQTHLLALGKAYSCQISY  667

Query  364  HTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLC  188
              F     ++     K +   + +++A+  +  DA  +L  G +    + A+R+ +  +C
Sbjct  668  EIFTKFTETIADEKNKALFEKLGTLHALHEIRHDATWYLEQGYIGGTKSKAIRQRVERIC  727

Query  187  SELRPHALALVTSFGIPDTFLS-PIA  113
            +ELRPH   LV  FGIP+  ++ PIA
Sbjct  728  TELRPHINTLVDGFGIPEYLITAPIA  753



>ref|WP_011292662.1| acyl-CoA oxidase [Thermobifida fusca]
 gb|AAZ56272.1| conserved hypothetical protein [Thermobifida fusca YX]
 gb|EOR70723.1| hypothetical protein TM51_11505 [Thermobifida fusca TM51]
Length=659

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 98/223 (44%), Gaps = 31/223 (14%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT----------CKRKGKAFKGLGLEH------MNEPCPV  572
            FEGDN VL+Q V K+LL  Y             K     F G  +E       ++     
Sbjct  424  FEGDNTVLLQLVGKSLLTNYRQEFGNLDPLGMAKFAAGQFLGTVIERTAARSLLDRLVQA  483

Query  571  IPSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGE------GKENAFLLSYQ  410
             P +   D L + ++Q  +   RE H+L   A  +    A  +        ++  LL+  
Sbjct  484  APGRGDEDDLRNREWQRALLADRENHVLEGLARRLRAAPADADPFDVVNNVQDHVLLA--  541

Query  409  LAEDLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILD-EDAAFLRYGCLT  233
                  RA  DR ++  F +    +     + ++  +  + A+++++ E A FL +G LT
Sbjct  542  -----ARAHVDRLVFEAFASGVARIEDEGTRAVVERLCDLAALSLVEQERAWFLEHGRLT  596

Query  232  TDNAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
               A AV   +  LC ELRPHA  LV +FG+ D +L +PIA  
Sbjct  597  PARAKAVTATVNALCQELRPHARDLVDAFGLNDEWLAAPIALG  639



>ref|WP_040168540.1| acyl-CoA dehydrogenase, partial [Microbacterium sp. G3]
Length=685

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 104/226 (46%), Gaps = 39/226 (17%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVT-CKRK--------------GKAFKGLGLEHMNEPCPVI  569
            FEGDNN+L+Q V K LL +Y T  K K              GK F G GL  + +    +
Sbjct  434  FEGDNNILLQLVGKRLLTDYGTQLKEKDQRQLAAFAVGQAAGKVFHGAGLRRLGQAFADM  493

Query  568  PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQA---------SGEGKENAFLLS  416
             S     T  S++F      LRER    L A  V Q  A         + +  + AF   
Sbjct  494  GS-----TARSVEF-----GLRERDQQELLADRVQQMVADIAMRMRPSAKQTPDEAFATF  543

Query  415  YQLAEDL---GRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAF-LR  248
             +   +L    RA  +   +  F +A  +      + +L+ +R ++ ++++++  A+ + 
Sbjct  544  NENQSELMEAARAHGELLQWEAFTDAVRTAPDDGTREVLTWLRDLFGLSLIEKHLAWHII  603

Query  247  YGCLTTDNAAAVRKEIATLCSELRPHALALVTSFGI-PDTFLSPIA  113
             G L+T  AA+V + I  LC  LRPHA  LV +FG  P+   +PIA
Sbjct  604  NGRLSTQRAASVSRYIDRLCQRLRPHAQDLVDAFGYEPEHLRAPIA  649



>ref|WP_034248225.1| acyl-CoA oxidase [Arenibacter algicola]
Length=753

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 99/205 (48%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKG---KAFKGLGLEHMNEPC---PVIPSKLSSDTL  542
            FEGDN VL+Q  +K +++++ T          FK LG +  ++     P+  +K+  + L
Sbjct  548  FEGDNTVLLQLAAKGIMSDFNTEFNSAGFSAVFKLLGTQISDKLVTINPIYANKVDKEHL  607

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
             + +F    F  R R L    A  +  +   G     AFL        LG+A++    Y+
Sbjct  608  YNPKFHQHAFDYRTRRLTYSAAMRIRDYIKKGVPTYQAFLKVQTHLIALGKAYSCELAYN  667

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLCS  185
            T++    ++     + +   +  ++A++ + EDA+ +L  G L    + A+R+ +  L +
Sbjct  668  TYLQFTETIEDKKNQQLFQKLGCLFALSEIREDASWYLEQGYLGGTKSKAIRQRVERLST  727

Query  184  ELRPHALALVTSFGIPDTFLS-PIA  113
            E RPH   LV  FGIPD  L+ PI+
Sbjct  728  EFRPHIEVLVDGFGIPDHCLTAPIS  752



>ref|WP_016337188.1| acyl-CoA oxidase [Amycolatopsis orientalis]
 gb|AGM09489.1| acyl-CoA oxidase [Amycolatopsis orientalis HCCB10007]
Length=628

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 95/208 (46%), Gaps = 18/208 (9%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY----------VTCKRKGKAFKGLGLEHMNEPCPV--IPSK  560
            FEGDN VL+Q V+K LL  Y           T +   +      +E  +    V  +   
Sbjct  419  FEGDNTVLLQLVAKGLLTSYKDHFQDLSPLATARFVAEQLVEAVIERTSARKVVERLTEA  478

Query  559  LSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQH-QASGEGKENAFLLSYQLAEDLGRAF  383
               D L S ++   +F  RE H+L    A V+Q  + +G      F  +       GRA 
Sbjct  479  DDGDVLYSREWHLKLFEDREEHVL----AGVAQRLRKAGSDPFGVFNDAQDHVLRAGRAH  534

Query  382  ADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAAVRK  206
             DR +   FV A         + +L  V  +YA+A ++ D   FL +G LT+  + AV  
Sbjct  535  VDRVVLEAFVGAIERCADAEARELLERVCDLYALANIEADRGWFLEHGRLTSGRSKAVTA  594

Query  205  EIATLCSELRPHALALVTSFGIPDTFLS  122
             +  LC++LRPHA  LV +F IP+ +L+
Sbjct  595  AVNALCADLRPHARTLVDAFAIPEPYLA  622



>ref|WP_017576371.1| acyl-CoA oxidase [Nocardiopsis kunsanensis]
Length=659

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 110/221 (50%), Gaps = 25/221 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTC----KRKG--KAFKGLGLEHMNE---PCPVI------  569
            FEGDN VL+QQ++K LL  +        + G  K   G   E++ E     P+I      
Sbjct  426  FEGDNTVLLQQLTKGLLTNFQDAFGDLDQMGLVKFMAGKVFENVIERTAAVPLIDRLIAA  485

Query  568  -PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P +  + +L +  +Q ++   RE+H++   AA +   +A  +   +AF + +  A+D  
Sbjct  486  APGRGGNSSLYNRGWQIELLEDREKHVVEGLAARI--RRARKDDGRDAFEV-FNHAQDHV  542

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
               GR   +R +   FV         S   +L+ +  +Y M++++ED A FL +  L+T 
Sbjct  543  LRAGRVHMERVVLEAFVAGIDRCGDTSTAKLLNRLCDLYVMSVIEEDRAWFLEHERLSTA  602

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
             A AV   +  LC  LRP+A+ LV +FG+ + +L +PIA  
Sbjct  603  RAKAVTAAVNELCQGLRPYAVQLVDAFGLREEWLAAPIALG  643



>ref|WP_036382477.1| acyl-CoA oxidase [Muricauda sp. MAR_2010_75]
Length=754

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 96/205 (47%), Gaps = 8/205 (4%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL------EHMNEPCPVIPSKLSSDTL  542
            FEGDN VL+Q  +K +L+++            L L      + +    P+  +K+ ++ L
Sbjct  549  FEGDNTVLLQLAAKGVLSDFKAEFNSAGFASVLKLLQTQLSDKLTAINPLYSNKVDAEHL  608

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIYH  362
             + +F    F  R R L    A  +  +   G     AFL        LG+A++    Y 
Sbjct  609  YNPKFHKHAFNYRTRRLTYTLAMRIRSYIKKGMPSYQAFLKVQTHLLALGKAYSVELAYQ  668

Query  361  TFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDA-AFLRYGCLTTDNAAAVRKEIATLCS  185
             F +   SV     K++L  + ++YA+  +  DA  +L  G ++   + A+R+ +  L +
Sbjct  669  IFSDFCASVQDDKYKSLLEKLGALYALHQIHLDARWYLEQGYISGTKSKAIRQRVERLST  728

Query  184  ELRPHALALVTSFGIPDTFLS-PIA  113
            ELRPH   LV  FGIP+  L+ PIA
Sbjct  729  ELRPHIEVLVDGFGIPEHCLTAPIA  753



>ref|WP_024481861.1| acyl-CoA oxidase [Cellulophaga baltica]
Length=754

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 95/206 (46%), Gaps = 10/206 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKG---LGLEHMNEPC----PVIPSKLSSDT  545
            FEGDNNVL+Q  +K +L+++   +     F     L    +N+      P+  +K   D 
Sbjct  549  FEGDNNVLLQLAAKGVLSDF-KAEFNSAGFASVLKLLTSQLNDKLTTINPIYTNKTDPDH  607

Query  544  LGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAEDLGRAFADRTIY  365
            L + +F    F  R R L    A  +  +   G     AFL        LG+A++ +  Y
Sbjct  608  LYNSKFHQHAFEYRTRRLTYTLAMRIRDYIKDGVPSYQAFLKVQTHLLALGKAYSCQLSY  667

Query  364  HTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLC  188
              F     ++     K +   + +++A+  +  DA  +L  G +    + A+R+ +  +C
Sbjct  668  EIFTKFTETIADEKNKALFEKLGTLHALHEIRHDATWYLEQGYIGGSKSKAIRQRVERIC  727

Query  187  SELRPHALALVTSFGIPDTFLS-PIA  113
            +ELRPH   LV  FGIP+  ++ PIA
Sbjct  728  TELRPHLNTLVDGFGIPEYLITAPIA  753



>ref|WP_015100482.1| Acyl-CoA oxidase [Saccharothrix espanaensis]
 emb|CCH30370.1| Acyl-CoA oxidase [Saccharothrix espanaensis DSM 44229]
Length=615

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 66/214 (31%), Positives = 100/214 (47%), Gaps = 25/214 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEHMNEPCPVIPSKL-----------  557
            FEGDN VL+Q V+K LL  Y         + G+     ++   V+  +            
Sbjct  407  FEGDNTVLLQLVAKGLLTSYRDHVGDLDPW-GMARFVADQVVDVVIERTAARAIIDRLVS  465

Query  556  -SSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED----LG  392
             SSD L    +Q   F  RERH+L   A  + +        ENAF + +  A+D      
Sbjct  466  GSSDALLDRGWQVRQFEDRERHVLEGLARRLRRAT-----PENAFDV-FNTAQDHVLHAA  519

Query  391  RAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNAAA  215
            RA  DR +   FV A        +  +L  V  +YA++ ++ D A FL +G LT   + +
Sbjct  520  RAHVDRVVLEAFVAAVDRCPDPEVSALLDTVCDLYALSTIEADRAWFLEHGRLTAARSKS  579

Query  214  VRKEIATLCSELRPHALALVTSFGIPDTFL-SPI  116
            + + +  LC+ LRPHA  LV  FG+P+ +L +PI
Sbjct  580  LTQAVNQLCAGLRPHARRLVDVFGVPEGWLAAPI  613



>ref|WP_035694733.1| acyl-CoA oxidase [Flavobacterium soli]
Length=753

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 104/205 (51%), Gaps = 10/205 (5%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGLEH------MNEPCPVIPSKLSSDTL  542
            FEGDN VLMQ V+K  L+E+     +  AF  +   +      +++  P          L
Sbjct  547  FEGDNTVLMQLVAKNRLSEFRKEFGEMNAFGIINYVYDQAKTVISQKNPFATRNTDEAHL  606

Query  541  GSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAF-LLSYQLAEDLGRAFADRTIY  365
               +F  + F  RE+ +LN  A  + +    G    +AF ++ +Q+ E + +A+ +R   
Sbjct  607  LDKEFHLNAFQYREKQILNSAAKRLKKLIDEGLDSYDAFNVVQHQMIE-VAQAYLERVTL  665

Query  364  HTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTDNAAAVRKEIATLC  188
              F     S+   + K IL+ +  +YA++ ++++   FL  G +      A+RK +  LC
Sbjct  666  EQFYTEIESIKDENCKTILTELCQLYALSQIEKNKGWFLEDGYMEGVKTKAIRKMVNQLC  725

Query  187  SELRPHALALVTSFGIPDTFL-SPI  116
             E+RP+A+ALV +F IP++ L +PI
Sbjct  726  WEIRPNAVALVEAFDIPESCLAAPI  750



>ref|WP_017546736.1| acyl-CoA oxidase [Nocardiopsis prasina]
Length=663

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 101/219 (46%), Gaps = 23/219 (11%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYVTCKRKGKAFKGLGL---------EHMNEPCPVIP--SKL  557
            FEGDN VL+QQ++KALL  +   K        LGL         E + E    IP   +L
Sbjct  432  FEGDNTVLLQQLTKALLTNF---KDSFGDLDQLGLARFMAGKVFETVIERTAAIPLIDRL  488

Query  556  SSDTLGSIQ-------FQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED  398
             + + G  +       +  ++   RE+H++   A  + + +  G      F  +      
Sbjct  489  VAASPGRDEAGLYNRGWHLELMEDREKHIIEGLAGRLRRSRKDGSDAFEVFNQAQDHVLA  548

Query  397  LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTDNA  221
             GRA  DR +   FV         S   +L+ +  +Y +++++ED A FL +  L+T   
Sbjct  549  AGRAHMDRVVLEAFVAGIDRCGDQSTAKLLNRLCDLYVLSVIEEDRAWFLEHERLSTART  608

Query  220  AAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPIAFN  107
             AV   +  LC  LRP+A+ LV +FG+ D +L +PIA  
Sbjct  609  KAVTAAVNDLCRGLRPYAVRLVDAFGLRDEWLGAPIALG  647



>ref|WP_036396123.1| acyl-CoA oxidase [Mycobacterium cosmeticum]
Length=656

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 100/211 (47%), Gaps = 26/211 (12%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---------VTCKRKGKAFKGLGLEHMNEPCPVIPSKLSS  551
            FEGDN+VL Q V+K LL  Y         V   R    F G  +        ++ + L +
Sbjct  418  FEGDNHVLTQLVAKELLTAYADDIKGMSPVEWVRFAANFAGERVMKRTAAETIMQTILDT  477

Query  550  ----DTLGSI---QFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
                +  GS+     Q  +F  RE++LL+  A  +      G+ KE +   ++   +D  
Sbjct  478  RQDNEEEGSLFNRGTQVQMFEDREQYLLSTVARRLQ-----GKAKEVSAFDAFNAVQDHV  532

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAA-FLRYGCLTTD  227
                 A  DR +   FV    +    + + IL LV  +YA++I++ED A F+ +  L+T+
Sbjct  533  LHAATAHIDRIVLEAFVAGIDTCEDPTAREILDLVCDLYALSIIEEDKAWFVEHRFLSTE  592

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPD  134
             A AV + I   C +LRPHA  LV  FGIP+
Sbjct  593  RAKAVTRAINDRCRKLRPHAELLVDGFGIPE  623



>ref|WP_017204343.1| acyl-CoA dehydrogenase [Microbacterium barkeri]
Length=684

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/225 (30%), Positives = 98/225 (44%), Gaps = 38/225 (17%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEYV---------------TCKRKGKAFKGLGLEHMNEPCPVI  569
            FEGDNNVL+Q V K LL +Y                     GK F G GL  + +     
Sbjct  434  FEGDNNVLLQLVGKRLLTDYAKQFQGKDAAALAKFAVGMTAGKLFHGAGLRQLGQAVSDF  493

Query  568  PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQAS------GEGKENAF---LLS  416
                 S   G          LRE    +L A  V Q  A         GK+ A    L +
Sbjct  494  GQVSRSVERG----------LREEQQHDLLAGRVQQMVADIAGRLRAGGKDKALGARLFN  543

Query  415  YQLAE--DLGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDEDAAF-LRY  245
               AE  +  RA  +   +  F +A   ++    K +L+ +R ++ + ++++  A+ L +
Sbjct  544  ENQAELIEAARAHGELLQWEAFTDALRRIDDPQTKKVLTWLRDLFGLQLIEKHLAWHLIH  603

Query  244  GCLTTDNAAAVRKEIATLCSELRPHALALVTSFGI-PDTFLSPIA  113
            G L+   AAAV   I  LC+ LRP+AL LV +FG  P+   +PIA
Sbjct  604  GRLSMQRAAAVSSYIDRLCARLRPYALDLVNAFGYEPEHVRAPIA  648



>ref|WP_039500185.1| acyl-CoA oxidase [Prauserella sp. Am3]
 gb|KID32089.1| Acyl-coenzyme A oxidase [Prauserella sp. Am3]
Length=628

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 99/218 (45%), Gaps = 28/218 (13%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---VTCKRKGKAFKGLGLEHMN------EPCPVI------  569
            FEGDN VL+Q V+K LL  Y   V   R  +  + L  + ++          VI      
Sbjct  414  FEGDNTVLLQLVAKGLLTSYKQEVQDLRPIETVRFLAEQVVDVVIERTSARKVIERIMDA  473

Query  568  -PSKLSSDTLGSIQFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
             P +   D+L    +Q  +F  RE H+L+     + +      G++N     +  A+D  
Sbjct  474  SPRRDDEDSLYDRAWQISMFEDREEHVLDSLVKRLRR-----AGRDNG-XEXFNSAQDHV  527

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSLKNILSLVRSMYAMAILDED-AAFLRYGCLTTD  227
               GR   DR +   FV A         K +L  V  +YA+A ++ D A FL +G  T  
Sbjct  528  LRAGRXHVDRIVLEAFVGAIDRCTDPDTKALLERVCDLYALANIEADRAWFLEHGRFTAQ  587

Query  226  NAAAVRKEIATLCSELRPHALALVTSFGIPDTFL-SPI  116
               AV   +  LC+ELRP A  LV +F +P+ FL +PI
Sbjct  588  RGKAVVAAVNELCAELRPRARELVDAFAVPERFLRAPI  625



>ref|WP_006241046.1| acyl-CoA oxidase [Mycobacterium tusciae]
Length=645

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 102/216 (47%), Gaps = 31/216 (14%)
 Frame = -2

Query  703  FEGDNNVLMQQVSKALLAEY---------VTCKRKGKAFKGLGLEHMNEPCPVIPSKLSS  551
            FEGDN+VL Q V+K LL  Y         V   R    F G  +        ++ + L +
Sbjct  419  FEGDNHVLTQLVAKELLTTYADDIKGMSPVEWVRFAANFAGERVLKRTAAETIMQTILDT  478

Query  550  ----DTLGSI---QFQNDIFCLRERHLLNLFAAEVSQHQASGEGKENAFLLSYQLAED--  398
                +  GS+     Q  +F  RE ++L+  A  +      G+ KE +   ++   +D  
Sbjct  479  RQDNEEEGSLFNRGTQVKMFEDREEYMLSTVARRLQ-----GKSKEMSAFDAFNSVQDHV  533

Query  397  --LGRAFADRTIYHTFVNAEPSVNSGSL-----KNILSLVRSMYAMAILDED-AAFLRYG  242
                RA  DR I   FV    S  S S+     + IL+LV  +YA+ +++ED A F+ + 
Sbjct  534  LHTARAHIDRIILEAFVAGIDSCESTSVEGQEAREILNLVCDLYALTVIEEDRAWFMEHR  593

Query  241  CLTTDNAAAVRKEIATLCSELRPHALALVTSFGIPD  134
             L+T+ A AV + I   C +LRPHA  LV  FGIP+
Sbjct  594  FLSTERAKAVTRGINERCRDLRPHAELLVDGFGIPE  629



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150