BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019O14

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792971.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     173   3e-48   Nicotiana sylvestris
ref|XP_009629822.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     166   2e-45   Nicotiana tomentosiformis
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     164   7e-45   Solanum tuberosum [potatoes]
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     159   4e-43   Solanum lycopersicum
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580          159   6e-43   Vitis vinifera
emb|CBI30663.3|  unnamed protein product                                159   4e-41   Vitis vinifera
emb|CDP21061.1|  unnamed protein product                                152   2e-40   Coffea canephora [robusta coffee]
ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     150   1e-39   Nicotiana sylvestris
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     149   3e-39   Nelumbo nucifera [Indian lotus]
emb|CDO96754.1|  unnamed protein product                                149   3e-39   Coffea canephora [robusta coffee]
ref|XP_006361073.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     147   5e-39   
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     147   2e-38   Nicotiana tomentosiformis
emb|CDP21060.1|  unnamed protein product                                140   2e-37   Coffea canephora [robusta coffee]
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600          144   2e-37   Glycine max [soybeans]
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    142   7e-37   Solanum lycopersicum
gb|KHN08454.1|  GDSL esterase/lipase                                    144   2e-36   Glycine soja [wild soybean]
ref|XP_007020868.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    136   2e-36   
ref|XP_003593737.1|  GDSL esterase/lipase                               141   2e-36   Medicago truncatula
gb|AFK42362.1|  unknown                                                 141   3e-36   Medicago truncatula
gb|KHN08455.1|  GDSL esterase/lipase                                    135   4e-36   Glycine soja [wild soybean]
ref|XP_007020867.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    137   4e-36   
ref|XP_008358656.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     135   1e-35   
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     137   5e-35   Citrus sinensis [apfelsine]
gb|KDO77812.1|  hypothetical protein CISIN_1g018031mg                   135   6e-35   Citrus sinensis [apfelsine]
ref|NP_973932.1|  GDSL esterase/lipase                                  137   6e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                    137   7e-35   Arabis alpina [alpine rockcress]
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     136   1e-34   
ref|XP_007020866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    140   1e-34   
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                   136   2e-34   Citrus sinensis [apfelsine]
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg             135   2e-34   Citrus clementina [clementine]
ref|XP_010911731.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     132   5e-34   Elaeis guineensis
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     135   5e-34   Cicer arietinum [garbanzo]
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    135   7e-34   
emb|CDO96753.1|  unnamed protein product                                134   9e-34   Coffea canephora [robusta coffee]
ref|NP_001241470.1|  uncharacterized protein LOC100816865               134   1e-33   Glycine max [soybeans]
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     133   2e-33   Phoenix dactylifera
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     133   2e-33   Phoenix dactylifera
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     132   4e-33   Phoenix dactylifera
ref|XP_010912648.1|  PREDICTED: sinapine esterase-like isoform X3       132   4e-33   
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     132   4e-33   Prunus mume [ume]
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    132   5e-33   Elaeis guineensis
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    132   5e-33   Elaeis guineensis
gb|EYU28060.1|  hypothetical protein MIMGU_mgv1a008085mg                132   6e-33   Erythranthe guttata [common monkey flower]
ref|XP_002893538.1|  predicted protein                                  135   7e-33   
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     132   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010422035.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    132   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009784633.1|  PREDICTED: GDSL esterase/lipase At5g45910          131   8e-33   Nicotiana sylvestris
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    132   9e-33   Camelina sativa [gold-of-pleasure]
emb|CDY15655.1|  BnaA07g08260D                                          131   1e-32   Brassica napus [oilseed rape]
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     131   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     131   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     130   2e-32   Brassica rapa
gb|AAM65183.1|  lipase, putative                                        130   3e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94634.1|  BnaC07g10240D                                          130   3e-32   
ref|NP_174182.1|  GDSL esterase/lipase                                  130   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252    134   3e-32   
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg             130   4e-32   
ref|XP_004291631.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     130   4e-32   Fragaria vesca subsp. vesca
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    130   4e-32   
gb|EEE55084.1|  hypothetical protein OsJ_02825                          127   4e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    130   5e-32   Brassica rapa
ref|XP_008371712.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     130   5e-32   
ref|XP_010540491.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    129   5e-32   Tarenaya hassleriana [spider flower]
ref|XP_009608032.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    129   5e-32   
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     130   6e-32   Phoenix dactylifera
gb|AAL86351.1|  putative lipase                                         126   7e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDO99485.1|  unnamed protein product                                129   7e-32   Coffea canephora [robusta coffee]
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     129   7e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     129   7e-32   Cicer arietinum [garbanzo]
ref|XP_003593740.1|  GDSL esterase/lipase                               129   8e-32   Medicago truncatula
gb|EMT22799.1|  GDSL esterase/lipase                                    129   9e-32   
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878    132   9e-32   
ref|XP_010460977.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     124   1e-31   Camelina sativa [gold-of-pleasure]
gb|AAG60153.1|AC074360_18  lipase, putative                             129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     129   1e-31   
dbj|BAD95190.1|  hypothetical protein                                   129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031122.1|  GDSL esterase/lipase                               129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540489.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    128   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_010057068.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     129   1e-31   Eucalyptus grandis [rose gum]
ref|NP_001172483.1|  Os01g0649400                                       127   1e-31   
emb|CDO96751.1|  unnamed protein product                                128   1e-31   Coffea canephora [robusta coffee]
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     129   1e-31   
ref|XP_009608031.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    128   1e-31   Nicotiana tomentosiformis
emb|CDY30819.1|  BnaC05g21950D                                          129   1e-31   Brassica napus [oilseed rape]
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    129   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     128   2e-31   Brassica rapa
ref|XP_006367777.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     128   2e-31   
ref|XP_006362447.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     128   2e-31   Solanum tuberosum [potatoes]
ref|XP_004234095.1|  PREDICTED: GDSL esterase/lipase At5g45910          127   2e-31   Solanum lycopersicum
ref|XP_009352808.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     127   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     128   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007148064.1|  hypothetical protein PHAVU_006G177500g             127   3e-31   Phaseolus vulgaris [French bean]
ref|XP_010499707.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    127   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     127   3e-31   
gb|EAY75182.1|  hypothetical protein OsI_03072                          126   4e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like     127   4e-31   Glycine max [soybeans]
ref|XP_010499708.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    127   4e-31   
gb|AAF24548.2|AC007508_11  F1K23.17                                     130   4e-31   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44668.1|  putative lipase                                        127   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180304.1|  GDSL esterase/lipase                                  127   4e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44742.1|  hypothetical protein AALP_AA1G297000                    131   5e-31   Arabis alpina [alpine rockcress]
emb|CDO96755.1|  unnamed protein product                                127   5e-31   Coffea canephora [robusta coffee]
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479    130   5e-31   
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     127   5e-31   Elaeis guineensis
ref|XP_011096420.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    127   5e-31   Sesamum indicum [beniseed]
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    127   6e-31   
ref|NP_174181.1|  GDSL esterase/lipase                                  127   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007025435.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    126   6e-31   
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    127   6e-31   
ref|XP_008777733.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     126   6e-31   Phoenix dactylifera
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     126   6e-31   
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg             126   6e-31   
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                     126   7e-31   Eucalyptus grandis [rose gum]
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550          126   8e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     126   8e-31   Camelina sativa [gold-of-pleasure]
gb|EMT19408.1|  GDSL esterase/lipase                                    125   9e-31   
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078             126   9e-31   
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     126   9e-31   Camelina sativa [gold-of-pleasure]
gb|KCW45467.1|  hypothetical protein EUGRSUZ_L00816                     126   1e-30   Eucalyptus grandis [rose gum]
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                     125   1e-30   Eucalyptus grandis [rose gum]
ref|XP_002879083.1|  predicted protein                                  126   1e-30   
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     125   1e-30   Populus euphratica
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924    129   1e-30   
ref|XP_009765841.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     125   1e-30   Nicotiana sylvestris
ref|XP_008812188.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     125   1e-30   
gb|KEH34273.1|  GDSL-like lipase/acylhydrolase                          125   1e-30   Medicago truncatula
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592    129   1e-30   
gb|KEH34272.1|  GDSL-like lipase/acylhydrolase                          125   2e-30   Medicago truncatula
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     125   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     125   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     125   2e-30   Phoenix dactylifera
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     125   2e-30   Camelina sativa [gold-of-pleasure]
ref|NP_849723.1|  GDSL esterase/lipase                                  125   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     125   2e-30   Camelina sativa [gold-of-pleasure]
ref|NP_564314.1|  GDSL esterase/lipase                                  125   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     125   3e-30   Elaeis guineensis
emb|CDM80951.1|  unnamed protein product                                122   3e-30   Triticum aestivum [Canadian hard winter wheat]
emb|CDM83549.1|  unnamed protein product                                125   3e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     125   3e-30   
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     125   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010460658.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    125   3e-30   Camelina sativa [gold-of-pleasure]
emb|CDO96749.1|  unnamed protein product                                124   4e-30   Coffea canephora [robusta coffee]
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    124   4e-30   Camelina sativa [gold-of-pleasure]
ref|NP_001057786.1|  Os06g0531900                                       124   4e-30   
ref|XP_009415142.1|  PREDICTED: uncharacterized protein LOC103996...    125   4e-30   
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...    124   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase                 124   5e-30   Arabidopsis lyrata subsp. lyrata
gb|EAZ37226.1|  hypothetical protein OsJ_21564                          124   5e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     124   5e-30   Brachypodium distachyon [annual false brome]
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925    127   5e-30   
ref|XP_004233850.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    124   6e-30   Solanum lycopersicum
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     124   6e-30   
gb|EMT27195.1|  GDSL esterase/lipase                                    124   6e-30   
ref|NP_973931.1|  GDSL esterase/lipase                                  122   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     124   7e-30   Camelina sativa [gold-of-pleasure]
emb|CDO96752.1|  unnamed protein product                                124   7e-30   Coffea canephora [robusta coffee]
gb|KCW45468.1|  hypothetical protein EUGRSUZ_L00817                     123   1e-29   Eucalyptus grandis [rose gum]
ref|XP_004491864.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     123   1e-29   Cicer arietinum [garbanzo]
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     123   1e-29   Phoenix dactylifera
ref|XP_010057069.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     123   1e-29   Eucalyptus grandis [rose gum]
gb|KDP21068.1|  hypothetical protein JCGZ_21539                         123   1e-29   Jatropha curcas
emb|CDY64716.1|  BnaCnng44670D                                          123   1e-29   Brassica napus [oilseed rape]
dbj|BAJ98364.1|  predicted protein                                      123   1e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010915606.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     122   1e-29   Elaeis guineensis
ref|XP_008783909.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     122   1e-29   Phoenix dactylifera
emb|CDY63998.1|  BnaA07g36520D                                          123   2e-29   Brassica napus [oilseed rape]
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                     122   2e-29   Eucalyptus grandis [rose gum]
gb|AAX62802.1|  lipase 2                                                122   2e-29   Brassica napus [oilseed rape]
ref|NP_174180.1|  GDSL esterase/lipase                                  122   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ01210.1|  hypothetical protein OsI_23235                          122   2e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_010040115.1|  PREDICTED: uncharacterized protein LOC104428890    125   2e-29   
emb|CDM83548.1|  unnamed protein product                                122   2e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     122   2e-29   
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     122   2e-29   Brassica rapa
ref|XP_002438501.1|  hypothetical protein SORBIDRAFT_10g020950          122   3e-29   Sorghum bicolor [broomcorn]
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     122   3e-29   Brassica rapa
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910          122   3e-29   Prunus mume [ume]
gb|EMT22154.1|  GDSL esterase/lipase                                    122   3e-29   
ref|XP_004248142.1|  PREDICTED: GDSL esterase/lipase At1g28610          122   3e-29   Solanum lycopersicum
ref|XP_009416172.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     122   3e-29   
ref|XP_010478243.1|  PREDICTED: GDSL esterase/lipase At1g28650          122   3e-29   
gb|EEC71187.1|  hypothetical protein OsI_03077                          116   3e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     122   3e-29   Setaria italica
ref|XP_006656143.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     122   4e-29   Oryza brachyantha
ref|XP_006644439.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     122   4e-29   Oryza brachyantha
ref|NP_001168439.1|  uncharacterized protein LOC100382211               120   4e-29   Zea mays [maize]
gb|EEE55087.1|  hypothetical protein OsJ_02829                          116   4e-29   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ86481.1|  predicted protein                                      122   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg             124   4e-29   
ref|XP_010455496.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    122   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002863442.1|  GDSL-motif lipase/hydrolase family protein         121   5e-29   
gb|AAF24544.2|AC007508_7  F1K23.13                                      125   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011096449.1|  PREDICTED: uncharacterized protein LOC105175645    125   5e-29   
ref|XP_010925692.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     121   6e-29   Elaeis guineensis
sp|Q3ZFI4.1|SCE3_BRANA  RecName: Full=Sinapine esterase; Short=Bn...    121   7e-29   Brassica napus [oilseed rape]
ref|XP_002439451.1|  hypothetical protein SORBIDRAFT_09g006600          121   8e-29   Sorghum bicolor [broomcorn]
ref|XP_008655207.1|  PREDICTED: uncharacterized protein LOC100382...    120   9e-29   Zea mays [maize]
emb|CDX90163.1|  BnaA08g18210D                                          120   9e-29   
gb|AFW80395.1|  esterase                                                120   1e-28   
ref|NP_174188.1|  lipase ARAB-1                                         120   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     120   1e-28   Oryza brachyantha
ref|XP_008655208.1|  PREDICTED: uncharacterized protein LOC100382...    120   1e-28   Zea mays [maize]
ref|NP_001150078.1|  esterase                                           120   1e-28   Zea mays [maize]
ref|XP_010052211.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     120   1e-28   Eucalyptus grandis [rose gum]
ref|XP_010499396.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     120   1e-28   Camelina sativa [gold-of-pleasure]
ref|NP_001149156.1|  esterase precursor                                 120   1e-28   
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009601721.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     120   1e-28   Nicotiana tomentosiformis
emb|CDY30822.1|  BnaC05g21980D                                          120   1e-28   Brassica napus [oilseed rape]
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670          120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     120   1e-28   Camelina sativa [gold-of-pleasure]
ref|NP_001042396.1|  Os01g0215700                                       120   1e-28   
dbj|BAA94228.1|  putative esterase                                      120   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein         120   2e-28   
ref|XP_009333827.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     120   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     120   2e-28   
gb|EEE54111.1|  hypothetical protein OsJ_00875                          120   2e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CDY43309.1|  BnaC03g58810D                                          120   2e-28   Brassica napus [oilseed rape]
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   2e-28   Eucalyptus grandis [rose gum]
ref|XP_003569458.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     120   2e-28   Brachypodium distachyon [annual false brome]
gb|KGN49290.1|  hypothetical protein Csa_6G519430                       119   2e-28   
ref|NP_001043721.1|  Os01g0649900                                       119   2e-28   
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   2e-28   Setaria italica
ref|XP_008361146.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    117   2e-28   
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850          119   2e-28   Sorghum bicolor [broomcorn]
ref|XP_010925696.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    119   2e-28   Elaeis guineensis
gb|ACU18341.1|  unknown                                                 116   3e-28   Glycine max [soybeans]
ref|XP_010915608.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   3e-28   Elaeis guineensis
emb|CDY43308.1|  BnaC03g58800D                                          119   3e-28   Brassica napus [oilseed rape]
dbj|BAK06933.1|  predicted protein                                      119   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93079.1|  predicted protein                                      119   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW76151.1|  hypothetical protein EUGRSUZ_D00528                     117   3e-28   Eucalyptus grandis [rose gum]
gb|ACF85857.1|  unknown                                                 119   4e-28   Zea mays [maize]
gb|KJB62810.1|  hypothetical protein B456_009G437600                    119   4e-28   Gossypium raimondii
ref|XP_006603997.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     118   4e-28   Glycine max [soybeans]
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg             119   5e-28   
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   5e-28   Cicer arietinum [garbanzo]
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   5e-28   Eucalyptus grandis [rose gum]
ref|XP_004963464.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   5e-28   Setaria italica
ref|XP_011086014.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     118   6e-28   Sesamum indicum [beniseed]
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     118   6e-28   Phoenix dactylifera
ref|XP_003593742.1|  GDSL esterase/lipase                               118   6e-28   Medicago truncatula
ref|XP_008393854.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     118   7e-28   
emb|CDO96750.1|  unnamed protein product                                118   7e-28   Coffea canephora [robusta coffee]
ref|XP_009411654.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     118   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002893540.1|  predicted protein                                  122   7e-28   
ref|XP_002456052.1|  hypothetical protein SORBIDRAFT_03g029580          118   8e-28   
gb|KJB57433.1|  hypothetical protein B456_009G164000                    118   9e-28   Gossypium raimondii
ref|XP_002317430.2|  hypothetical protein POPTR_0011s07610g             115   9e-28   
gb|KHG23842.1|  hypothetical protein F383_29871                         117   1e-27   Gossypium arboreum [tree cotton]
ref|XP_004134933.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     118   1e-27   Cucumis sativus [cucumbers]
gb|KJB62807.1|  hypothetical protein B456_009G437300                    118   1e-27   Gossypium raimondii
ref|XP_006387672.1|  hypothetical protein POPTR_0686s00200g             113   1e-27   
gb|AAM62801.1|  GDSL-motif lipase/hydrolase-like protein                117   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199403.1|  GDSL esterase/lipase                                  117   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31510.1|  hypothetical protein AALP_AA6G122100                    117   1e-27   Arabis alpina [alpine rockcress]
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     117   1e-27   Eucalyptus grandis [rose gum]
ref|NP_001149136.1|  alpha-L-fucosidase 2 precursor                     117   2e-27   
gb|ACL53525.1|  unknown                                                 117   2e-27   Zea mays [maize]
ref|XP_003593736.1|  GDSL esterase/lipase                               117   2e-27   Medicago truncatula
ref|XP_008654982.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1         117   2e-27   
ref|NP_973930.1|  GDSL esterase/lipase                                  116   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg             117   2e-27   Eutrema salsugineum [saltwater cress]
gb|KHN08453.1|  GDSL esterase/lipase                                    115   2e-27   Glycine soja [wild soybean]
ref|XP_011027711.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     117   2e-27   Populus euphratica
ref|XP_006844515.1|  hypothetical protein AMTR_s00016p00147040          114   2e-27   
ref|XP_007025434.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    117   2e-27   
emb|CDX90162.1|  BnaA08g18220D                                          117   2e-27   
ref|XP_009352806.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     117   2e-27   
gb|KHN34384.1|  GDSL esterase/lipase                                    116   2e-27   Glycine soja [wild soybean]
ref|XP_002461110.1|  hypothetical protein SORBIDRAFT_02g040940          116   3e-27   
ref|NP_174179.3|  GDSL esterase/lipase                                  116   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525626.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     116   3e-27   Glycine max [soybeans]
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280          116   3e-27   Amborella trichopoda
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     116   4e-27   Eucalyptus grandis [rose gum]
ref|NP_001242505.1|  uncharacterized protein LOC100815771 precursor     116   4e-27   Glycine max [soybeans]
emb|CDY08074.1|  BnaA06g16520D                                          116   4e-27   Brassica napus [oilseed rape]
emb|CDY39587.1|  BnaCnng09560D                                          116   4e-27   Brassica napus [oilseed rape]
ref|XP_009149816.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     116   4e-27   Brassica rapa
ref|XP_010250902.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     116   5e-27   
ref|XP_010042460.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     111   5e-27   
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     115   6e-27   
ref|XP_010231604.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     115   6e-27   
gb|KHN14076.1|  GDSL esterase/lipase                                    115   6e-27   
ref|NP_174186.1|  GDSL esterase/lipase                                  115   6e-27   
dbj|BAF02148.1|  putative lipase                                        115   6e-27   
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    115   6e-27   
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    115   6e-27   
ref|XP_003549836.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     115   7e-27   
ref|XP_007155513.1|  hypothetical protein PHAVU_003G208000g             115   7e-27   
ref|XP_007037866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    115   7e-27   
ref|XP_010232088.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    115   7e-27   
ref|NP_174440.2|  GDSL esterase/lipase                                  115   7e-27   
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    115   8e-27   
ref|XP_003569457.2|  PREDICTED: GDSL esterase/lipase At1g28600-li...    115   8e-27   
gb|KJB51165.1|  hypothetical protein B456_008G204600                    115   8e-27   
ref|XP_002455947.1|  hypothetical protein SORBIDRAFT_03g027770          115   8e-27   
gb|EEE62726.1|  hypothetical protein OsJ_17529                          115   9e-27   
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                     115   1e-26   
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     115   1e-26   
ref|NP_001054914.2|  Os05g0210400                                       115   1e-26   
ref|XP_011084056.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     115   1e-26   
emb|CDX77066.1|  BnaC04g38610D                                          115   1e-26   
gb|EMT32479.1|  GDSL esterase/lipase                                    114   1e-26   
ref|XP_009140758.1|  PREDICTED: GDSL esterase/lipase At5g45910          114   1e-26   
emb|CDY48195.1|  BnaA04g15590D                                          115   1e-26   
gb|EEE55085.1|  hypothetical protein OsJ_02827                          114   1e-26   
ref|XP_004971993.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     114   2e-26   
ref|NP_001140937.1|  hypothetical protein                               114   2e-26   
gb|KCW44565.1|  hypothetical protein EUGRSUZ_L01922                     114   2e-26   
ref|XP_006291232.1|  hypothetical protein CARUB_v10017363mg             114   2e-26   
gb|KHG00751.1|  hypothetical protein F383_21550                         114   2e-26   
gb|ACU17921.1|  unknown                                                 114   2e-26   
tpg|DAA58330.1|  TPA: hypothetical protein ZEAMMB73_195608              112   2e-26   
gb|KJB63193.1|  hypothetical protein B456_009G437100                    114   2e-26   
dbj|BAK05475.1|  predicted protein                                      114   2e-26   
ref|XP_009411652.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     114   2e-26   
ref|XP_009411653.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     114   2e-26   
ref|XP_002305753.2|  hypothetical protein POPTR_0004s05350g             114   2e-26   
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910          114   2e-26   
ref|XP_003608902.1|  GDSL esterase/lipase                               114   2e-26   
ref|XP_007217900.1|  hypothetical protein PRUPE_ppa012875mg             109   3e-26   
gb|ADN33970.1|  lipase                                                  113   3e-26   
ref|XP_009150194.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     114   3e-26   
ref|XP_004969326.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     114   3e-26   
ref|XP_010915607.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     113   3e-26   
gb|EAY96955.1|  hypothetical protein OsI_18874                          113   3e-26   
gb|KFK34151.1|  gdsl esterase lipase                                    113   3e-26   
emb|CDY37927.1|  BnaA06g18900D                                          113   3e-26   
gb|EPS71267.1|  hypothetical protein M569_03493                         113   3e-26   
ref|XP_010503477.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     113   4e-26   
ref|XP_004515840.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     113   4e-26   
ref|XP_010515164.1|  PREDICTED: GDSL esterase/lipase At3g48460          113   4e-26   
ref|XP_007020872.1|  SGNH hydrolase-type esterase superfamily pro...    113   4e-26   
ref|XP_010042817.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     109   4e-26   
ref|XP_010915609.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     113   4e-26   
ref|XP_008439284.1|  PREDICTED: GDSL esterase/lipase At3g48460          113   4e-26   
gb|KCW76148.1|  hypothetical protein EUGRSUZ_D00525                     113   4e-26   
gb|ACN28025.1|  unknown                                                 113   4e-26   
ref|XP_010232089.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    113   4e-26   
ref|NP_001149094.1|  LOC100282715 precursor                             113   5e-26   
ref|XP_008783975.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     113   5e-26   
ref|XP_003569463.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    113   5e-26   
ref|XP_008439763.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     113   5e-26   
ref|XP_006404256.1|  hypothetical protein EUTSA_v10010448mg             113   6e-26   
gb|AES91099.2|  GDSL-like lipase/acylhydrolase                          112   6e-26   
ref|NP_190416.1|  GDSL esterase/lipase                                  112   6e-26   
gb|EEC71081.1|  hypothetical protein OsI_02841                          112   6e-26   
gb|EAZ12674.1|  hypothetical protein OsJ_02589                          112   7e-26   
ref|XP_006281867.1|  hypothetical protein CARUB_v10028062mg             110   7e-26   
ref|XP_002875905.1|  GDSL-motif lipase/hydrolase family protein         112   7e-26   
ref|XP_006646093.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     112   7e-26   
ref|XP_004960620.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     112   7e-26   
gb|KHN34100.1|  GDSL esterase/lipase                                    112   8e-26   
ref|NP_174185.2|  GDSL esterase/lipase                                  112   8e-26   
sp|P0C8Z7.1|GDL91_ARATH  RecName: Full=GDSL esterase/lipase At1g2...    112   8e-26   
ref|XP_010915611.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    112   9e-26   
ref|XP_007209226.1|  hypothetical protein PRUPE_ppa006897mg             112   9e-26   
ref|XP_010915610.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    112   9e-26   
ref|XP_009359493.1|  PREDICTED: GDSL esterase/lipase At3g48460          112   1e-25   
ref|XP_004301038.1|  PREDICTED: GDSL esterase/lipase At3g48460          112   1e-25   
ref|XP_002267222.2|  PREDICTED: GDSL esterase/lipase At5g45910          112   1e-25   
ref|XP_010550714.1|  PREDICTED: GDSL esterase/lipase At3g48460          112   1e-25   
ref|XP_003593744.1|  GDSL esterase/lipase                               111   1e-25   
ref|XP_006415634.1|  hypothetical protein EUTSA_v10009717mg             112   1e-25   
ref|XP_010426341.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     112   1e-25   
ref|NP_001130974.1|  uncharacterized protein LOC100192079               112   1e-25   
dbj|BAK01308.1|  predicted protein                                      111   1e-25   
gb|KEH33412.1|  GDSL-like lipase/acylhydrolase                          111   2e-25   
ref|XP_008392856.1|  PREDICTED: GDSL esterase/lipase At3g48460          111   2e-25   
gb|AES71072.2|  GDSL-like lipase/acylhydrolase                          111   2e-25   
ref|XP_006476962.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     111   2e-25   
ref|XP_006440021.1|  hypothetical protein CICLE_v10020570mg             111   2e-25   
gb|KGN49292.1|  hypothetical protein Csa_6G519450                       111   2e-25   
ref|NP_001054913.1|  Os05g0210100                                       111   2e-25   
ref|XP_010495736.1|  PREDICTED: GDSL esterase/lipase At5g45910          111   2e-25   
ref|XP_007148063.1|  hypothetical protein PHAVU_006G177400g             111   2e-25   
dbj|BAJ86410.1|  predicted protein                                      111   2e-25   
ref|XP_008239404.1|  PREDICTED: GDSL esterase/lipase At3g48460          111   3e-25   
ref|XP_004134931.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     110   3e-25   
dbj|BAJ97312.1|  predicted protein                                      111   3e-25   
ref|XP_004152509.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     110   3e-25   
ref|XP_008785278.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     110   3e-25   
ref|XP_003569350.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     110   3e-25   
ref|XP_006651411.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     110   3e-25   
gb|KHN34101.1|  GDSL esterase/lipase                                    110   3e-25   
ref|XP_007148066.1|  hypothetical protein PHAVU_006G177700g             110   3e-25   
emb|CDX77910.1|  BnaC03g53090D                                          110   4e-25   
ref|NP_001050175.1|  Os03g0365800                                       110   4e-25   
gb|EEE59101.1|  hypothetical protein OsJ_10956                          110   4e-25   
gb|EAZ12915.1|  hypothetical protein OsJ_02838                          109   4e-25   
gb|ACF87885.1|  unknown                                                 110   4e-25   
ref|XP_006656658.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     110   4e-25   
ref|XP_011096421.1|  PREDICTED: GDSL esterase/lipase At5g45910          110   4e-25   
ref|NP_001149411.1|  esterase precursor                                 110   5e-25   
ref|XP_003600821.1|  GDSL esterase/lipase                               110   5e-25   
ref|XP_009791093.1|  PREDICTED: GDSL esterase/lipase At3g48460          110   5e-25   
dbj|BAJ90990.1|  predicted protein                                      110   5e-25   
ref|XP_003537084.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     112   5e-25   
emb|CDM83418.1|  unnamed protein product                                110   5e-25   
gb|EAZ35882.1|  hypothetical protein OsJ_20183                          109   5e-25   
ref|XP_009421256.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     110   6e-25   
ref|XP_006655093.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     109   7e-25   
ref|NP_001043718.2|  Os01g0649200                                       105   7e-25   
emb|CAN62554.1|  hypothetical protein VITISV_031355                     109   7e-25   
ref|XP_002274810.1|  PREDICTED: GDSL esterase/lipase At3g48460          109   7e-25   
dbj|BAJ93038.1|  predicted protein                                      105   8e-25   
gb|EAY75193.1|  hypothetical protein OsI_03085                          109   8e-25   
emb|CBI14877.3|  unnamed protein product                                109   9e-25   
ref|XP_010925693.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    109   9e-25   
ref|NP_001050176.1|  Os03g0365900                                       107   9e-25   
gb|KHG30334.1|  hypothetical protein F383_10781                         109   9e-25   
ref|XP_004984286.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     109   9e-25   
ref|NP_001056855.1|  Os06g0156600                                       109   1e-24   
gb|EYU40119.1|  hypothetical protein MIMGU_mgv1a021460mg                109   1e-24   
ref|XP_002439450.1|  hypothetical protein SORBIDRAFT_09g006590          109   1e-24   
ref|XP_004236316.1|  PREDICTED: GDSL esterase/lipase At3g48460          109   1e-24   
ref|XP_008439761.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     109   1e-24   
ref|XP_006828273.1|  hypothetical protein AMTR_s00023p00217880          109   1e-24   
ref|XP_004155631.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    108   1e-24   
gb|EAY90131.1|  hypothetical protein OsI_11697                          109   1e-24   
ref|XP_006646155.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     108   1e-24   
gb|KJB66737.1|  hypothetical protein B456_010G156100                    108   1e-24   
gb|KJB66739.1|  hypothetical protein B456_010G156100                    108   1e-24   
gb|KJB66738.1|  hypothetical protein B456_010G156100                    108   1e-24   
gb|KJB66736.1|  hypothetical protein B456_010G156100                    108   1e-24   
ref|NP_001043728.2|  Os01g0651000                                       105   2e-24   
gb|KHG11244.1|  hypothetical protein F383_11796                         108   2e-24   
ref|XP_010445802.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     108   2e-24   
ref|XP_009414900.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     108   2e-24   
tpg|DAA58326.1|  TPA: hypothetical protein ZEAMMB73_004372              107   2e-24   
ref|XP_006644441.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     107   2e-24   
ref|XP_006844513.1|  hypothetical protein AMTR_s00016p00145970          108   2e-24   
ref|XP_004969330.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    108   2e-24   
ref|XP_003565496.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     108   2e-24   
ref|XP_004964803.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    108   3e-24   
ref|XP_008673015.1|  PREDICTED: alpha-L-fucosidase 2 isoform X2         107   3e-24   
ref|XP_003564307.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     108   3e-24   
ref|XP_004964802.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    108   3e-24   
ref|XP_009596313.1|  PREDICTED: GDSL esterase/lipase At3g48460          108   3e-24   
ref|XP_002321669.1|  GDSL-motif lipase/hydrolase family protein         107   3e-24   
dbj|BAD73016.1|  putative esterase                                      108   3e-24   
gb|KEH38722.1|  GDSL-like lipase/acylhydrolase                          107   3e-24   
ref|NP_001172233.1|  Os01g0216900                                       107   3e-24   
ref|XP_006644440.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     107   3e-24   
ref|XP_002438721.1|  hypothetical protein SORBIDRAFT_10g025020          106   4e-24   
ref|XP_006351456.1|  PREDICTED: GDSL esterase/lipase At3g48460-like     107   4e-24   
gb|KEH17248.1|  GDSL-like lipase/acylhydrolase                          107   4e-24   
ref|NP_001151904.1|  alpha-L-fucosidase 2 precursor                     107   4e-24   
ref|XP_003635688.1|  GDSL esterase/lipase                               107   4e-24   
ref|XP_010026792.1|  PREDICTED: GDSL esterase/lipase At3g48460          107   5e-24   
gb|KJB62806.1|  hypothetical protein B456_009G437200                    107   5e-24   
dbj|BAD61220.1|  lanatoside 15'-O-acetylesterase-like                   107   5e-24   
ref|XP_006853138.1|  hypothetical protein AMTR_s00038p00165200          109   6e-24   
gb|EMT33597.1|  GDSL esterase/lipase                                    107   6e-24   
gb|EMT30557.1|  GDSL esterase/lipase                                    107   6e-24   
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like     107   6e-24   
gb|EAZ27028.1|  hypothetical protein OsJ_10957                          107   6e-24   
ref|XP_008383648.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     107   6e-24   
ref|XP_011024095.1|  PREDICTED: GDSL esterase/lipase At3g48460          107   7e-24   
gb|EMT23758.1|  GDSL esterase/lipase                                    107   8e-24   
gb|KEH33577.1|  GDSL-like lipase/acylhydrolase                          106   8e-24   
ref|XP_004510075.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     106   8e-24   
ref|XP_004516452.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     106   9e-24   
gb|EMT23760.1|  hypothetical protein F775_42456                         105   9e-24   
gb|EAZ12911.1|  hypothetical protein OsJ_02834                          106   9e-24   
dbj|BAJ97605.1|  predicted protein                                      106   1e-23   
ref|XP_011072984.1|  PREDICTED: GDSL esterase/lipase At3g48460          106   1e-23   
ref|XP_008797234.1|  PREDICTED: GDSL esterase/lipase At3g48460          106   1e-23   
ref|XP_004516453.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     106   1e-23   
ref|XP_003568743.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     106   1e-23   
dbj|BAB89203.1|  lipase-like                                            106   1e-23   
ref|XP_004509605.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     106   1e-23   
gb|KEH38721.1|  GDSL-like lipase/acylhydrolase                          105   1e-23   
ref|XP_002456059.1|  hypothetical protein SORBIDRAFT_03g029650          106   1e-23   
ref|XP_004515399.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     106   1e-23   
ref|XP_006844517.1|  hypothetical protein AMTR_s00016p00148320          105   1e-23   
gb|AFW85778.1|  hypothetical protein ZEAMMB73_678347                    105   2e-23   
ref|XP_002437861.1|  hypothetical protein SORBIDRAFT_10g003930          105   2e-23   
emb|CDP15060.1|  unnamed protein product                                105   2e-23   
gb|EMT15617.1|  GDSL esterase/lipase                                    105   2e-23   
gb|ABL11233.1|  UCW116, putative lipase                                 105   2e-23   
ref|XP_008658948.1|  PREDICTED: uncharacterized protein LOC100501...    105   2e-23   
dbj|BAJ90380.1|  predicted protein                                      105   2e-23   
ref|NP_001132224.1|  alpha-L-fucosidase 2 precursor                     105   2e-23   
dbj|BAK06902.1|  predicted protein                                      105   2e-23   
gb|ACG28261.1|  alpha-L-fucosidase 2 precursor                          105   2e-23   
ref|XP_007138099.1|  hypothetical protein PHAVU_009G1802000g            105   3e-23   
dbj|BAJ90120.1|  predicted protein                                      105   3e-23   
ref|XP_006655809.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     104   3e-23   
ref|NP_001242867.1|  uncharacterized protein LOC100794616 precursor     105   4e-23   
gb|AES71053.2|  GDSL-like lipase/acylhydrolase                          105   4e-23   
gb|EEE55083.1|  hypothetical protein OsJ_02823                          105   4e-23   
ref|XP_002453668.1|  hypothetical protein SORBIDRAFT_04g010100          104   4e-23   
ref|XP_009382515.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     104   4e-23   
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     104   4e-23   
ref|XP_002456053.1|  hypothetical protein SORBIDRAFT_03g029590          104   5e-23   
ref|XP_004960619.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     104   5e-23   
gb|ACN30561.1|  unknown                                                 104   5e-23   
ref|XP_008675274.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    104   5e-23   



>ref|XP_009792971.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana sylvestris]
Length=384

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LLQ E+ R+RE +P   IIYADYYNAAM++Y SP K+GF +T+VACCGGGGPYNYD L
Sbjct  262  NQLLQEEIHRIRELHPQANIIYADYYNAAMQIYQSPKKFGFTSTIVACCGGGGPYNYDSL  321

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIF  267
              CGS  S VC+NPSS++SWDG  LTEAAY+WIA GLL+GPYT P+IN  C F
Sbjct  322  ASCGSPLSNVCNNPSSHVSWDGVHLTEAAYRWIAKGLLQGPYTIPKINELCSF  374



>ref|XP_009629822.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=385

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LLQ E+ R+RE +P   +IYADYYNAAM++Y SP K+GF +T+VACCGGGGPYNYD L
Sbjct  263  NQLLQEEIHRIRELHPQANVIYADYYNAAMQIYKSPKKFGFTSTIVACCGGGGPYNYDSL  322

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIF  267
              CGS  S VC+NPSSY+SWDG  LTEAAY+ IA GLL+GPY  P++N  C F
Sbjct  323  AICGSPLSNVCNNPSSYVSWDGVHLTEAAYRLIAKGLLQGPYAIPRMNELCSF  375



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LLQ E+ +LRE +P   IIYADYYNAAM++Y SP K+GF +T+VACCGGGGPYNYD  
Sbjct  265  NQLLQQEIHKLREIHPHANIIYADYYNAAMQIYKSPKKFGFTSTIVACCGGGGPYNYDSK  324

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              CGS SS  CD PSSY+SWDG  LTEAAYK IA+GLL+GPYT PQ+N
Sbjct  325  RPCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAEGLLQGPYTIPQMN  372



>ref|XP_004234096.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum lycopersicum]
Length=380

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LLQ E+ +LRE +P   IIYADYYNAAM++Y SP K+GF +T+VACCGGGG YNYD  
Sbjct  262  NQLLQQEIHKLREIHPHANIIYADYYNAAMQIYRSPKKFGFTSTIVACCGGGGVYNYDSN  321

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              CGS SS  CD PSSY+SWDG  LTEAAYK IA GLL+GPYT PQ+N
Sbjct  322  RPCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAKGLLQGPYTIPQMN  369



>ref|XP_002267261.1| PREDICTED: GDSL esterase/lipase At1g28580 [Vitis vinifera]
Length=375

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N  L+ EL+R+RE YP T IIYADYYNAAMR+Y SP+K+GFK   + ACCGGGGPYNY+ 
Sbjct  250  NEQLKTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGFKRGALTACCGGGGPYNYNS  309

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             V+CG+  +T CD+PS Y+SWDG  LTEAAYKWIA+GLL+ PYT P +N  CI
Sbjct  310  SVECGNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPLNASCI  362



>emb|CBI30663.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N  L+ EL+R+RE YP T IIYADYYNAAMR+Y SP+K+GFK   + ACCGGGGPYNY+ 
Sbjct  250  NEQLKTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGFKRGALTACCGGGGPYNYNS  309

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             V+CG+  +T CD+PS Y+SWDG  LTEAAYKWIA+GLL+ PYT P +N  CI
Sbjct  310  SVECGNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEEPYTFPPLNASCI  362


 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 1/99 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  L+  LD+L  +YP   IIYADYYNAAM L+ +P  +GF N  + ACCGGGGPYN++ 
Sbjct  604  NTHLKLALDKLGLKYPHAKIIYADYYNAAMPLFQAPRSFGFYNGALRACCGGGGPYNFNN  663

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLL  312
               CG   S  C++PSSY +WDG  LTE AYK IA  L+
Sbjct  664  SARCGHIGSKACNDPSSYANWDGIHLTEGAYKIIATCLI  702



>emb|CDP21061.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            NRLLQ EL+R+R+ +P   IIYADYYNAAMRLY SP+KYGF+   + ACCGGGGPYNY+ 
Sbjct  270  NRLLQKELNRIRKLHPHATIIYADYYNAAMRLYRSPNKYGFRGGALKACCGGGGPYNYNS  329

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
             V+CG   +T CD+PS Y+ WDG  LTEAAY+ IA GLL+GP++TP +N  C   S  + 
Sbjct  330  SVECGYPPATSCDDPSLYVCWDGLHLTEAAYQLIAGGLLQGPFSTPPMNTICALASTSSG  389

Query  248  L  246
            L
Sbjct  390  L  390



>ref|XP_009774388.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana sylvestris]
Length=385

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N+LLQ EL RLRE +P   IIYADYYNAAM+LY SPSKYGF K  +V CCGGGGPYN++ 
Sbjct  262  NQLLQRELHRLREIHPHVNIIYADYYNAAMQLYRSPSKYGFLKGGLVTCCGGGGPYNFNP  321

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               CG   +T C++P+ YI+WDG  LTEAAY+W+   LL+GP+T P IN  C F   + +
Sbjct  322  FAPCGDYPATSCEDPNQYINWDGYHLTEAAYRWMTKSLLEGPFTNPPINSVCPFDINEAQ  381

Query  248  LSD  240
            +S 
Sbjct  382  VSQ  384



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N  L  ELD +RE YP   IIYADYYNAAMR+Y SPS+YGF N  + ACCGGGGPYNYD 
Sbjct  265  NDHLVKELDGMRELYPHATIIYADYYNAAMRIYRSPSQYGFTNGALTACCGGGGPYNYDR  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               CG A S  C++PSSY+SWDG  LTEAAY+ IA+GL++GPY  P I   C
Sbjct  325  TAMCGDAGSRTCEDPSSYVSWDGIHLTEAAYRLIAEGLIRGPYAVPSIKHSC  376



>emb|CDO96754.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N++LQ+E++R+RE  P   IIYADYYNAAMRLY  P+KYGFK  V+ ACCG GGPYNY+ 
Sbjct  273  NQVLQSEINRIRELNPHATIIYADYYNAAMRLYRFPNKYGFKGEVLKACCGAGGPYNYNS  332

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             V CG   +  CD+P  Y+SWDG  LTEAAY+WIA GLL+GP++TP IN  C
Sbjct  333  TVPCGYQPAASCDDPPLYVSWDGLHLTEAAYRWIARGLLEGPFSTPPINTVC  384



>ref|XP_006361073.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Solanum tuberosum]
Length=310

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N LLQ EL RLRE +P   IIYADYYNA+M+LY +P KYGF K  ++ACCGGGGPYN++ 
Sbjct  187  NELLQKELHRLRELHPHVNIIYADYYNASMKLYRAPRKYGFLKGVLIACCGGGGPYNFNI  246

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               CG++ +T C++P+ Y++WDG   TEAAY+W+   LL+GP+T P +   C+F   + +
Sbjct  247  SAQCGTSQATSCEDPNQYVNWDGYHFTEAAYRWMTKSLLEGPFTYPPMKNLCLFDVIEAQ  306

Query  248  LSD  240
            +S 
Sbjct  307  ISQ  309



>ref|XP_009607101.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana tomentosiformis]
Length=398

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N+LLQ EL RLRE  P   IIYADYYNAAM+LY +PSKYGF K  +V CCG GGPYN++ 
Sbjct  265  NQLLQRELHRLREINPHVNIIYADYYNAAMQLYRAPSKYGFLKGGLVTCCGAGGPYNFNP  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               CG+  +T C++P+ YI+WDG  LTEAAYKW+   LL+GP+T P IN  C F   + +
Sbjct  325  FAQCGNYPATSCEDPNQYINWDGYHLTEAAYKWMTKSLLEGPFTNPPINSFCPFDISEAQ  384

Query  248  LS  243
            +S
Sbjct  385  VS  386



>emb|CDP21060.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            + LLQ +L+  R+++P   IIYADYYNA ++LY +P +YGF+ T  ACCG GGPYNY+  
Sbjct  115  DELLQTKLNMARKRHPTAAIIYADYYNAILQLYRNPEEYGFRRTTAACCGDGGPYNYNKE  174

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKT  252
            V CG   +TVC +PS YI+WDG   TEAA +WI   LLKGPYT P ++  CI  +  T
Sbjct  175  VQCGDPPTTVCPDPSVYINWDGPHFTEAANRWITSALLKGPYTLPHLDASCISEAAST  232



>ref|XP_003542989.1| PREDICTED: GDSL esterase/lipase At1g28600 [Glycine max]
Length=400

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N LLQ E++RLR  YP T IIYADY+NAA+  YNSP ++GF  N +  CCGGGGPYNY+ 
Sbjct  270  NELLQIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFGGNVLKVCCGGGGPYNYNE  329

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG A    CD+PS Y+SWDG  LTEAAY+W+  GLL GPYT P+ N  C 
Sbjct  330  TAMCGDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCF  382



>ref|XP_004248464.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Solanum 
lycopersicum]
Length=378

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N LLQ EL RLRE +P   IIYADYYNA+M++Y +P KYGF K+ +VACCGGGGPYN++ 
Sbjct  255  NELLQKELHRLRELHPHVNIIYADYYNASMKIYRAPRKYGFLKSVLVACCGGGGPYNFNV  314

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               CG++ +T C++P  Y++WDG   +EAAYKWI   LL+G ++ P +   C+F   + +
Sbjct  315  SAQCGTSQATSCEDPKQYVNWDGYHFSEAAYKWITKSLLEGLFSYPPMKNLCLFDVVEAQ  374

Query  248  LSD  240
            +S 
Sbjct  375  VSQ  377



>gb|KHN08454.1| GDSL esterase/lipase [Glycine soja]
Length=709

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N LLQ E++RLR  YP T IIYADY+NAA+  YNSP ++GF  N +  CCGGGGPYNY+ 
Sbjct  579  NELLQIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFGGNVLKVCCGGGGPYNYNE  638

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG A    CD+PS Y+SWDG  LTEAAY+W+  GLL GPYT P+ N  C 
Sbjct  639  TAMCGDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGPYTIPKFNVSCF  691


 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 76/134 (57%), Gaps = 13/134 (10%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+ LQ+EL RL+  +    IIYADYYNA + LY  P+ +GF N +  CCG GGPYNY+  
Sbjct  258  NQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTN-LKTCCGMGGPYNYNAS  316

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGP----YTTPQINGECI----  270
             DCG      CD+PS +I WDG  LTEAAY+ IA   L       + +P+ + +C+    
Sbjct  317  ADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQDSLTDTGNLYFISPRQSPDCLLPPY  376

Query  269  ----FRSPKTKLSD  240
                F  P  + SD
Sbjct  377  GQTHFHRPNGRCSD  390



>ref|XP_007020868.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOY12393.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 2, partial [Theobroma cacao]
Length=172

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N LLQ ELD++RE +P   IIYADYYN AMR Y+ P ++GF  T+VACCG G PYNY   
Sbjct  49   NELLQQELDQIRELHPHVNIIYADYYNIAMRFYHFPDQFGFTKTIVACCGRGVPYNYSSS  108

Query  425  VDCGSAS-STVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            + CG     T CD+PSSY+SWDG   TEA Y+WI+  +LK  +T P IN  C+
Sbjct  109  MACGDPPLRTSCDDPSSYVSWDGVHFTEATYRWISKAVLKELFTIPYINSLCL  161



>ref|XP_003593737.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63988.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=375

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N LLQ EL +LR  YP T IIYADY+NAA++LY SP +YGF  N    CCGGGGPYNY+ 
Sbjct  260  NELLQTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFKVCCGGGGPYNYND  319

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG++    CD+PS Y+SWDG  LTEAA++W+ + LL+GPYT P+ +  C+
Sbjct  320  SALCGNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPKFSFSCL  372



>gb|AFK42362.1| unknown [Medicago truncatula]
Length=375

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N LLQ EL +LR  YP T IIYADY+NAA++LY SP +YGF  N    CCGGGGPYNY+ 
Sbjct  260  NELLQTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFKVCCGGGGPYNYND  319

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG++    CD+PS Y+SWDG  LTEAA++W+ + LL+GPYT P+ +  C+
Sbjct  320  SALCGNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPKFSFSCL  372



>gb|KHN08455.1| GDSL esterase/lipase [Glycine soja]
Length=182

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDC  417
            LQ+ELD+LR  YP   IIYADYYNAA  LY  P+K+GF +  V CCG GGPYNY+   DC
Sbjct  65   LQSELDKLRGLYPRANIIYADYYNAAFTLYRDPTKFGFTDLKV-CCGMGGPYNYNTTADC  123

Query  416  GSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIF  267
            G+   + CD+PS +I WD   LTEAAY+ IA+GL+KGPY  PQIN  C+ 
Sbjct  124  GNPGVSACDDPSKHIGWDNVHLTEAAYRIIAEGLMKGPYCLPQINTSCLM  173



>ref|XP_007020867.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY12392.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=215

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N LLQ ELD++RE +P   IIYADYYN AMR Y+ P ++GF  T+VACCG G PYNY   
Sbjct  92   NELLQQELDQIRELHPHVNIIYADYYNIAMRFYHFPDQFGFTKTIVACCGRGVPYNYSSS  151

Query  425  VDCGSAS-STVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            + CG     T CD+PSSY+SWDG   TEA Y+WI+  +LK  +T P IN  C+
Sbjct  152  MACGDPPLRTSCDDPSSYVSWDGVHFTEATYRWISKAVLKELFTIPYINSLCL  204



>ref|XP_008358656.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Malus domestica]
Length=208

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N LLQ EL R+R  +P   I YADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+ 
Sbjct  92   NELLQRELSRIRSLHPHVNIXYADYYNAMLQLYQSPDQFGFTGETTKACCGGGGPYNYNS  151

Query  428  LVDCGSASSTV-CDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG+  + V C+NP+ +ISWDG   TEAAY+WIA GLL G YT PQI+  C+
Sbjct  152  SALCGTPEANVLCENPAQFISWDGVHSTEAAYRWIAKGLLNGNYTVPQISTLCV  205



>ref|XP_006467672.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Citrus sinensis]
Length=362

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N +L+ EL +LR++YP   IIYADYY AAMR Y++P  YGF N  V ACCGGGGPYN++ 
Sbjct  254  NTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNN  313

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S  C+NPS++ +WDG  LTEAAY+ +A+GL+ GP+ TP +
Sbjct  314  SARCGHTGSRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPSL  361



>gb|KDO77812.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=286

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N +L+ EL +LR++YP   IIYADYY AAMR Y++P  YGF N  V ACCGGGGPYN++ 
Sbjct  178  NTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNN  237

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S  C+NPS++ +WDG  LTE+AY+ +A+GL+ GP+ TP +
Sbjct  238  SARCGHTGSRACENPSTHANWDGIHLTESAYRHVANGLIHGPFATPSL  285



>ref|NP_973932.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SHP6.2|GDL10_ARATH RecName: Full=GDSL esterase/lipase At1g28610; AltName: Full=Extracellular 
lipase At1g28610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22835.1|AC007508_11 F1K23.16 [Arabidopsis thaliana]
 gb|AEE31002.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 81/122 (66%), Gaps = 1/122 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ EL+RL + YP   IIY DY+NA +RLY  PSK+GF +  + ACCG GGPYN+  
Sbjct  259  NEKLQAELNRLSKLYPHVNIIYGDYFNALLRLYQEPSKFGFMDRPLPACCGLGGPYNFTL  318

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               CGS     C +PS Y++WDG  +TEAAYKWIADGLLKGPYT P  +  C+    K+K
Sbjct  319  SKKCGSVGVKYCSDPSKYVNWDGVHMTEAAYKWIADGLLKGPYTIPSFHWLCLGSKIKSK  378

Query  248  LS  243
             S
Sbjct  379  ES  380



>gb|KFK44741.1| hypothetical protein AALP_AA1G296900 [Arabis alpina]
Length=390

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ ELD+LR  YP   IIY DYYNA +R++  P+K+G  N  + ACCG GGPYN++ 
Sbjct  262  NEHLQAELDKLRNLYPHVTIIYGDYYNALLRIFEDPAKFGLMNRPLPACCGLGGPYNFNF  321

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             + CG+  S  C +PS Y++WDG  LTEAAY+WI++GLLKGPY  P ++  CI
Sbjct  322  SIKCGTRGSEYCSDPSKYVNWDGVHLTEAAYRWISEGLLKGPYAIPHLDMSCI  374



>ref|XP_003542992.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Glycine max]
Length=376

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  LQ+ELD+LR  +P   IIYADYYNAA+ LY  P+K+GF +  + CCG GGPYN++ L
Sbjct  256  NHKLQSELDKLRVFHPRANIIYADYYNAALPLYRDPTKFGFTDLKI-CCGMGGPYNFNKL  314

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRS  261
             +CG+ S   CD+PS +I WDG  LTEAAY++IA GL+KGPY+ PQ +  C FR+
Sbjct  315  TNCGNPSVIACDDPSKHIGWDGVHLTEAAYRFIAKGLIKGPYSLPQFSTLC-FRN  368



>ref|XP_007020866.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY12391.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=789

 Score =   140 bits (352),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/113 (55%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N LLQ ELD++RE +P   IIYADYYN AMR Y+ P ++GF  T+VACCG G PYNY   
Sbjct  299  NELLQQELDQIRELHPHVNIIYADYYNIAMRFYHFPDQFGFTKTIVACCGKGVPYNYSSS  358

Query  425  VDCGSAS-STVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            + CG     T CD+PSSY+SWDG   TEA Y+WI+  +LK  +T P IN  C+
Sbjct  359  MACGDPPLRTSCDDPSSYVSWDGVHFTEATYRWISKAVLKELFTIPYINSLCL  411


 Score =   110 bits (275),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 55/118 (47%), Positives = 78/118 (66%), Gaps = 4/118 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV--ACCGGGGPYNYD  432
            N+LLQ EL R++E +P   I YADYY+AA+R Y SP ++GF+      ACCGGGGPYN++
Sbjct  663  NQLLQEELARIQEIHPHVNIFYADYYSAAIRFYLSPKQFGFRKETQRKACCGGGGPYNFN  722

Query  431  GLVDCG-SASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRS  261
                CG    ++ CD+PSSY+SWDG   TEAA + ++  +L G +T   I+   +F+S
Sbjct  723  LSAVCGYPLVTSCCDDPSSYVSWDGIHYTEAANRLLSRAILDGLHTNFPISNS-LFQS  779



>gb|KDO77809.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=362

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N +L+ EL +LR++YP   IIYADYY AAMR Y++P  YGF N  V ACCGGGGPYN++ 
Sbjct  254  NTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNN  313

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S  C+NPS++ +WDG  LTE+AY+ +A+GL+ GP+ TP +
Sbjct  314  SARCGHTGSRACENPSTHANWDGIHLTESAYRHVANGLIHGPFATPSL  361



>ref|XP_006449476.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
 gb|ESR62716.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
Length=362

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N +L+ +L +LR++YP   IIYADYY AAMR Y++P  YGF N  V ACCGGGGPYN++ 
Sbjct  254  NTMLKAQLHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVKACCGGGGPYNFNN  313

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S  C+NPS++ +WDG  LTEAAY+ +A+GL+ GP+ TP +
Sbjct  314  SARCGHTGSRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPSL  361



>ref|XP_010911731.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Elaeis guineensis]
Length=226

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLL +ELD+LR  YP+  IIYADYY A + +Y SP ++GF+    ACCGGGGP N    
Sbjct  92   NRLLLDELDKLRHLYPNATIIYADYYKALLSIYRSPREFGFEKPFDACCGGGGPNN--SA  149

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            V CG    TVC +PS Y+SWDG  LTEAAY+ IA GLL+G YTTP +N  C
Sbjct  150  VPCGDPGFTVCSDPSKYVSWDGLHLTEAAYREIALGLLQGSYTTPSMNQVC  200



>ref|XP_004485879.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Cicer arietinum]
Length=383

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N LLQ EL+RLR  YP T IIYADY+NAA++ Y SP ++GF +N +  CCGGGGPYN++ 
Sbjct  257  NELLQFELNRLRVLYPFTNIIYADYFNAALQFYKSPEQFGFERNALQVCCGGGGPYNFND  316

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG+     CD+ S Y+SWDG  LTEAAY+W+A  LL G YT P+ +  C+
Sbjct  317  TALCGNLEVIACDDTSKYVSWDGYHLTEAAYRWMAMSLLDGQYTIPKFSLSCL  369



>ref|XP_010912598.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=410

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LLQNELDR+R  +P   IIYADYY A M ++ SP K+GF+    ACCGGGGP N    
Sbjct  276  NQLLQNELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGFEKPFDACCGGGGPNN--CA  333

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            + CG    TVC +PS Y+SWDGS LTEAAY+ IA GLL+G YTTP ++  C
Sbjct  334  IQCGDPGFTVCSDPSKYVSWDGSHLTEAAYRAIALGLLQGSYTTPSMSRAC  384



>emb|CDO96753.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 80/112 (71%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N+LL  E++R+RE  P   I+YADYYNAAM LY SP KYGFK   + ACCG GGPYNY+ 
Sbjct  282  NKLLLTEINRIRELNPHALIVYADYYNAAMTLYRSPQKYGFKAGALKACCGAGGPYNYNA  341

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               CG   +T CD+PS Y++WDG  LTEAAY++IA  LL+GPY+  +IN  C
Sbjct  342  SAPCGYPPATSCDDPSLYVAWDGLHLTEAAYRFIARRLLQGPYSGLRINRFC  393



>ref|NP_001241470.1| uncharacterized protein LOC100816865 [Glycine max]
 gb|ACU18909.1| unknown [Glycine max]
 gb|KHN18922.1| GDSL esterase/lipase [Glycine soja]
Length=386

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  LQ+ELD+LR  YP   IIYADY+NAA+  Y  P+K+GF    V CCG GGPYNY+  
Sbjct  266  NNELQSELDKLRRLYPRANIIYADYFNAALLFYRDPTKFGFTGLKV-CCGMGGPYNYNTS  324

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             DCG+   + CD+PS +I WD   LTEAAY+ +A+GL+KGPY  PQIN  C+
Sbjct  325  ADCGNPGVSACDDPSKHIGWDSVHLTEAAYRIVAEGLIKGPYCLPQINTLCL  376



>ref|XP_008785390.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=364

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N LL+  LD LR +YP   I+YADYY A+  +  SP  +GF +N  VACCGG GPYN+  
Sbjct  257  NALLRRALDELRRKYPRARIMYADYYGASNPISRSPQHFGFGRNIFVACCGGDGPYNFSP  316

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
            L  CG  SSTVC +PSSY++WDG  LTEAAY +IA GLL+GPYTTP +
Sbjct  317  LALCGQPSSTVCSHPSSYVNWDGFHLTEAAYHFIATGLLEGPYTTPPL  364



>ref|XP_008777731.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=396

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 0/116 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N LLQ ELDRLR  +P   IIYA+YY+AAM +Y  P KYGF   + ACCGGGGPYN++  
Sbjct  272  NSLLQTELDRLRRLHPRITIIYANYYDAAMDIYRHPLKYGFDAPLAACCGGGGPYNFNLT  331

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSP  258
              CG+   TVC +PS ++ WDG  LT+AAY+ IA GLL+G Y +  I   C+   P
Sbjct  332  AMCGAREDTVCSDPSKHVCWDGMHLTDAAYEIIARGLLQGSYASAPITQACLLLEP  387



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N LLQNELDRLR  +P   IIYADYY A M +++SP K+GFK   + ACCGGGGPYN + 
Sbjct  276  NHLLQNELDRLRRLHPHVTIIYADYYEALMSIFHSPQKFGFKKAPLDACCGGGGPYNVNF  335

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             + CG+  +TVC +PS ++ WDG+ LT+AA + +A GLL+GPY  P I   C
Sbjct  336  SLLCGAPMTTVCRDPSMFVFWDGTHLTDAASEIVARGLLEGPYADPPIIQTC  387



>ref|XP_010912648.1| PREDICTED: sinapine esterase-like isoform X3 [Elaeis guineensis]
Length=370

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            NRLL +ELD L++ +P   IIYADYY A + ++ SP+++GFK   + ACCGGGGPYN   
Sbjct  247  NRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNIS-  305

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             V CG  ++TVC++PS+Y+ WDG  LTEAAY+ IA GLL+GP+T P I   C
Sbjct  306  -VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  356



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N  LQ EL R+R  +P   I+YADYYNA ++LY SP ++GF   T  ACCGGGGPYN++ 
Sbjct  265  NEQLQIELSRIRRLHPQVTIVYADYYNALLQLYQSPRQFGFTGETSKACCGGGGPYNFNS  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             V CG+A +TVC+NPS +I+WDG   TEAAY+ +   LL+G YT P++   C+
Sbjct  325  SVQCGNAGATVCENPSQFINWDGMHCTEAAYRLMTKALLQGNYTFPRLASLCV  377



>ref|XP_010912632.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            NRLL +ELD L++ +P   IIYADYY A + ++ SP+++GFK   + ACCGGGGPYN   
Sbjct  275  NRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNIS-  333

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             V CG  ++TVC++PS+Y+ WDG  LTEAAY+ IA GLL+GP+T P I   C
Sbjct  334  -VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  384



>ref|XP_010912640.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X2 [Elaeis 
guineensis]
Length=386

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            NRLL +ELD L++ +P   IIYADYY A + ++ SP+++GFK   + ACCGGGGPYN   
Sbjct  263  NRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGFKKAPLAACCGGGGPYNIS-  321

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             V CG  ++TVC++PS+Y+ WDG  LTEAAY+ IA GLL+GP+T P I   C
Sbjct  322  -VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEGPHTAPPITQAC  372



>gb|EYU28060.1| hypothetical protein MIMGU_mgv1a008085mg [Erythranthe guttata]
Length=385

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = -1

Query  605  NRLLQNELDRLREQY-PDTX-IIYADYYNAAMRLYNSPSKYGF--KNTVVACCGGGGPYN  438
            N+LL+ EL+R++E   PD   IIYADYYNAAMR Y SP++YG   K  + ACCG GGPYN
Sbjct  264  NKLLKKELNRIQELINPDQIDIIYADYYNAAMRFYLSPNEYGLSKKGILRACCGAGGPYN  323

Query  437  YDGLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
            Y+   +CGS+ +T CD+PSS+ SWDG   TEAAY+ IA GL  GPYTTP++ 
Sbjct  324  YNASAECGSSPATCCDDPSSFASWDGLHFTEAAYRLIAQGLFDGPYTTPRVK  375



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ EL+RL+E YP   IIYADYYNA +RL+  P+K+GF N  + ACCG GG YN++ 
Sbjct  684  NEQLQKELNRLKELYPHVNIIYADYYNALLRLFPEPAKFGFMNRPLPACCGLGGSYNFNF  743

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CGS     C++PS Y++WDG  +TEAAY+WI++GLLKGPY  P  N  C+
Sbjct  744  SRRCGSVGVEYCNDPSKYVNWDGIHMTEAAYRWISEGLLKGPYAIPTFNWSCL  796


 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ EL+RLR+  P   IIYADYYNA +RL+  P+K+GF +  + ACCG GG YN++    
Sbjct  262  LKTELNRLRKLNPHVNIIYADYYNALLRLFKEPAKFGFMDRPLHACCGIGGQYNFNFTRK  321

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  243
            CGS     C +PS Y+ WDG  +TE AYKWIADG+LKGPY  P     C+    K K S
Sbjct  322  CGSVGVESCKDPSKYVGWDGVHMTEGAYKWIADGILKGPYAIPPFGRSCLRSEIKNKES  380



>ref|XP_010478618.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  420
            LQ EL RLR+  P   II+ADYYN  +RL   PSKYGF K  + ACCG GGPYN++    
Sbjct  268  LQAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGFTKEPLYACCGVGGPYNFNFNTK  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C++PS Y++WDG  +TEAAYK +ADGLLKGPY TP  N  C+    K K
Sbjct  328  CGSVEVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKGPYATPPFNWSCLSSKIKNK  384



>ref|XP_010422035.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=382

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            LQ EL RLR+  P   IIYADYYNA +RL   P+KYGF N  + ACCG G PYN++    
Sbjct  254  LQAELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFINKPLSACCGVGEPYNFNFSTC  313

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C++PS Y++WDG  +TEAAYK+IADGLLKGPYT+P  N  C+    K K
Sbjct  314  CGSFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSPPFNWTCLTSKIKNK  370



>ref|XP_009784633.1| PREDICTED: GDSL esterase/lipase At5g45910 [Nicotiana sylvestris]
Length=366

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L+  L++LRE+YP   IIYADYY AA R +++P  YGF NT+VACCGGGGPYN++  
Sbjct  252  NSQLKLSLEKLREEYPHAKIIYADYYGAAKRFFHAPKHYGFSNTLVACCGGGGPYNFNNS  311

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG   S  C + S + +WDG  LTEAAY  IA GLL GP+T+P +
Sbjct  312  ARCGHIGSKACLDSSKFANWDGIHLTEAAYHHIAKGLLNGPFTSPPL  358



>ref|XP_010422034.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            LQ EL RLR+  P   IIYADYYNA +RL   P+KYGF N  + ACCG G PYN++    
Sbjct  268  LQAELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFINKPLSACCGVGEPYNFNFSTC  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C++PS Y++WDG  +TEAAYK+IADGLLKGPYT+P  N  C+    K K
Sbjct  328  CGSFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGPYTSPPFNWTCLTSKIKNK  384



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ ELDRLR+ YP   IIYADYYNA  R++  P+K+GF N  + ACCG GG YNY  
Sbjct  261  NEQLQAELDRLRKMYPHVNIIYADYYNALSRIFQEPAKFGFMNRPLPACCGLGGQYNYTP  320

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG      CD+PS Y++WDG  +TEAAY+ IA+GLLKGPY  P  N  C+
Sbjct  321  GKKCGFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCL  373



>ref|XP_009347996.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Pyrus x bretschneideri]
Length=376

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL+R+R  +P   IIYADYYNA M LY+SP ++GF   T  ACCGGGG YNY+ 
Sbjct  261  NEQLQTELNRIRSLHPHVNIIYADYYNAMMYLYHSPEQFGFIGGTPKACCGGGGTYNYNS  320

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG   ++ C NP  +ISWDG   TEAAYKWI + LLKG YT P I+  C+
Sbjct  321  SAQCGMRQASACQNPEEFISWDGIHFTEAAYKWITNALLKGNYTDPCISSLCV  373



>ref|XP_009401628.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLLQ+ELDRLR+ +P   IIYA+YY+A +  + +P  +GFK  + ACCG  GPY  +  
Sbjct  258  NRLLQDELDRLRKLHPHVTIIYANYYDATISFFRAPQLFGFKAPLHACCGSDGPYGVNRF  317

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRS  261
            V CG   +TVC +PSS ISWDG  LTEAAY+ IA  LL+GP+  P I   C  RS
Sbjct  318  VQCGHKDATVCSDPSSSISWDGIHLTEAAYETIARSLLEGPHAKPPITRACPQRS  372



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ ELDRLR+ YP   IIYADYYNA  R++  P+K+GF N  + ACCG GG YNY  
Sbjct  261  NEQLQAELDRLRKLYPHVNIIYADYYNALSRIFQEPAKFGFMNRPLPACCGLGGQYNYTP  320

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG      CD+PS Y++WDG  +TEAAY+ IA+GLLKGPY  P  N  C+
Sbjct  321  GKKCGFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCL  373



>gb|AAM65183.1| lipase, putative [Arabidopsis thaliana]
Length=393

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVD  420
            L+ EL+RLR+ YP   IIYADYYN+ +R++  P+K+GF +    ACCG GGPYN++    
Sbjct  262  LKAELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMDRPFPACCGIGGPYNFNFTRK  321

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CGS     C +PS Y+ WDG  +TEAAYKWIADG+L GPY  P  +  C+
Sbjct  322  CGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCL  371



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ ELDRLR+ YP   IIYADYYNA  RL+  P+KYGF N  + ACCG GG YNY  
Sbjct  267  NEQLQAELDRLRKLYPHVNIIYADYYNALARLFQEPAKYGFMNRPLPACCGFGGQYNYTP  326

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG      C +PS Y++WDG  +TEAAY+ IA+GLLKGPY  P  N  C+
Sbjct  327  GKKCGFEGVDYCKDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVIPPFNWSCL  379



>ref|NP_174182.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q94F40.1|GDL9_ARATH RecName: Full=GDSL esterase/lipase At1g28600; AltName: Full=Extracellular 
lipase At1g28600; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK60329.1|AF385739_1 At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AAM91505.1| At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AEE30999.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=393

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  420
            L+ EL+RLR+ YP   IIYADYYN+ +R++  P+K+GF +    ACCG GGPYN++    
Sbjct  262  LKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMERPFPACCGIGGPYNFNFTRK  321

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CGS     C +PS Y+ WDG  +TEAAYKWIADG+L GPY  P  +  C+
Sbjct  322  CGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCL  371



>ref|XP_009352954.1| PREDICTED: uncharacterized protein LOC103944252 [Pyrus x bretschneideri]
Length=1005

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N LLQ EL R+R  +P   IIYADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+ 
Sbjct  250  NELLQRELSRIRILHPYVNIIYADYYNAMLQLYQSPDQFGFTGETTKACCGGGGPYNYNS  309

Query  428  LVDCGSASSTV-CDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CGS  + V C+NP+ +ISWDG   TEAAY+WIA GLL G YT PQI
Sbjct  310  SALCGSPEANVLCENPAQFISWDGVHSTEAAYRWIAKGLLNGNYTVPQI  358


 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N LLQ EL R++  +P   IIYADYYNA + L+ SP ++GF   T  ACCGGGGPYNY+ 
Sbjct  715  NELLQIELRRIQSLHPHVNIIYADYYNAMLELHQSPDQFGFTGETTKACCGGGGPYNYNS  774

Query  428  LVDCGSASSTV-CDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG+  + V C+NP+ +ISWDG   TEAAY+WIA GLL   YT PQI+  C+
Sbjct  775  SALCGTPEANVLCENPAQFISWDGLHSTEAAYRWIAKGLLNRNYTVPQISALCV  828


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  467  ACCGGGGPYNYDGLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKG  306
            ACCGGG PYN++    CG   ST C +PSSY++WDG  LTEAAY++IA GL+ G
Sbjct  367  ACCGGGEPYNFNNSARCGHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHG  420



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N  LQ EL R+R  +P   I+YADYYNA ++LY SP ++GF   T  ACCGGGGPYN++ 
Sbjct  278  NEQLQIELSRIRRLHPQVTIVYADYYNALLQLYQSPHQFGFTGETSKACCGGGGPYNFNP  337

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             + CG+A +TVC+NPS +I+WDG   TEAAY+ +   LL+G YT P++   C+
Sbjct  338  SLQCGNAGATVCENPSQFINWDGMHSTEAAYRLMTKALLQGNYTFPRLASLCV  390



>ref|XP_004291631.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 3/117 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL R++  +P+  IIYADYYNA M  Y+SP ++GF   TV ACCGGGGPYNY+ 
Sbjct  268  NDQLQIELSRIQRLHPNINIIYADYYNAVMHFYHSPDQFGFIGGTVKACCGGGGPYNYNS  327

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQING--ECIFR  264
               CGS  ++ C+NP+ +I+WDG   TEAAY+WI   L KG Y  P I+    C+F 
Sbjct  328  SAQCGSIEASACENPAEFINWDGIHFTEAAYRWIVKVLFKGKYNVPGISRLVPCVFH  384



>ref|XP_009113643.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Brassica 
rapa]
Length=386

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ EL+RLR+ YP   IIY DYYNA +RL   P+K+G  N  +  CCG GG YNY  
Sbjct  262  NEQLQAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGLMNNPLPVCCGLGGRYNYTF  321

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
             V CG      C++PS Y++WDG  +TEAAYKWIA+GLLKGPY TP  +  C+    K K
Sbjct  322  GVKCGLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKGPYATPPFDWSCLSSEIKDK  381

Query  248  LS  243
             S
Sbjct  382  ES  383



>gb|EEE55084.1| hypothetical protein OsJ_02825 [Oryza sativa Japonica Group]
Length=254

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LL +EL+ LR+ +PD  IIY DYY AAM ++ SP ++G ++ +VACCGGGGPY     
Sbjct  123  NKLLIDELENLRKLHPDVAIIYTDYYGAAMEIFLSPEQFGIEDPLVACCGGGGPYGVSAS  182

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG     VCD+PS Y SWDG   +EAAYK IA GLL+GPYT P I
Sbjct  183  AGCGYGEYKVCDDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  229



>ref|XP_009113642.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X1 [Brassica 
rapa]
 emb|CDY34089.1| BnaA09g27150D [Brassica napus]
Length=389

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 78/122 (64%), Gaps = 1/122 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ EL+RLR+ YP   IIY DYYNA +RL   P+K+G  N  +  CCG GG YNY  
Sbjct  265  NEQLQAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGLMNNPLPVCCGLGGRYNYTF  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
             V CG      C++PS Y++WDG  +TEAAYKWIA+GLLKGPY TP  +  C+    K K
Sbjct  325  GVKCGLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKGPYATPPFDWSCLSSEIKDK  384

Query  248  LS  243
             S
Sbjct  385  ES  386



>ref|XP_008371712.1| PREDICTED: GDSL esterase/lipase At1g28600-like, partial [Malus 
domestica]
Length=434

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL R+R  +P   IIYADYYNA M L +SP ++GF   +  ACCGGGG YNY+ 
Sbjct  319  NEQLQTELSRIRSLHPHVNIIYADYYNAMMYLXHSPEQFGFIGGSPKACCGGGGTYNYNS  378

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG   ++ C+NP+ +ISWDG   TEAAYKWI + LLKG YT P+I+  C+
Sbjct  379  SAQCGMRQASACENPAEFISWDGIHFTEAAYKWITNALLKGNYTDPRISSLCV  431



>ref|XP_010540491.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X3 [Tarenaya 
hassleriana]
Length=321

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVA-CCGGGGPYNYDG  429
            N  LQ EL+RLR+ YP   I+YADYYN  +RL+  P ++GF N  ++ CCG GGPYNY  
Sbjct  193  NERLQIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMNRPLSVCCGAGGPYNYSP  252

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG      CDNPS Y++WDG  LTE AY+WIA GLLKGPY  P  N  C 
Sbjct  253  SRLCGDGVP-YCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYCF  304



>ref|XP_009608032.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X2 [Nicotiana 
tomentosiformis]
Length=340

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L+  L++LRE+YP   IIYADYY AA RL+++P  YGF NT+VACCGGGGPYN++  
Sbjct  226  NSQLKLSLEKLREEYPHAKIIYADYYGAAKRLFHAPKHYGFFNTLVACCGGGGPYNFNNS  285

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG   S  C + S + +WDG  LTEAAY  IA GLL G +T+P +
Sbjct  286  ARCGHIGSKACLDSSKFANWDGIHLTEAAYHHIAKGLLNGLFTSPPL  332



>ref|XP_008783908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=413

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 1/106 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            NRLL+  LD+LR +YP   + YADYY AA+RL ++P +YGF N  + ACCGGGGPYN++ 
Sbjct  255  NRLLRRSLDQLRIKYPRLRLTYADYYGAAIRLASNPKRYGFSNGALRACCGGGGPYNFNS  314

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTP  291
             V CG   STVC +PS+Y+SWD   LTEAAY  +A GLL+GPY  P
Sbjct  315  TVFCGQPGSTVCKDPSTYVSWDSIHLTEAAYHSMAMGLLQGPYADP  360



>gb|AAL86351.1| putative lipase [Arabidopsis thaliana]
Length=243

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N+ LQ EL+ LR+ YP   IIYADYYNA +RL+  P+K+GF N  + ACCG GG YN++ 
Sbjct  105  NKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNF  164

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               CGS     CD+PS Y+++DG  +TEAAY+ I++GLLKGPY  P     C+      K
Sbjct  165  SRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCLSSEIMNK  224

Query  248  LS  243
            +S
Sbjct  225  MS  226



>emb|CDO99485.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGP-YNYD  432
            N LLQ EL+ +R  +PD  I+YADY+N  M+L+ SP + GF   +++ACCG GGP YNY+
Sbjct  270  NELLQEELNGVRANHPDALILYADYFNPLMQLFRSPEQNGFGGRSLMACCGDGGPPYNYN  329

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
                CG  +ST C  PS YISWDG  LTEAAY+++A GLL+GPYTTP+IN  C
Sbjct  330  FSAQCGEPASTACAWPSLYISWDGIHLTEAAYRFMAKGLLEGPYTTPRINPLC  382



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 5/122 (4%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL RL++ +P   IIYADYY A+M ++++P+ +GF +  +VACCGGGGPYNY+ 
Sbjct  283  NGRLQAELRRLQQLHPHATIIYADYYGASMSIFSNPNAFGFGEEPLVACCGGGGPYNYNF  342

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               CGS  STVC +PS Y+ WDG  +TEA Y+ IA GLL GP+  P I   C    P  +
Sbjct  343  SRQCGSEGSTVCGDPSRYVHWDGLHMTEATYRSIASGLLHGPFAAPAIGSTC----PNIQ  398

Query  248  LS  243
            LS
Sbjct  399  LS  400



>ref|XP_004485878.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Cicer arietinum]
Length=390

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+ LQ E+ RLR  +PD  IIYADYYNA + LY+ P+KYGF   + ACCG GGPYNY+  
Sbjct  268  NQKLQYEIHRLRGIHPDANIIYADYYNAVLPLYHYPTKYGFTG-LKACCGIGGPYNYNTS  326

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
              CG      C++PS YI WDG  LTEAAYK IADGL+ GPY  PQ +  C 
Sbjct  327  KACGDPDVIACEDPSQYIGWDGIHLTEAAYKLIADGLINGPYCVPQFSNLCF  378



>ref|XP_003593740.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63991.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=387

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+ LQ+E+ RLR  +P   IIYADYYNAA+ LY  P KYGF    V CCG G PYNY+  
Sbjct  263  NQKLQHEIHRLRVIHPHANIIYADYYNAALPLYRYPKKYGFTGLKV-CCGIGSPYNYNAS  321

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIF  267
              CG      CD+PS YI+WDG   TEAAY+ IA+GL+KGPY+ PQ++  C  
Sbjct  322  NMCGKPGVPACDDPSQYITWDGVHFTEAAYRLIANGLIKGPYSVPQLSNLCFM  374



>gb|EMT22799.1| GDSL esterase/lipase [Aegilops tauschii]
Length=445

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LL +EL++LR+ +P   IIYADYY AAM ++ SPS++G KN +VACCG  GPY     
Sbjct  314  NKLLVDELEKLRKLHPSVSIIYADYYGAAMEIFVSPSQFGIKNPLVACCGVEGPYGVSIT  373

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG     VCDNP  Y SWDG   TE +YK IADGLL+GPYT P I
Sbjct  374  TKCGHGEYKVCDNPQKYASWDGLHPTETSYKAIADGLLRGPYTQPPI  420



>ref|XP_008225217.1| PREDICTED: uncharacterized protein LOC103324878 [Prunus mume]
Length=885

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL R+R  +P   IIYADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+ 
Sbjct  770  NDQLQIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNA  829

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               CG A ++VC+NP+ +ISWDG   TEAAY+WI   +L+G YT P+++  C
Sbjct  830  SALCGDAGASVCENPAQFISWDGLHSTEAAYRWITKAILQGNYTVPRVSTLC  881


 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 80/126 (63%), Gaps = 7/126 (6%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL R+R  +P   IIYADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+ 
Sbjct  268  NDQLQIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNT  327

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKW----IADGLLKGPYTTPQINGECIF-R  264
               CG A ++VC+NP+ +ISWDG   TEAAY +     AD  LKG    P +  EC F +
Sbjct  328  SALCGDAGASVCENPAQFISWDGLHSTEAAYSYAGAIFADACLKGLNGVPDVV-ECSFVQ  386

Query  263  SPKTKL  246
            S  T+L
Sbjct  387  SSVTEL  392



>ref|XP_010460977.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=180

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            LQ E+ RLR+  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     
Sbjct  53   LQVEIKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGRPYNFSFSQS  112

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C++PS Y++WDG  +TEAAYK +ADGLLKGPY TP  N  C+    K K
Sbjct  113  CGSVGVESCNDPSKYVAWDGIHMTEAAYKLMADGLLKGPYATPPFNWSCLSSKIKNK  169



>gb|AAG60153.1|AC074360_18 lipase, putative [Arabidopsis thaliana]
Length=391

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            LQ EL+RLR+  P   IIYADYYNA++RL   PSKYGF N  + ACCG GGPYN++    
Sbjct  264  LQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCGVGGPYNFNLSRS  323

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C +PS Y++WDG  +TEAA+K +ADGL+KGPY  P  +  C+    K K
Sbjct  324  CGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWSCLSSMIKKK  380



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            NRL+  ELDRLR  +P   II+A+YY+A M ++ SP ++GFK + + ACCGG GPYN + 
Sbjct  278  NRLISEELDRLRRLHPHATIIHANYYDALMSIFRSPQQFGFKKSPLDACCGGDGPYNMNI  337

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             + CG   +TVC +P+ ++ WDG+ LTEAAY+ I+ GLL+GPY TP I   C
Sbjct  338  SLRCGDPKTTVCRDPAKFVFWDGTHLTEAAYEVISRGLLEGPYATPSIIQTC  389



>dbj|BAD95190.1| hypothetical protein [Arabidopsis thaliana]
Length=394

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            LQ EL+RLR+  P   IIYADYYNA++RL   PSKYGF N  + ACCG GGPYN++    
Sbjct  267  LQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCGVGGPYNFNLSRS  326

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C +PS Y++WDG  +TEAA+K +ADGL+KGPY  P  +  C+    K K
Sbjct  327  CGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWSCLSSMIKKK  383



>ref|NP_001031122.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C857.1|GDL16_ARATH RecName: Full=GDSL esterase/lipase At1g31550; AltName: Full=Extracellular 
lipase At1g31550; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51269.1|AC027135_10 unknown protein [Arabidopsis thaliana]
 gb|AEE31372.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            LQ EL+RLR+  P   IIYADYYNA++RL   PSKYGF N  + ACCG GGPYN++    
Sbjct  267  LQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCGVGGPYNFNLSRS  326

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C +PS Y++WDG  +TEAA+K +ADGL+KGPY  P  +  C+    K K
Sbjct  327  CGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAIPPFDWSCLSSMIKKK  383



>ref|XP_010540489.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Tarenaya 
hassleriana]
Length=366

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVA-CCGGGGPYNYDG  429
            N  LQ EL+RLR+ YP   I+YADYYN  +RL+  P ++GF N  ++ CCG GGPYNY  
Sbjct  238  NERLQIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMNRPLSVCCGAGGPYNYSP  297

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG      CDNPS Y++WDG  LTE AY+WIA GLLKGPY  P  N  C 
Sbjct  298  SRLCGDGVP-YCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYCF  349



>ref|XP_010057068.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Eucalyptus grandis]
 gb|KCW74054.1| hypothetical protein EUGRSUZ_E02674 [Eucalyptus grandis]
Length=402

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 83/123 (67%), Gaps = 6/123 (5%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ +LD LRE +P T IIY DYYNAA+R + SP+K+GF+  V  ACCGGGG +NY+ 
Sbjct  267  NEQLQLKLDHLRELHPRTKIIYVDYYNAAIRFFQSPNKFGFEGQVFRACCGGGGTHNYNS  326

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               C S+++ VCD+PSSY SWDG   TEAAY+WI   +  GP+T P+++  C    P   
Sbjct  327  SALC-SSNTKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGPFTVPKLDISC----PSLA  381

Query  248  LSD  240
            LS+
Sbjct  382  LSE  384



>ref|NP_001172483.1| Os01g0649400 [Oryza sativa Japonica Group]
 dbj|BAH91213.1| Os01g0649400 [Oryza sativa Japonica Group]
Length=306

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LL +EL+ LR+ +PD  IIY DYY AAM ++ SP ++G ++ +VACCGGGGPY     
Sbjct  175  NKLLIDELENLRKLHPDVAIIYTDYYGAAMEIFLSPEQFGIEDPLVACCGGGGPYGVSAS  234

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG     VCD+PS Y SWDG   +EAAYK IA GLL+GPYT P I
Sbjct  235  AGCGYGEYKVCDDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  281



>emb|CDO96751.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = -1

Query  599  LLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDGLV  423
            +LQ EL+++R+ +P   +IY DYYN+ ++LY+S  +YGF     VACC GGGPYNY+   
Sbjct  223  MLQKELNKIRDHHPHASVIYVDYYNSTIQLYHSAQEYGFNGKNFVACCRGGGPYNYNFTA  282

Query  422  DCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            +CG   +T C  PS +++WDG+  TEAA +W+   +L+GPYT PQIN  CI
Sbjct  283  ECGDPLTTSCPYPSVFVNWDGNHFTEAANRWMTRAILEGPYTFPQINPSCI  333



>ref|XP_008777735.1| PREDICTED: GDSL esterase/lipase At1g28580-like, partial [Phoenix 
dactylifera]
Length=396

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 1/111 (1%)
 Frame = -1

Query  602  RLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGL  426
            RLL  ELDRLR  +P   II+A+YY+A M ++ SP ++GFK + + ACCGG GPYN +  
Sbjct  282  RLLSEELDRLRRLHPHAIIIHANYYDALMSIFRSPQQFGFKKSPLDACCGGDGPYNLNIS  341

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            + CG   +TVC +PS Y+ WDG+ LTEAAY+ I+ GLL+GPY TP I   C
Sbjct  342  LRCGDPMTTVCHDPSKYVFWDGTHLTEAAYEVISRGLLEGPYATPSIIQTC  392



>ref|XP_009608031.1| PREDICTED: GDSL esterase/lipase At5g45910 isoform X1 [Nicotiana 
tomentosiformis]
Length=366

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L+  L++LRE+YP   IIYADYY AA RL+++P  YGF NT+VACCGGGGPYN++  
Sbjct  252  NSQLKLSLEKLREEYPHAKIIYADYYGAAKRLFHAPKHYGFFNTLVACCGGGGPYNFNNS  311

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG   S  C + S + +WDG  LTEAAY  IA GLL G +T+P +
Sbjct  312  ARCGHIGSKACLDSSKFANWDGIHLTEAAYHHIAKGLLNGLFTSPPL  358



>emb|CDY30819.1| BnaC05g21950D [Brassica napus]
Length=397

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N+ LQ EL+RL++ YP   I+YADYYNA + ++  P+++GF N  + ACCG GGPYN++ 
Sbjct  266  NKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFMNRPLSACCGTGGPYNFNN  325

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               CG+     C +PS Y+ WDG  LTE+AY+W+A GLL+GPYT P  +  C
Sbjct  326  GSQCGTKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTLPAFDWSC  377



>ref|XP_010540488.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 73/113 (65%), Gaps = 2/113 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVA-CCGGGGPYNYDG  429
            N  LQ EL+RLR+ YP   I+YADYYN  +RL+  P ++GF N  ++ CCG GGPYNY  
Sbjct  265  NERLQIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGFMNRPLSVCCGAGGPYNYSP  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG      CDNPS Y++WDG  LTE AY+WIA GLLKGPY  P  N  C 
Sbjct  325  SRLCGDGVP-YCDNPSKYVNWDGFHLTEHAYRWIAKGLLKGPYADPAFNSYCF  376



>ref|XP_009113646.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
 emb|CDY34093.1| BnaA09g27190D [Brassica napus]
Length=397

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N+ LQ EL+RL++ YP   I+YADYYNA + ++  P+++GF N  + ACCG GGPYN++ 
Sbjct  266  NKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFVNRPLSACCGTGGPYNFNN  325

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               CG+     C +PS Y+ WDG  LTE+AY+W+A GLL+GPYT P  +  C
Sbjct  326  GSQCGTKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTLPAFDWSC  377



>ref|XP_006367777.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Solanum tuberosum]
Length=368

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L+  ++ LR++YP   IIYADYY AA RL +SP  YGF NT+VACCGGGGPYN++  
Sbjct  254  NAKLKLGIENLRKEYPHAKIIYADYYGAAKRLIHSPKHYGFSNTLVACCGGGGPYNFNNS  313

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG   S  C + SS+ +WDG  LTEAAY  IA GLL GP+ +P +
Sbjct  314  ARCGHIGSKACLDASSFANWDGIHLTEAAYHHIAKGLLNGPFISPSL  360



>ref|XP_006362447.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Solanum tuberosum]
Length=400

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N LLQ EL  LR+ YP   IIYADYYNAAM+ Y SP  +GF K  +VACCG GGPYN+  
Sbjct  265  NELLQKELHLLRDLYPAATIIYADYYNAAMQFYASPKSHGFRKGALVACCGAGGPYNFMF  324

Query  428  LVDCGS-ASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFR  264
               CG  A+  +C + S Y SWDG   TEAAYKWIA GLLKG +T P +   C  R
Sbjct  325  STICGDPAARNICSDTSVYASWDGMHFTEAAYKWIATGLLKGTFTFPPLPKICTDR  380



>ref|XP_004234095.1| PREDICTED: GDSL esterase/lipase At5g45910 [Solanum lycopersicum]
Length=368

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L+  ++ LR++YP   IIYADYY  A RL +SP  YGF NT+VACCGGGGPYN++  
Sbjct  254  NAKLKLGIENLRKEYPHAKIIYADYYGVAKRLIHSPKHYGFSNTLVACCGGGGPYNFNNS  313

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG   S  C + SS+ +WDG  LTEAAY  IA GLL GP+T+P +
Sbjct  314  ARCGHIGSKSCLDASSFTNWDGIHLTEAAYHHIAKGLLNGPFTSPSL  360



>ref|XP_009352808.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Pyrus x bretschneideri]
Length=367

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N  L+  L  LR++YP   IIYADYY AAM  +++P  YGFK+ T+ ACCGGGGPYN++ 
Sbjct  261  NSELKRALATLRQKYPHVNIIYADYYGAAMPFFHAPQHYGFKSGTLRACCGGGGPYNFNN  320

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTP  291
               CG   ST C +PSSY++WDG  LTEAAY++IA GL+ G +T P
Sbjct  321  SARCGHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHGQFTKP  366



>ref|XP_010478238.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Camelina sativa]
Length=415

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 74/110 (67%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVD  420
            L  EL+RLR+  P   IIYADYYNA +RL+  P+K+GF N    ACCG GGPYN+    +
Sbjct  277  LHAELNRLRKLNPHVNIIYADYYNALLRLFQEPAKFGFGNRPFPACCGIGGPYNFSLNRN  336

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CGS     C++PS Y+ WDG  +TEAAYK IADG+L+GPY  P  N  C+
Sbjct  337  CGSVGVKSCNDPSKYVGWDGIHMTEAAYKLIADGILQGPYAIPPFNWSCL  386



>ref|XP_007148064.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
 gb|ESW20058.1| hypothetical protein PHAVU_006G177500g [Phaseolus vulgaris]
Length=380

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N LLQ EL++LR  Y  T IIYADY+NAA++LY SP ++GF  N +  CCG  G YNY+ 
Sbjct  260  NELLQIELNQLRGLYSHTNIIYADYFNAALQLYKSPEQFGFGGNVLKVCCGVDGSYNYND  319

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
               CG A    CD+PS YISWDG  +TEAAY+WIA  LL G YT P+ N
Sbjct  320  TYKCGEAGVVACDDPSQYISWDGYHMTEAAYRWIAIALLDGSYTIPKFN  368



>ref|XP_010499707.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            LQ EL RLR+  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     
Sbjct  269  LQVELKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGKPYNFSFSQS  328

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C+NPS Y++WDG  +TEAA+K +ADGLLKGPY TP  N  C+    K K
Sbjct  329  CGSVGVESCNNPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSCLSSKIKNK  385



>ref|XP_010068248.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL  LR++Y    IIYADYY   MRL+ SP++YGF K+T VACCG GGP+N++ 
Sbjct  259  NNYLQRELQVLRQKYSHARIIYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  318

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
             + CGS SS VC +PS+ I WDG  LTEAAY+ +A GLL GP+T+P++
Sbjct  319  RMMCGSTSS-VCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  365



>gb|EAY75182.1| hypothetical protein OsI_03072 [Oryza sativa Indica Group]
Length=310

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+L  +EL+ LR+ +PD  IIY DYY AAM ++ SP ++G ++ +VACCGGGGPY     
Sbjct  179  NKLFIDELENLRKLHPDVAIIYTDYYGAAMEIFLSPEQFGIEDPLVACCGGGGPYGVSAS  238

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG     VCD+PS Y SWDG   +EAAYK IA GLL+GPYT P I
Sbjct  239  AGCGYGEYKVCDDPSKYASWDGFHPSEAAYKGIAIGLLQGPYTQPPI  285



>ref|XP_003546023.2| PREDICTED: GDSL esterase/lipase At1g31550-like [Glycine max]
Length=391

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+ LQ+ELDRLR  +    IIYADYYNA + LY++ + +GF N +  CCG GGPYNY+  
Sbjct  271  NQKLQSELDRLRGLHSHANIIYADYYNATLPLYHNTTMFGFTN-LKTCCGMGGPYNYNAA  329

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             DCG   +  CD+PS +I WD    TEAAY+ IA+GL+KGPY  PQ N  C+
Sbjct  330  ADCGDPGAIACDDPSKHIGWDSVHFTEAAYRIIAEGLIKGPYCLPQFNTFCL  381



>ref|XP_010499708.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=379

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            LQ EL RLR+  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     
Sbjct  252  LQVELKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGKPYNFSFSQS  311

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C+NPS Y++WDG  +TEAA+K +ADGLLKGPY TP  N  C+    K K
Sbjct  312  CGSVGVESCNNPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSCLSSKIKNK  368



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  420
            L+ EL+RLR+ YP   IIYADYYN+ +R++  P+K+GF +    ACCG GGPYN++    
Sbjct  262  LKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMERPFPACCGIGGPYNFNFTRK  321

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CGS     C +PS Y+ WDG  +TEAAYKWIADG+L GPY  P  +  C+
Sbjct  322  CGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNGPYANPPFDRSCL  371


 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N+ LQ EL+ LR+ YP   IIYADYYNA +RL+  P+K+GF N  + ACCG GG YN++ 
Sbjct  685  NKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNF  744

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               CGS     CD+PS Y+++DG  +TEAAY+ I++GLLKGPY  P     C+      K
Sbjct  745  SRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCLSSEIMNK  804

Query  248  LS  243
            +S
Sbjct  805  MS  806



>dbj|BAD44668.1| putative lipase [Arabidopsis thaliana]
Length=390

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ EL RLR  YP   IIY DYYN  +RL   PSK+G  +  + ACCG GGPYN+  
Sbjct  259  NEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACCGLGGPYNFTF  318

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             + CGS     C +PS Y++WDG  +TEAAYKWI++G+L GPY  P  N  C+
Sbjct  319  SIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIPPFNWSCL  371



>ref|NP_180304.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9ZQI3.1|GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360; AltName: Full=Extracellular 
lipase At2g27360; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD41994.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15186.1| putative lipase [Arabidopsis thaliana]
 gb|AEC07985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ EL RLR  YP   IIY DYYN  +RL   PSK+G  +  + ACCG GGPYN+  
Sbjct  263  NEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDRPLPACCGLGGPYNFTF  322

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             + CGS     C +PS Y++WDG  +TEAAYKWI++G+L GPY  P  N  C+
Sbjct  323  SIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYAIPPFNWSCL  375



>gb|KFK44742.1| hypothetical protein AALP_AA1G297000 [Arabis alpina]
Length=1372

 Score =   131 bits (329),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  420
            LQ EL+RL++ YP   IIYADYYN  +R++  P+K+GF    + ACCG GG YNY   + 
Sbjct  265  LQVELNRLQKLYPHVNIIYADYYNPMLRIFQEPAKFGFISRPLPACCGVGGLYNYTVGMQ  324

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CG+     C++PS Y++WDG  LTEAAY+W+ADGLL GPY  P  +  C+    K K
Sbjct  325  CGTEVVECCNDPSKYVNWDGVHLTEAAYRWLADGLLNGPYAIPPFDWSCLSSEIKNK  381


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -1

Query  458   GGGGPYNYDGLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQING  279
             G GG YNY+ +  CG+     C +PS Y+ WDGS LTE+ Y+WIA GLL+GPYT P  + 
Sbjct  1292  GAGGMYNYNSVRQCGTKGVDCCLDPSKYVHWDGSHLTESTYRWIAMGLLEGPYTIPAFDW  1351

Query  278   ECI  270
              C+
Sbjct  1352  SCL  1354



>emb|CDO96755.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  L+  L++LR++YP   IIYADYY AA R  +SP  YGF K+ +VACCGGGGPYN++ 
Sbjct  261  NAQLRLGLEKLRQKYPQAKIIYADYYGAAKRFVHSPKHYGFSKDRLVACCGGGGPYNFNN  320

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
               CG   ST C +PS++ +WDG  LTEAAY+++A GL+ GP+++P ++
Sbjct  321  SARCGHTGSTTCTSPSAHANWDGIHLTEAAYRYVAMGLINGPFSSPSLS  369



>ref|XP_010480702.1| PREDICTED: uncharacterized protein LOC104759479 [Camelina sativa]
Length=826

 Score =   130 bits (327),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 56/110 (51%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            L+ EL+RL++ YP   IIYADYYNA +R Y  P+K+GF +  + ACCG GGPYNY  +  
Sbjct  268  LRAELNRLQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLSACCGVGGPYNYTSVTQ  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG+     C +PS Y++WDG  +TEAAY+ I+DG+LKGPY  P  +  C+
Sbjct  328  CGTDVVEGCSDPSKYVAWDGVHMTEAAYRLISDGILKGPYAVPPFDWSCL  377


 Score =   118 bits (295),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 56/113 (50%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N  LQ EL+RL++ YP   IIYADYYN    ++  P+K+GF N  + ACCG GGPYN   
Sbjct  693  NEQLQVELNRLQKLYPRVNIIYADYYNVLSSIFQEPAKFGFINRPLSACCGFGGPYNDTV  752

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG+     C +PS Y++WDG  LTEAAY  IA+G+L GPYT P  +  C+
Sbjct  753  GKKCGTDVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSGPYTIPPFDWSCL  805



>ref|XP_010912659.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Elaeis guineensis]
Length=387

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            NRLL +ELD LR+ +P   IIYADYY A + ++  P+++GFK   + ACCG GGPYN   
Sbjct  263  NRLLVDELDHLRQLHPHVTIIYADYYEALLHIFRFPTQFGFKEPPLAACCGAGGPYNV--  320

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             V CG  ++TVC++PS Y+ WDG  LTEAAY  IA GLL+G Y TP I   C
Sbjct  321  FVACGDRAATVCNDPSKYVCWDGIHLTEAAYGTIAQGLLEGSYATPPITQAC  372



>ref|XP_011096420.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At2g27360-like 
[Sesamum indicum]
Length=408

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF--KNTVVACCGGGGPYNYD  432
            N LLQ EL RLR  +P   IIYAD YNA MR Y SP ++GF  ++ + ACCGGGGPYN++
Sbjct  280  NELLQKELSRLRHLHPHIAIIYADNYNAMMRFYLSPHQFGFAKESILRACCGGGGPYNFN  339

Query  431  GLVDCGSA-SSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            G   CG+   +  C+NPS Y++WDG   TEAA KWIA GL +G YT P I   C
Sbjct  340  GSALCGNLPRANCCENPSLYVNWDGLHCTEAANKWIAQGLWEGSYTHPHIKTIC  393



>ref|XP_003542991.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Glycine 
max]
 ref|XP_006594559.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Glycine 
max]
 ref|XP_006594560.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X3 [Glycine 
max]
Length=378

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+ LQ+EL RL+  +    IIYADYYNA + LY  P+ +GF N +  CCG GGPYNY+  
Sbjct  258  NQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFTN-LKTCCGMGGPYNYNAS  316

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRS  261
             DCG      CD+PS +I WDG  LTEAAY+ IA GL+KGPY  P+ N  C+  +
Sbjct  317  ADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQGLIKGPYCLPRFNTLCLINT  371



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N+ LQ EL+ LR+ YP   IIYADYYNA +RL+  P+K+GF N  + ACCG GG YN++ 
Sbjct  265  NKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMNRPLPACCGVGGSYNFNF  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
               CGS     CD+PS Y+++DG  +TEAAY+ I++GLLKGPY  P     C+      K
Sbjct  325  SRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPYAIPPFKWSCLSSEIMNK  384

Query  248  LS  243
            +S
Sbjct  385  MS  386



>ref|XP_007025435.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY28057.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=343

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N +L+NEL+++R+ +P   I+YADYY AA+  Y SP ++GF +T+ ACCGGGGPYN++  
Sbjct  225  NGMLKNELNKIRKLHPFANIVYADYYQAAIPFYRSPRQFGFNSTLTACCGGGGPYNFNLS  284

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            + CGS  +T C +PSSY+SWDG  LTEA Y  I+  LL G  T P++   C
Sbjct  285  LGCGSPGTTSCGDPSSYVSWDGIHLTEATYGLISKALLDGSSTIPRLKILC  335



>ref|XP_010912608.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X2 [Elaeis 
guineensis]
Length=405

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N+LLQNELDR+R  +P   IIYADYY A M ++ SP K+GFK   + ACCGGGGPYN + 
Sbjct  276  NQLLQNELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGFKKAPLDACCGGGGPYNVNF  335

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             + CG   +TVC +PS ++ WD +  TEAA + +A GLL+GPY  P I   C
Sbjct  336  SLPCGGPMATVCKDPSKFVFWDDAHPTEAATEIVARGLLEGPYAYPPILQAC  387



>ref|XP_008777733.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Phoenix dactylifera]
Length=375

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLL +EL++LR+ +PD  IIYA+YY A + +  SP +YG + T  ACCG  GP N    
Sbjct  263  NRLLMDELNKLRQLHPDATIIYANYYEALLSIVRSPGQYGIEVTEAACCGPSGPVNVTSP  322

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            V CG  ++TVC +PS YISWDG  LTEAAY  IA GLL+GPY TP I   C
Sbjct  323  VLCGDPAATVCSDPSKYISWDGVHLTEAAYGNIARGLLEGPYATPPIARAC  373



>ref|XP_010068245.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL  LR++Y    IIYADYY   MRL+ SP++YGF K+T VACCG GGP+N++ 
Sbjct  259  NDYLQRELQVLRQKYNHARIIYADYYEDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  318

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
             + CGS SS VC +PS+ I WDG  LTEAAY+ +A GLL GP+T+P++
Sbjct  319  RMMCGSKSS-VCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  365



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ  L R+R  +P   IIYADYYNA ++LY SP ++GF   T  ACCGGGGPYNY+ 
Sbjct  262  NDQLQIALSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGETSKACCGGGGPYNYNA  321

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               CG A ++ C+NP+ +ISWDG   TEAA++WI   +L+G YT P+++  C
Sbjct  322  SALCGDAGASACENPAQFISWDGLHSTEAAHRWITKAILQGNYTVPRVSTLC  373



>gb|KCW63207.1| hypothetical protein EUGRSUZ_G00824, partial [Eucalyptus grandis]
Length=349

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL  LR++Y    IIYADYY   MRL+ SP++YGF K+T VACCG GGP+N++ 
Sbjct  241  NDYLQRELQVLRQKYNHARIIYADYYEDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  300

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
             + CGS SS VC +PS+ I WDG  LTEAAY+ +A GLL GP+T+P++
Sbjct  301  RMMCGSKSS-VCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSPRL  347



>ref|XP_010478903.1| PREDICTED: GDSL esterase/lipase At1g31550 [Camelina sativa]
Length=395

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            LQ EL+RLR+  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     
Sbjct  268  LQVELNRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGRPYNFSFSQS  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CGSA    C++PS Y++WDG  +TEAA+K +ADGLLKGPY TP  N  C+
Sbjct  328  CGSAGVKSCNDPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSCL  377



>ref|XP_010499588.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=395

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            LQ EL+RL++ YP   IIYADYYNA +R+Y  P+K+GF N  + ACCG GGPYN+     
Sbjct  271  LQAELNRLQKLYPHVNIIYADYYNALLRIYQEPTKFGFMNRPLSACCGVGGPYNFTSFWQ  330

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG+     C +PS Y++WDG  +TEAAY  I++G+LKGPY  P  +  C+
Sbjct  331  CGADVVEGCSDPSKYVTWDGVHMTEAAYSLISEGILKGPYAAPPFDWSCL  380



>gb|EMT19408.1| GDSL esterase/lipase [Aegilops tauschii]
Length=326

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGG--PYNYD  432
            NR L+ +LD+L+++YP T I+Y DY+ AAM+   SP K+GF   + ACCG GG   YN++
Sbjct  216  NRELKQQLDQLQKKYPKTKIMYGDYFKAAMQFVVSPGKFGFSTALQACCGAGGSGAYNFN  275

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
                CG A ++VC NPS+Y+SWDG  +TEAAY+ +A+G L GPY +P I
Sbjct  276  LKKKCGEAGASVCSNPSAYVSWDGIHMTEAAYRMVANGWLNGPYASPPI  324



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ EL RL++ YP   +IYADYYNA +RLY  P+K+GF N  + ACCG GGPYNY     
Sbjct  269  LRAELKRLQKLYPHVNVIYADYYNALLRLYQEPAKFGFMNRPLSACCGSGGPYNYTVGRK  328

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG+     C++PS Y++WDG  LTEAAY+ +A+G+LKGPY  P  +  C+
Sbjct  329  CGTDIVESCNDPSKYVAWDGVHLTEAAYRLMAEGILKGPYAIPPFDWSCL  378



>ref|XP_010460655.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=414

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 2/113 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN--TVVACCGGGGPYNYD  432
            N+ LQ EL+R+++ YP   IIYADYYNA +R++  P+K+GF +   + A CG GGPYN++
Sbjct  267  NKELQEELNRVQKIYPHVTIIYADYYNALLRIFQEPAKFGFTSGRPLSAFCGTGGPYNFN  326

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             +  CG+     C +PS Y+ WDG  LTE+AY+WIA G LKGPYT P  +  C
Sbjct  327  SMSWCGTKKVDSCSDPSKYVHWDGFHLTESAYRWIAMGFLKGPYTIPAYDWSC  379



>gb|KCW45467.1| hypothetical protein EUGRSUZ_L00816 [Eucalyptus grandis]
Length=402

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ +LD LRE +P T IIY DYYNAA+R Y SP+K+GF+  V  ACCGGGG +NY+ 
Sbjct  267  NEQLQLKLDHLRELHPRTKIIYVDYYNAAVRFYQSPNKFGFEGQVFRACCGGGGTHNYNS  326

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               C S+++ VCD+PSSY SWDG   TEAAY+WI   +  G +T P+++  C
Sbjct  327  SALC-SSNTKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGSFTVPKLDISC  377



>gb|KCW63215.1| hypothetical protein EUGRSUZ_G00835, partial [Eucalyptus grandis]
Length=345

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL  LR++Y    IIYADYY   MRL+ SP++YGF K+T VACCG GGP+N++ 
Sbjct  241  NNYLQRELQVLRQKYSHARIIYADYYGDIMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  300

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTP  291
             + CGS SS VC +PS+ I WDG  LTEAAY+ +A GLL GP+T+P
Sbjct  301  RMMCGSTSS-VCKDPSASILWDGVHLTEAAYRHMAKGLLDGPFTSP  345



>ref|XP_002879083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ EL+RLR+ YP   IIY DYYN  +RL   PSK+G  +  + ACCG GGPYN+  
Sbjct  263  NEQLQAELNRLRKLYPHVNIIYGDYYNTLLRLVQEPSKFGLMDRPLPACCGVGGPYNFTF  322

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
             + CGS     C +PS Y++WDG  +TEAAYK I++G+LKGPY  P  +  C+    K K
Sbjct  323  SIQCGSKGVEYCSDPSKYVNWDGIHMTEAAYKCISEGILKGPYAIPPFDWSCLSSEIKNK  382

Query  248  LS  243
             S
Sbjct  383  ES  384



>ref|XP_011027710.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Populus euphratica]
Length=373

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N  L+  L  LR++YP   IIYADYY AA R Y++P ++GF   T+ ACCGGGGPYN++ 
Sbjct  261  NNQLKTALQMLRQKYPHARIIYADYYGAAKRFYHAPQRHGFTGGTLTACCGGGGPYNFNN  320

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S  C NPSS+ +WDG  LTEAAY++IA GL+ G +TTP +
Sbjct  321  SARCGHMGSRTCSNPSSHANWDGIHLTEAAYRYIAMGLVSGSFTTPPL  368



>ref|XP_010501634.1| PREDICTED: uncharacterized protein LOC104778924 [Camelina sativa]
Length=818

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N+ LQ EL+RL + YP   IIYADYYNA +R+Y  PSK+GF N  + ACCG GGPYN+  
Sbjct  263  NKQLQAELNRLLKLYPHVNIIYADYYNALLRIYQEPSKFGFMNRPLSACCGVGGPYNFTS  322

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG+     C +PS Y++WDG  +TEAAY  I++G+LKGPY  P  +  C+
Sbjct  323  FWQCGADVVEGCSDPSKYVTWDGVHMTEAAYSLISEGILKGPYAVPPFDWSCL  375


 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVD  420
            L+ EL+R+++ YP   IIY DYYNA +R Y  P+K+GF +  + ACCG GGPYNY  +  
Sbjct  690  LRAELNRIQKLYPHVNIIYVDYYNALLRFYQEPAKFGFMDRPLPACCGVGGPYNYTSVTQ  749

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CG+     C +PS Y++WDG  +TEAAY+ +++G+LKGPY  P  +  C+    K K
Sbjct  750  CGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPLFDWSCLSSEIKDK  806



>ref|XP_009765841.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nicotiana sylvestris]
Length=388

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N LLQ EL  LRE +P   IIYADYYNAAM+ Y SP+ +GF K  + ACCG GGPYN+  
Sbjct  265  NELLQKELHLLRELHPSVTIIYADYYNAAMQFYVSPTSHGFRKGALDACCGAGGPYNFKF  324

Query  428  LVDCGS-ASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIF  267
               CG   +  +C + S Y SWDG   TEAAYKWIA GLL+G +T P +   C F
Sbjct  325  SAVCGDPPARNICSDTSQYASWDGMHFTEAAYKWIARGLLEGTFTFPPLAKICTF  379



>ref|XP_008812188.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=377

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLL +EL++LR+ +PD  IIYA+YY A + +  SP +YG + T  ACCG  GP N    
Sbjct  241  NRLLMDELNKLRQLHPDATIIYANYYEALLSIVRSPGQYGIEVTEAACCGPSGPVNVTSP  300

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            V CG  ++TVC +PS YISWDG  LTEAAY  IA GLL+GPYT P +   C
Sbjct  301  VLCGDPAATVCSDPSKYISWDGVHLTEAAYGNIARGLLEGPYTAPPMIRAC  351



>gb|KEH34273.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
 gb|KEH34274.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
 gb|KEH34275.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
 gb|KEH34276.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=388

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF----KNTVVACCGGGGPYN  438
            N  L+N ++ LR +YP   IIY DYYN   RLY +P +YGF    +  + ACCGG GPY+
Sbjct  270  NEQLKNSIETLRHKYPQAKIIYFDYYNNLKRLYQTPQQYGFISDKEEILKACCGGSGPYH  329

Query  437  YDGLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
             +  + CG+ SSTVC +PS YI+WDGS LTEA+YK IA GL++GP+  P +
Sbjct  330  VNLEIFCGTGSSTVCPDPSKYINWDGSHLTEASYKLIAKGLVEGPFANPSL  380



>ref|XP_010462954.1| PREDICTED: uncharacterized protein LOC104743592 [Camelina sativa]
Length=799

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  420
            LQ EL+RL+  YP+  IIYADYYNA + LY  P+K+GF K  + ACCG GG YN++    
Sbjct  268  LQTELNRLKNLYPNVNIIYADYYNALLCLYQEPTKFGFIKRPLPACCGLGGLYNFNFTRK  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  243
            CGS     C++PS Y++WDG  +TEAAY+WI++GLL GPY  P  N  C+    K K S
Sbjct  328  CGSLGVESCNDPSKYVNWDGIHMTEAAYRWISEGLLNGPYAIPPFNWSCLNSKIKKKKS  386


 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  420
            L+ EL+RL++ YP   IIYADYYNA +R+Y  P+K+GF K  + ACCG GGPYN+     
Sbjct  675  LRVELNRLQKLYPHVNIIYADYYNALLRIYQDPAKFGFMKRPLSACCGVGGPYNFTAGKK  734

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG+     C++PS Y++WDG  LTEAAY+ +A+G+L GPY  P  +  C+
Sbjct  735  CGTDVVDSCNDPSKYVAWDGVHLTEAAYRLMAEGILNGPYAVPPFDWSCL  784



>gb|KEH34272.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=395

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF----KNTVVACCGGGGPYN  438
            N  L+N ++ LR +YP   IIY DYYN   RLY +P +YGF    +  + ACCGG GPY+
Sbjct  277  NEQLKNSIETLRHKYPQAKIIYFDYYNNLKRLYQTPQQYGFISDKEEILKACCGGSGPYH  336

Query  437  YDGLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
             +  + CG+ SSTVC +PS YI+WDGS LTEA+YK IA GL++GP+  P +
Sbjct  337  VNLEIFCGTGSSTVCPDPSKYINWDGSHLTEASYKLIAKGLVEGPFANPSL  387



>ref|XP_010277743.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Nelumbo nucifera]
Length=390

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN--TVVACCGGGGPYNYD  432
            N LLQ E+ RLR  +P   IIYAD YNA   ++ SP K+GF+    ++ CCGG GPYNY+
Sbjct  265  NHLLQEEIHRLRHLHPHVTIIYADLYNAVKAIFRSPDKFGFRKGALLLTCCGGEGPYNYN  324

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              V CG   + VC +PS Y SWDG+ +TEA Y+ IA GL++GPY  P  N
Sbjct  325  KSVHCGVRGAKVCQDPSQYGSWDGTHMTEAVYRVIATGLMEGPYAIPPFN  374



>ref|XP_010460979.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=387

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            LQ E+ RLR+  P   IIYADYYNA++ L   P+KY F N T+ ACCG G PYN+     
Sbjct  260  LQVEIKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGRPYNFSFSQS  319

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C++PS Y++WDG  +TEAAYK +ADGLLKGPY TP  N  C+    K K
Sbjct  320  CGSVGVESCNDPSKYVAWDGIHMTEAAYKLMADGLLKGPYATPPFNWSCLSSKIKNK  376



>ref|XP_008785157.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=360

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N+LL+ +L +L+++YP T +IY D+YNAAM+   +P KYGF N  + ACCGGGGPYN + 
Sbjct  251  NQLLKIKLQQLQQRYPGTRVIYGDFYNAAMQFVTNPQKYGFSNGALKACCGGGGPYNVNL  310

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S VC++PS+Y SWDG   TEAA +++A+GLL+GPY  P I
Sbjct  311  DYRCGQKGSNVCNDPSTYASWDGIHFTEAANRYVANGLLRGPYANPPI  358



>ref|XP_010435654.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            LQ EL RLR   P   IIYADYYNA +RL   P+KYGF +  + ACCG G PYN++    
Sbjct  268  LQAELKRLRNLNPHVNIIYADYYNALLRLNQEPTKYGFIDKPLSACCGVGEPYNFNFSTC  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C++PS Y++WDG  +TEAAYK +ADGLLKGPY +P  N  C+    K K
Sbjct  328  CGSFGVDSCNDPSKYVAWDGIHMTEAAYKLMADGLLKGPYASPPFNWTCLSSKIKNK  384



>ref|NP_849723.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31010.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=382

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  L+ EL RL++ YPD  IIYADY+N+  R Y  P+KYGFKN  + ACCG GG YN+  
Sbjct  263  NEQLKTELKRLQKLYPDVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTI  322

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
              +CG    + C NPS Y++WDG  LTEAAY+ +A+G+L GPY TP  +  C+
Sbjct  323  GKECGYEGVSYCQNPSEYVNWDGYHLTEAAYQKMAEGILNGPYATPAFDWSCL  375



>ref|XP_010461021.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  420
            LQ EL RLR+  P   II+ADYYN  +RL   PSKYGF K  + ACCG GG YN++    
Sbjct  268  LQAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGFIKEPLSACCGVGGTYNFNLSTG  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CG+     C++PS Y++WDG  +TEAAYK +ADGLLKGPY TP  +  C+    K K
Sbjct  328  CGNVGVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKGPYATPPFSWSCLSSKIKNK  384



>ref|NP_564314.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FPE4.1|GDL12_ARATH RecName: Full=GDSL esterase/lipase At1g28660; AltName: Full=Extracellular 
lipase At1g28660; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG42007.1|AF327417_1 unknown protein [Arabidopsis thaliana]
 gb|AAN71956.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31011.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  L+ EL RL++ YPD  IIYADY+N+  R Y  P+KYGFKN  + ACCG GG YN+  
Sbjct  264  NEQLKTELKRLQKLYPDVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTI  323

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
              +CG    + C NPS Y++WDG  LTEAAY+ +A+G+L GPY TP  +  C+
Sbjct  324  GKECGYEGVSYCQNPSEYVNWDGYHLTEAAYQKMAEGILNGPYATPAFDWSCL  376



>ref|XP_010912585.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=396

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N LL+ E+DRLR  +P T IIYADYY AAM +Y  P KYG    + ACCGGGG YN++  
Sbjct  272  NNLLKAEVDRLRGLHPYTTIIYADYYEAAMDIYRHPLKYGIDAPLAACCGGGGRYNFNLA  331

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            V CG+   TVC +PS ++ WDG  LT+A YK IA GLL+G Y T  I   C+
Sbjct  332  VMCGAPGGTVCSDPSKHVCWDGMHLTDAVYKIIARGLLEGSYATAPIAQACL  383



>emb|CDM80951.1| unnamed protein product [Triticum aestivum]
Length=231

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LL +EL++LR+ +P   IIYADYY AAM ++ SP  +G ++ +VACCG  GPY     
Sbjct  100  NKLLVDELEKLRKLHPSVSIIYADYYGAAMEIFVSPYLFGIEDPLVACCGVEGPYGVSVT  159

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG     VCDNP  Y SWDG   TE +Y+ IADGLL+GPYT P I
Sbjct  160  TKCGHGEYKVCDNPQKYASWDGLHPTETSYRAIADGLLRGPYTQPPI  206



>emb|CDM83549.1| unnamed protein product [Triticum aestivum]
Length=389

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LL +EL+ LR+ +P   IIYADYY AAM +++SP ++G ++ ++ACCGGGGPY     
Sbjct  259  NKLLVDELENLRKLHPGVVIIYADYYGAAMEIFSSPEQFGIEDPLMACCGGGGPYGVSAT  318

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              CG     VCD+P  Y SWDG   TEA YK IA+GLL+G YT P I+
Sbjct  319  AGCGHGDYKVCDDPQEYASWDGFHPTEATYKGIANGLLRGSYTQPPIS  366



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 5/120 (4%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  L+  L R+R++ P   +IYADYY+AAM ++ SP   GF+++ + ACCGGGGPYN++ 
Sbjct  303  NNQLRVVLKRIRQRNPHATVIYADYYSAAMSMFRSPQLSGFRSSPLPACCGGGGPYNFNS  362

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
             + CG+  S VC +PSSY++WDG  +TEAAY+ IA GLL+GP   P I   C    P+TK
Sbjct  363  FLQCGNPGSNVCADPSSYVTWDGMHMTEAAYRKIATGLLEGPNAVPPILNTC----PRTK  418



>ref|XP_009407319.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            NR L +EL +LR +YP   IIYA+YY AAM ++ SP +YGF K  + ACCGGGGPYNY+ 
Sbjct  271  NRHLLDELTQLRRRYPQATIIYANYYEAAMAIFRSPQEYGFGKFPLAACCGGGGPYNYNH  330

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               CG   + VC +PSS ISWDG  LTEAAY+ IA GLL GPYT P ++  C
Sbjct  331  STKCGK-DAGVCSSPSSQISWDGIHLTEAAYRVIARGLL-GPYTIPSLSRSC  380



>ref|XP_010460658.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Camelina 
sativa]
Length=394

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ EL+R+++ YP   IIYADYYNA +R Y  P+K+GF +  + ACCG GGPYNY  +  
Sbjct  266  LRAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLCACCGVGGPYNYTSVSQ  325

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CG+     C +PS Y++WDG  +TEAAY+ +++G+LKGPY  P  +  C+    K K
Sbjct  326  CGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPPFDWSCLSSEIKDK  382



>emb|CDO96749.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 2/113 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGG-PYNYD  432
            N LLQ EL R+R+++ +  ++YA+YY+A M+LY SP +YGF    + ACCG GG PYNYD
Sbjct  267  NELLQAELTRIRQRHRNAVVMYANYYDALMQLYLSPEQYGFGGEPLTACCGAGGIPYNYD  326

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
                CG   S  C  PS YISWDG+  TEAAY++I   LL+GPYT P IN  C
Sbjct  327  SDAVCGDPPSRACAQPSLYISWDGAHCTEAAYRFITKSLLEGPYTAPHINSSC  379



>ref|XP_010460657.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Camelina 
sativa]
Length=397

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ EL+R+++ YP   IIYADYYNA +R Y  P+K+GF +  + ACCG GGPYNY  +  
Sbjct  269  LRAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGFMDRPLCACCGVGGPYNYTSVSQ  328

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CG+     C +PS Y++WDG  +TEAAY+ +++G+LKGPY  P  +  C+    K K
Sbjct  329  CGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKGPYAVPPFDWSCLSSEIKDK  385



>ref|NP_001057786.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAD54230.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF19700.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAG87915.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGP--YNYD  432
            NR L+ +LD L+++YP+T I+Y DY+ AAM+   SP  +GF +T+ ACCG GG   YN++
Sbjct  285  NRELKQQLDELQKKYPETKIMYGDYFKAAMQFVVSPGNFGFSSTMQACCGAGGQGNYNFN  344

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
                CG   ++VC NPSSY+SWDG  +TEAAY+++A+G L GPY  P I
Sbjct  345  LKKKCGEEGASVCSNPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEPPI  393



>ref|XP_009415142.1| PREDICTED: uncharacterized protein LOC103996059 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=448

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 78/121 (64%), Gaps = 4/121 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L +E+ RL+  +P+  IIYADYY A M +++ P ++G +   +ACCGGGGPYNY+  
Sbjct  319  NGHLHDEVRRLQALHPEAVIIYADYYGAMMNIFSDPERFGIEERFLACCGGGGPYNYNSS  378

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKL  246
              CGS   TVCD+ S+Y+ WDG  +TEA Y+ ++ GLL+GP+  P I   C    P T+ 
Sbjct  379  RPCGSEGQTVCDDTSTYLHWDGLHMTEATYRIVSVGLLQGPFAVPAIATTC----PATRF  434

Query  245  S  243
            S
Sbjct  435  S  435



>ref|XP_009415143.1| PREDICTED: GDSL esterase/lipase At1g28590-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 78/121 (64%), Gaps = 4/121 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L +E+ RL+  +P+  IIYADYY A M +++ P ++G +   +ACCGGGGPYNY+  
Sbjct  255  NGHLHDEVRRLQALHPEAVIIYADYYGAMMNIFSDPERFGIEERFLACCGGGGPYNYNSS  314

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKL  246
              CGS   TVCD+ S+Y+ WDG  +TEA Y+ ++ GLL+GP+  P I   C    P T+ 
Sbjct  315  RPCGSEGQTVCDDTSTYLHWDGLHMTEATYRIVSVGLLQGPFAVPAIATTC----PATRF  370

Query  245  S  243
            S
Sbjct  371  S  371



>ref|XP_002891138.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67397.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDGLVD  420
            L+ EL RLR+  P   IIYADYYNA++RL   P+KYGF N  + ACCG G PYN++    
Sbjct  267  LKEELKRLRQLNPHVNIIYADYYNASLRLGQEPTKYGFINRHLSACCGVGRPYNFNFSRS  326

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C++PS Y++WDG  +TEAA+K +ADGLL GPY  P  N  C+    K K
Sbjct  327  CGSVGVESCNDPSKYVAWDGLHMTEAAHKSMADGLLNGPYAIPPFNWSCLSSKIKKK  383



>gb|EAZ37226.1| hypothetical protein OsJ_21564 [Oryza sativa Japonica Group]
Length=379

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGP--YNYD  432
            NR L+ +LD L+++YP+T I+Y DY+ AAM+   SP  +GF +T+ ACCG GG   YN++
Sbjct  269  NRELKQQLDELQKKYPETKIMYGDYFKAAMQFVVSPGNFGFSSTMQACCGAGGQGNYNFN  328

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
                CG   ++VC NPSSY+SWDG  +TEAAY+++A+G L GPY  P I
Sbjct  329  LKKKCGEEGASVCSNPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEPPI  377



>ref|XP_003565548.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=373

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N ++Q +L  LR +YP   I+YADYY AAM    +P ++GFK+  +  CCGGGGPYN++ 
Sbjct  265  NAMVQQKLQGLRRKYPQARIMYADYYGAAMSFAKNPKQFGFKHGPLKTCCGGGGPYNFNP  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC++PS+Y +WDG  LTEAAY  IAD +L GPYT+P++
Sbjct  325  KTSCGVRGSSVCEDPSAYANWDGVHLTEAAYHAIADSILHGPYTSPRL  372



>ref|XP_010501635.1| PREDICTED: uncharacterized protein LOC104778925 [Camelina sativa]
Length=815

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDGLVD  420
            LQ EL+RL+   P+  IIYADYYNA +RLY  P+K+GF K  + ACCG GG YN++    
Sbjct  268  LQTELNRLKNLNPNVNIIYADYYNALLRLYQEPTKFGFIKRPLPACCGLGGLYNFNFTRK  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  243
            CGS     C +PS +++WDG  +TEAAY+WI++GLL GPY  P  N  C+    K K S
Sbjct  328  CGSLGVESCIDPSEFVNWDGIHMTEAAYRWISEGLLNGPYAIPPFNWSCLNSKIKNKKS  386


 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ EL+RL++ YP   IIYADYYNA +R+Y  P+K+GF +  + ACCG GGP+N+     
Sbjct  678  LRVELNRLQKLYPHVNIIYADYYNALLRIYQDPAKFGFMDRPLSACCGVGGPHNFTAGNK  737

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG+     CD+PS Y++WDG  LTEAAY+ IA+G+LKGPY  P  +  C+
Sbjct  738  CGTVVVESCDDPSKYVAWDGVHLTEAAYRLIAEGILKGPYAVPPFDWFCL  787



>ref|XP_004233850.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Solanum 
lycopersicum]
Length=385

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N LLQ EL  LR+  P   IIYADYYNAAM+ Y SP  +GF K  +VACCG GGPYN+  
Sbjct  264  NELLQKELHLLRDLNPAATIIYADYYNAAMQFYASPKSHGFRKGALVACCGAGGPYNFKF  323

Query  428  LVDCGSASST-VCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFR  264
               CG  S+  +C + S Y SWDG   TEAAYKWIA GLL+G +T P +   C  R
Sbjct  324  SALCGDPSARDICSDTSVYASWDGMHFTEAAYKWIATGLLQGTFTFPPVPKICTNR  379



>ref|XP_010478237.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=415

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ EL+RL++ YP   IIYADYYNA +R+Y  P  +GF N  + ACCG GGPYN+     
Sbjct  287  LRAELNRLQKLYPHVNIIYADYYNALLRIYQEPENFGFMNRPLSACCGVGGPYNFTSFWQ  346

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG+     C+ PS Y++WDG  +TEAAY  IA+G+LKGPY  P  N  C+
Sbjct  347  CGTDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKGPYAVPPFNWSCL  396



>gb|EMT27195.1| GDSL esterase/lipase [Aegilops tauschii]
Length=403

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLL +EL++LR+ +P   IIYADYY AAM +Y SP ++G  + + ACCGGGGPY     
Sbjct  272  NRLLIDELEKLRKLHPGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGVSMT  331

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              CG     VCD+P  Y SWDG   +EAAYK IA GLL+G YT P I+
Sbjct  332  ARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  379



>ref|NP_973931.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE30997.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=309

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ EL+RL++ YP   IIYADYYNA   LY  P+K+GF N  + ACCG GGPYNY     
Sbjct  188  LRAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGFMNRPLSACCGAGGPYNYTVGRK  247

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            CG+     CD+PS Y++WDG  +TEAAY+ +A+G+L GPY  P  +  C
Sbjct  248  CGTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAIPPFDWSC  296



>ref|XP_010478236.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=400

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN--TVVACCGGGGPYNYD  432
            N+ LQ E++R+++ YP   I+YADYYNA +R++  P+K+GF +   + ACCG G PYN++
Sbjct  267  NKELQEEINRVQKLYPHVTILYADYYNALLRIFLEPAKFGFTSGRPLSACCGTGEPYNFN  326

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             +  CG+ +   C +PS Y+ WDG  LTE+AY+WIA G LKGPYT P  +  C
Sbjct  327  SMSWCGTKNVDSCIDPSKYVHWDGFHLTESAYRWIAMGFLKGPYTIPAYDWSC  379



>emb|CDO96752.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N +LQ EL+R+RE +P   IIYADYYN+A+R Y  P ++GF   T+ ACCG GGPYN+D 
Sbjct  261  NEVLQIELNRIRELHPHVTIIYADYYNSAIRFYRWPKEFGFTGGTLSACCGAGGPYNFDS  320

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             V CG   +T C +PS+Y+ WDG  LTEAA + I  GL +G Y+ P I   C
Sbjct  321  SVGCGDPPTTGCADPSAYVCWDGLHLTEAANRLIVKGLFEGSYSAPPIKLIC  372



>gb|KCW45468.1| hypothetical protein EUGRSUZ_L00817 [Eucalyptus grandis]
Length=398

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ +L+ LRE +P   IIY DYYNAA+R Y SP K+GF   V+ ACCGG G YNY+ 
Sbjct  274  NEQLQRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGGEGTYNYNI  333

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            L  C S ++ VCD+PSSY SWDG   TEAAY+WI  G+  G +T P+++  C
Sbjct  334  LEPCNS-NARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  384



>ref|XP_004491864.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=373

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV----ACCGGGGPYN  438
            N  L+N ++ LR+++P   IIY DYY A  RLY +P +YGF +  V    ACCGG GPY+
Sbjct  255  NEQLKNSIETLRQKHPQAKIIYFDYYGATKRLYQAPQQYGFTSDKVEILKACCGGDGPYH  314

Query  437  YDGLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
             + L+ CG+  +T+C +PS  I WDG+ LTEAAYK IA GL++GP+T P +
Sbjct  315  VNALMFCGNPGTTICSDPSKLIDWDGAHLTEAAYKLIAKGLVEGPFTNPSL  365



>ref|XP_008812183.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=395

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 84/128 (66%), Gaps = 6/128 (5%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFK-NTVVACCGGGGPYNYDG  429
            N  L+  L+R+R + P   +IYADYY+AAM L++SP   GF+ + + ACCGGGGPYNY+ 
Sbjct  263  NNRLRVVLNRVRLRNPHATVIYADYYSAAMSLFSSPEPSGFRISPLPACCGGGGPYNYNS  322

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI-----FR  264
             + CG++ S +C +PS YI+WDG  +TEAAY+ IA GLLKGP   P I   C      F 
Sbjct  323  SLQCGNSGSNICADPSIYITWDGMHMTEAAYRKIAIGLLKGPNAVPAILNTCPQTNQEFS  382

Query  263  SPKTKLSD  240
             P+  LSD
Sbjct  383  RPQYVLSD  390



>ref|XP_010057069.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Eucalyptus grandis]
 gb|KCW74053.1| hypothetical protein EUGRSUZ_E02673 [Eucalyptus grandis]
Length=400

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ +L+ LRE +P   IIY DYYNAA+R Y SP K+GF   V+ ACCGG G YNY+ 
Sbjct  276  NEQLQRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGGEGTYNYNI  335

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            L  C S ++ VCD+PSSY SWDG   TEAAY+WI  G+  G +T P+++  C
Sbjct  336  LEPCNS-NARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  386



>gb|KDP21068.1| hypothetical protein JCGZ_21539 [Jatropha curcas]
Length=367

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  L+  L+ LR +YP+  IIYADYY AA R Y+SP  YGF N V+ ACCGGGG YN++ 
Sbjct  255  NNQLKGALETLRNKYPNARIIYADYYGAAKRFYHSPKHYGFYNGVLTACCGGGGSYNFNN  314

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S  C NPS+Y +WDG  LTEAAY+ IA GL+ G ++TP +
Sbjct  315  FARCGHVGSKACVNPSTYANWDGIHLTEAAYRIIAMGLINGSFSTPPL  362



>emb|CDY64716.1| BnaCnng44670D [Brassica napus]
Length=389

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ E+ RLR+ YP   IIYADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +
Sbjct  267  LKTEIRRLRKLYPHVNIIYADYYNSLYRLYQKPTKYGFKNRPLAACCGVGGQYNFTIGEE  326

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG      C NPS YI+WDG  LTEAA++ +A G+L GPY TP  N  C+
Sbjct  327  CGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYATPAFNWSCL  376



>dbj|BAJ98364.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LL +EL++LR+ +P   IIYADYY AAM ++ SP K+G ++ ++ACCG  GPY     
Sbjct  260  NKLLVDELEKLRKLHPSASIIYADYYGAAMEIFVSPYKFGIEDPLMACCGVEGPYGVSIT  319

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              CG     VCDNP +Y SWDG   TE +Y+ IADGLL+GPYT P I
Sbjct  320  TKCGHGEYKVCDNPQNYASWDGLHPTETSYRVIADGLLRGPYTQPPI  366



>ref|XP_010915606.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=361

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N++L+ +L  L+++YP T I+YAD+YNAAM    +P KYGF N  + ACCGGGGPYN + 
Sbjct  251  NQVLKMKLRYLQQRYPQTRIMYADFYNAAMHFVMNPLKYGFTNGALKACCGGGGPYNVNL  310

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S VC NPS++ SWDG   TEAA ++IA GLL+GPY  P I
Sbjct  311  DRRCGQKGSNVCQNPSTFASWDGIHFTEAANRYIATGLLRGPYANPPI  358



>ref|XP_008783909.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=360

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N++L+ +L  L+++YP T I+Y D+YNAAM+   +P KYGF N  + ACCGGGGPYN + 
Sbjct  251  NQMLKIKLRHLQQRYPRTRIMYGDFYNAAMQFVINPGKYGFSNGALKACCGGGGPYNVNL  310

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S VC NPS++ SWDG   TEAA +++A+GLL+GPY  P I
Sbjct  311  DHRCGQKGSNVCKNPSTFASWDGIHFTEAANRYVANGLLRGPYANPPI  358



>emb|CDY63998.1| BnaA07g36520D [Brassica napus]
Length=389

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ E+ RLR++YP   IIYADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +
Sbjct  267  LKTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGFKNRPLAACCGVGGQYNFTIGEE  326

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG      C NPS YI+WDG  LTEAA++ +A G+L GPY  P  N  C+
Sbjct  327  CGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYAAPAFNWSCL  376



>gb|KCW76155.1| hypothetical protein EUGRSUZ_D00534, partial [Eucalyptus grandis]
Length=362

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL  LR++Y    IIY DYY   MRL+ SP++YGF K+T VACCG GGP+N++ 
Sbjct  254  NDYLQRELQVLRQKYSHAKIIYVDYYGDTMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  313

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
             + CGS SS VC +PS+ I WDG  LTEAAY+ +A GLL  P+T+P++
Sbjct  314  RMMCGSTSS-VCKDPSASILWDGVHLTEAAYRHMAKGLLDSPFTSPRL  360



>gb|AAX62802.1| lipase 2 [Brassica napus]
Length=389

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ E+ RLR++YP   IIYADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +
Sbjct  267  LKTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGFKNRPLAACCGVGGQYNFTIGEE  326

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG      C NPS YI+WDG  LTEAA++ +A G+L GPY  P  N  C+
Sbjct  327  CGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYAAPAFNWSCL  376



>ref|NP_174180.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ2.1|GDL7_ARATH RecName: Full=GDSL esterase/lipase At1g28580; AltName: Full=Extracellular 
lipase At1g28580; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22836.1|AC007508_13 F1K23.18 [Arabidopsis thaliana]
 gb|AAK32776.1|AF361608_1 At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAK76488.1| putative lipase [Arabidopsis thaliana]
 gb|AAL69539.1| At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAL85126.1| putative lipase [Arabidopsis thaliana]
 gb|AEE30996.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=390

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ EL+RL++ YP   IIYADYYNA   LY  P+K+GF N  + ACCG GGPYNY     
Sbjct  269  LRAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGFMNRPLSACCGAGGPYNYTVGRK  328

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            CG+     CD+PS Y++WDG  +TEAAY+ +A+G+L GPY  P  +  C
Sbjct  329  CGTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNGPYAIPPFDWSC  377



>gb|EAZ01210.1| hypothetical protein OsI_23235 [Oryza sativa Indica Group]
Length=379

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGP--YNYD  432
            NR L+ +LD L+++YP+T I+Y DY+ AAM+   SP  +GF + + ACCG GG   YN++
Sbjct  269  NRELKQQLDELQKKYPETKIMYGDYFKAAMQFVVSPGNFGFSSAMQACCGAGGQGNYNFN  328

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
                CG   ++VC NPSSY+SWDG  +TEAAY+++A+G L GPY  P I
Sbjct  329  LKKKCGEEGASVCSNPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEPPI  377



>ref|XP_010040115.1| PREDICTED: uncharacterized protein LOC104428890 [Eucalyptus grandis]
Length=814

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ +LD LRE +P T IIY DYYNAA+R Y SP+K+GF+  V  ACCGGGG +NY+ 
Sbjct  679  NEQLQLKLDHLRELHPRTKIIYVDYYNAAVRFYQSPNKFGFEGQVFRACCGGGGTHNYNS  738

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               C S+++ VCD+PSSY SWDG   TEAAY+WI   +  G +T P+++  C
Sbjct  739  SALC-SSNTKVCDDPSSYASWDGLHFTEAAYRWIFKSIADGSFTVPKLDISC  789


 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ +L+ LRE +P   IIY DYYNAA+R Y SP K+GF   V+ ACCGG G YNY+ 
Sbjct  274  NEQLQRKLNHLRELHPRANIIYVDYYNAALRFYQSPDKFGFDGRVLRACCGGEGTYNYNI  333

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            L  C S ++ VCD+PSSY SWDG   TEAAY+WI  G+  G +T P+++  C
Sbjct  334  LEPCNS-NARVCDDPSSYASWDGIHFTEAAYRWIFKGVADGSFTVPKLDISC  384



>emb|CDM83548.1| unnamed protein product [Triticum aestivum]
Length=426

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLL +EL++LR+ +P   IIYADYY AAM +Y SP ++G  +   ACCGGGGPY     
Sbjct  275  NRLLIDELEKLRKLHPGMSIIYADYYGAAMEIYRSPEQFGIDHPSAACCGGGGPYGVSMT  334

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              CG     VCD+P  Y SWDG   +EAAYK IA GLL+G YT P I+
Sbjct  335  ARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  382



>ref|XP_010054333.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=388

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  LQ EL  LR++Y    IIY DYY   MRL+ SP++YGF K+T VACCG GGP+N++ 
Sbjct  280  NDYLQRELQVLRQKYSHAKIIYVDYYGDTMRLFESPTQYGFSKSTHVACCGAGGPFNFNV  339

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
             + CGS SS VC +PS+ I WDG  LTEAAY+ +A GLL  P+T+P++
Sbjct  340  RMMCGSTSS-VCKDPSASILWDGVHLTEAAYRHMAKGLLDSPFTSPRL  386



>ref|XP_009102890.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=389

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ E+ RLR++YP   +IYADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +
Sbjct  267  LKTEIKRLRKRYPHVNVIYADYYNSLYRLYQEPTKYGFKNRPLAACCGVGGQYNFTIGEE  326

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG      C NPS YI+WDG  LTEAA++ +A G+L GPY  P  N  C+
Sbjct  327  CGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNGPYAAPAFNWSCL  376



>ref|XP_002438501.1| hypothetical protein SORBIDRAFT_10g020950 [Sorghum bicolor]
 gb|EER89868.1| hypothetical protein SORBIDRAFT_10g020950 [Sorghum bicolor]
Length=399

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (67%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGP--YNYD  432
            NR L+ +LD L+++YP T I+Y DY+ AAM+    P K+GF   + ACCG GG   YN++
Sbjct  288  NRELKQQLDELQKKYPKTKIMYGDYFKAAMQFVVYPGKFGFSTALQACCGAGGQGNYNFN  347

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
                CG   ++VC NPSSY+SWDG  +TEAAYK +ADG L GPY  P I
Sbjct  348  LKKKCGEQGASVCSNPSSYVSWDGIHMTEAAYKKVADGWLNGPYAEPPI  396



>ref|XP_009109699.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=390

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 72/112 (64%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  L+NEL RL++ YP   IIYADYYN+    +  P+KYGFKN  + ACCG GG YN+  
Sbjct  265  NDQLKNELKRLQKLYPHVNIIYADYYNSIHTFFQEPAKYGFKNRPLAACCGVGGKYNFTV  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
              +CG      C NPS Y++WDG  LTEAAY+ IA GLL GPY TP  +  C
Sbjct  325  NEECGYRGVNYCQNPSEYVNWDGYHLTEAAYRKIAHGLLNGPYATPAFDWSC  376



>ref|XP_008225209.1| PREDICTED: GDSL esterase/lipase At5g45910 [Prunus mume]
Length=362

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 71/106 (67%), Gaps = 1/106 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N  L+  L  LR +YP   IIYADYY AAM  Y++P  YGFK+ T+ ACCGGGGPYN++ 
Sbjct  256  NSELKRALGALRLKYPHARIIYADYYGAAMPFYHAPQHYGFKSGTLRACCGGGGPYNFNN  315

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTP  291
               CG   ST C +PSSY +WDG  LTEAAY  IA GL+ G + TP
Sbjct  316  SARCGHIGSTACKDPSSYANWDGIHLTEAAYGHIAKGLIHGRFATP  361



>gb|EMT22154.1| GDSL esterase/lipase [Aegilops tauschii]
Length=387

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LL +EL+ LR+ +P   IIYADYY AAM +++SP ++G ++ ++ACCGGGGPY     
Sbjct  257  NKLLVDELENLRKLHPGVVIIYADYYGAAMEIFSSPEQFGIEDPLMACCGGGGPYGVSAS  316

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              CG     VC++P  Y SWDG   TEA YK IA+GLL+G YT P I+
Sbjct  317  AGCGHGDYKVCNDPQKYASWDGFHPTEATYKGIANGLLRGSYTQPPIS  364



>ref|XP_004248142.1| PREDICTED: GDSL esterase/lipase At1g28610 [Solanum lycopersicum]
Length=388

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N+LLQ EL  +R+ +P   IIYAD+YNAAM+ Y SP+ YGF K  +VACCG GGPYNY  
Sbjct  263  NKLLQMELHLVRQLHPSVTIIYADHYNAAMQFYLSPNTYGFTKGALVACCGAGGPYNYKL  322

Query  428  LVDCGSASS-TVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               CG  ++  +C +PS Y SWDG   TEAAYK IA  LL+G +T P +   C
Sbjct  323  FELCGDPTARNICSDPSIYASWDGMHFTEAAYKLIATSLLEGNFTFPSLPKIC  375



>ref|XP_009416172.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 11/111 (10%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLLQ+E++R+R  +P+  I YADYY +AMRL+ SP ++GFK  + ACC G         
Sbjct  256  NRLLQDEIERVRGLHPNATIAYADYYESAMRLFESPKQFGFKEPLSACCVG---------  306

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
              CG  S+ +C +PSSY SWDG  LTEAAY+ IA+GLLKGP   P +N  C
Sbjct  307  --CGGPSAKLCSDPSSYASWDGLHLTEAAYRTIANGLLKGPLAVPSLNQTC  355



>ref|XP_010478243.1| PREDICTED: GDSL esterase/lipase At1g28650 [Camelina sativa]
Length=367

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  L+ EL RL+  YP   IIYADYYN+  R +  P+KYGF+N  + ACCG GG YN+  
Sbjct  252  NEQLKTELKRLQNLYPHVNIIYADYYNSLYRFFQEPAKYGFRNRPLAACCGVGGQYNFTI  311

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
              +CG    + C NPS Y++WDG  LTEA Y+ +A GLL GPYT+P  +  C+
Sbjct  312  GKECGDKRVSYCQNPSVYVNWDGYHLTEATYRKMAQGLLNGPYTSPAFDWSCL  364



>gb|EEC71187.1| hypothetical protein OsI_03077 [Oryza sativa Indica Group]
Length=128

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 73/117 (62%), Gaps = 0/117 (0%)
 Frame = -1

Query  593  QNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  414
             +EL+ LR+ +PD  IIYADYY AAM ++ SP ++G +N +VACCGGGGPY       CG
Sbjct  1    MDELENLRKLHPDVAIIYADYYGAAMEIFLSPEQFGIENPLVACCGGGGPYGVSETARCG  60

Query  413  SASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  243
            +    VCD+P  Y SWDG   +EA YK IA GL+ G YT P I    I     T+LS
Sbjct  61   NGEYKVCDDPQLYGSWDGFHPSEAVYKAIATGLIWGSYTQPPIATTTISCLQITELS  117



>ref|XP_004965533.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=400

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGP--YNYD  432
            NR L+ +LD L+++YP T I+Y DY+ AAM+   +P K+GF   + ACCG GG   YN++
Sbjct  289  NRELKQQLDELQKKYPVTKIMYGDYFKAAMQFVVNPGKFGFSTALQACCGAGGQGNYNFN  348

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
                CG   ++VC NPSSY+SWDG  +TEAAYK +ADG L GPY  P I
Sbjct  349  LKKKCGEQGASVCSNPSSYVSWDGIHMTEAAYKKVADGWLNGPYAEPPI  397



>ref|XP_006656143.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=403

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGP--YNYD  432
            NR L+ +LD L+++YP+T I+Y DY+ AAM+   SP  +GF + + ACCG GG   YN++
Sbjct  293  NRELKQQLDELQKKYPETKIMYGDYFKAAMQFVVSPGNFGFSSAMQACCGAGGEGNYNFN  352

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
                CG   ++VC NPSSY+SWDG  +TEAAY+++A+G L GPY  P I
Sbjct  353  LKKKCGEDGASVCSNPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEPPI  401



>ref|XP_006644439.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Oryza brachyantha]
Length=405

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+ L +EL++LR+ +PD  IIYADYY A+M ++ SP ++G ++ +VACCGGGGPY     
Sbjct  274  NKHLTDELEKLRKLHPDVAIIYADYYGASMEIFLSPEQFGIEDPLVACCGGGGPYGVSAS  333

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
            V CG     VCD P  Y SWDG   +EAAYK I  GLL+G YT P  
Sbjct  334  VRCGHGEYKVCDGPEKYASWDGFHPSEAAYKAITIGLLRGSYTQPSF  380



>ref|NP_001168439.1| uncharacterized protein LOC100382211 [Zea mays]
 gb|ACN28246.1| unknown [Zea mays]
 gb|AFW82120.1| hypothetical protein ZEAMMB73_915676 [Zea mays]
Length=304

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N +L+  + RLR +YP T +++AD+Y    RL   P+K+GF +  + ACCGGGGPYNY+ 
Sbjct  192  NWMLREAVGRLRRKYPTTKLVFADFYRPVARLLRRPAKFGFTEEPIRACCGGGGPYNYNP  251

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CGS  +TVC +PS+++ WDG  LTEAAYK+IADG L G Y  P +
Sbjct  252  GAACGSPGATVCRDPSAHVHWDGIHLTEAAYKYIADGWLSGLYAYPPV  299



>gb|EEE55087.1| hypothetical protein OsJ_02829 [Oryza sativa Japonica Group]
Length=128

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 73/117 (62%), Gaps = 0/117 (0%)
 Frame = -1

Query  593  QNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVDCG  414
             +EL+ LR+ +PD  IIYADYY AAM ++ SP ++G +N +VACCGGGGPY       CG
Sbjct  1    MDELENLRKLHPDVAIIYADYYGAAMEIFLSPEQFGIENPLVACCGGGGPYGVSETARCG  60

Query  413  SASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTKLS  243
            +    VCD+P  Y SWDG   +EA YK IA GL+ G YT P I    I     T+LS
Sbjct  61   NGEYKVCDDPQLYGSWDGFHPSEAVYKAIATGLIWGSYTQPPIATTTISCLQITELS  117



>dbj|BAJ86481.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N ++Q +L  LR +YP   I+YADYY AAM    +P ++GFK   +  CCGGGGPYN++ 
Sbjct  274  NAMVQQKLQVLRLKYPKARIMYADYYGAAMSFAKNPKQFGFKQGPLKTCCGGGGPYNFNP  333

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC +PS+Y +WDG  LTEAAY  IAD +L GPYT+P++
Sbjct  334  TASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILHGPYTSPRL  381



>ref|XP_006415636.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
 gb|ESQ33989.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
Length=753

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 78/123 (63%), Gaps = 1/123 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  LQ EL+RLR+ YP   IIY DYYNA +RL   P+K+G  +  +  CCG GG YN+  
Sbjct  268  NEKLQTELNRLRKLYPHVNIIYGDYYNALLRLIQEPAKFGLMSRPLPVCCGSGGTYNFTF  327

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
             V CGS     CD+PS Y++WDG  +TE AY+ IA+GLLKGPY+ P  +  C+    + K
Sbjct  328  GVKCGSKGVGYCDDPSKYVNWDGVHMTETAYRLIAEGLLKGPYSIPPFDWSCLSSEIENK  387

Query  248  LSD  240
             S+
Sbjct  388  DSE  390


 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N+ LQ EL++L++ YP   IIYADYYNA  RL+  P+K+GF N  + ACCG GG YN+  
Sbjct  627  NKQLQAELNKLQKLYPHVNIIYADYYNAVSRLFQEPAKFGFMNRPLPACCGLGGSYNFTF  686

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG      C++P+ Y++WDG  LTE+AY+ IA+GLLKGPY  P  +  C+
Sbjct  687  GRKCGFQGVECCNDPTKYVNWDGVHLTESAYRLIAEGLLKGPYAIPPFDWSCL  739



>ref|XP_010455496.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ EL RLR+      IIYADYYNA + L   P+KYGF N  + ACCG G PYN++    
Sbjct  268  LEAELKRLRKLNHHVNIIYADYYNALLGLNQEPTKYGFINKPLSACCGVGEPYNFNFSTC  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSPKTK  249
            CGS     C++PS Y++WDG  +TEAAYK++ADG+LKGPYT+P  N  C+    K K
Sbjct  328  CGSFGVDSCNDPSKYVAWDGIHMTEAAYKFMADGILKGPYTSPPFNWTCLSSKIKNK  384



>ref|XP_002863442.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH39701.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=374

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 2/110 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGG-GPYNYD  432
            N  L+  L  LRE+YP   I+YADYY++AM+ +NSPSKYGF  +V+ ACCGGG G YN  
Sbjct  263  NDKLKKGLAALREKYPHAKIMYADYYSSAMQFFNSPSKYGFTGSVLKACCGGGDGRYNAK  322

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              V CG   ST C+NPS+Y +WDG  LTEAAY+ IA GL+ G +T P  N
Sbjct  323  PSVRCGEKGSTTCENPSTYANWDGIHLTEAAYRHIATGLISGRFTMPSYN  372



>gb|AAF24544.2|AC007508_7 F1K23.13 [Arabidopsis thaliana]
Length=1411

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  L+ EL RL++ YPD  IIYADY+N+  R Y  P+KYGFKN  + ACCG GG YN+  
Sbjct  562  NEQLKTELKRLQKLYPDVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTI  621

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
              +CG    + C NPS Y++WDG  LTEAAY+ +A+G+L GPY TP  +  C+
Sbjct  622  GKECGYEGVSYCQNPSEYVNWDGYHLTEAAYQKMAEGILNGPYATPAFDWSCL  674


 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  L+ EL RL++ YP   IIYADY+N+  R Y  P+KYGFKN  + ACCG GG YN+  
Sbjct  265  NEQLKTELKRLQKFYPHVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTI  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
              +CG      C NPS Y++WDG  LTEAAY+ + +G+L GPY TP  +  C+
Sbjct  325  GKECGYEGVNYCQNPSEYVNWDGYHLTEAAYQKMTEGILNGPYATPAFDWSCL  377


 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 69/112 (62%), Gaps = 1/112 (1%)
 Frame = -1

Query  605   NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
             N  L+ EL RL+E Y    IIYADYYN+  RLY  P KYGFKN  + ACCG GG YN+  
Sbjct  1286  NEQLKTELKRLQELYDHVNIIYADYYNSLFRLYQEPVKYGFKNRPLAACCGVGGQYNFTI  1345

Query  428   LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               +CG    + C NPS Y++WDG  LTEA ++ +A  +L G Y +P  +  C
Sbjct  1346  GKECGHRGVSCCQNPSEYVNWDGYHLTEATHQKMAQVILNGTYASPAFDWSC  1397


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 65/99 (66%), Gaps = 1/99 (1%)
 Frame = -1

Query  605   NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
             N  L+ EL +L++ YP   IIYADYYN+   L+  P+KYGFKN  + ACCG GG YN+  
Sbjct  914   NEQLKIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFKNRPLAACCGVGGQYNFTI  973

Query  428   LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLL  312
               +CG    + C NPS Y++WDG  LTEA Y+ +A GLL
Sbjct  974   GKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLL  1012



>ref|XP_011096449.1| PREDICTED: uncharacterized protein LOC105175645 [Sesamum indicum]
Length=1007

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV--ACCGGGGPYNYD  432
            N LLQ EL R+R  +P   IIYADYYNA +R Y SP ++GF    V  ACCGGGGPYNYD
Sbjct  259  NELLQKELFRIRHLHPRISIIYADYYNATIRFYLSPDQFGFTKESVLRACCGGGGPYNYD  318

Query  431  GLVDCG--SASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             L  CG    ++  C+NPS + SWDG   TEAA +WIA G ++  YT P I   C
Sbjct  319  PLTACGIDRPAANCCENPSLFASWDGIHFTEAANRWIAQGFIRQHYTHPPIKTLC  373


 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGG-GPYNYDG  429
            N LL+ EL R+RE +P T IIYADYYNA M LY SP ++GF    +  C GG GPYN + 
Sbjct  661  NDLLKKELARIRELHPHTTIIYADYYNAVMDLYRSPIEHGFAGGALGACCGGGGPYNCNL  720

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
             V CG   S  CD+PS Y++WDG   TEAAYKWIA GLLKGPYTTP ++  C
Sbjct  721  TVHCGYPPSNTCDDPSLYVNWDGMHFTEAAYKWIALGLLKGPYTTPPLSTVC  772



>ref|XP_010925692.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=360

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N+LL+ +L  L+++YP T IIY D YNAA +   +P KYGF N  + ACCGGGGPYN + 
Sbjct  251  NQLLKIKLQELQQKYPGTRIIYGDLYNAAKQFVVNPKKYGFTNGALKACCGGGGPYNVNL  310

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S VC++PS+Y SWDG   TEAA ++IADGLL+GP+  P I
Sbjct  311  DYRCGQTGSNVCNDPSTYASWDGIHFTEAANRYIADGLLRGPFGNPPI  358



>sp|Q3ZFI4.1|SCE3_BRANA RecName: Full=Sinapine esterase; Short=BnSCE3; AltName: Full=Lipase 
2; Short=BnLIP2; Flags: Precursor [Brassica napus]
 gb|AAX58135.1| lipase 2 [Brassica napus]
Length=389

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            L+ E+ RLR+ YP   I+YADYYN+  RLY  P+KYGFKN  + ACCG GG YN+    +
Sbjct  267  LKTEIRRLRKLYPHVNIMYADYYNSLYRLYQKPTKYGFKNRPLAACCGVGGQYNFTIGEE  326

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG      C NPS YI+WDG  +TEAA++ +A G+L GPY TP  N  C+
Sbjct  327  CGYEGVGYCQNPSEYINWDGYHITEAAHQKMAHGILNGPYATPAFNWSCL  376



>ref|XP_002439451.1| hypothetical protein SORBIDRAFT_09g006600 [Sorghum bicolor]
 gb|EES17881.1| hypothetical protein SORBIDRAFT_09g006600 [Sorghum bicolor]
Length=395

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N +L+  + R+R +YP T ++YAD+Y    RL   P+++GF +  + ACCGGGGPYNY+ 
Sbjct  283  NWMLREAVGRMRRKYPTTKLVYADFYKPVARLLRRPARFGFTEEPIRACCGGGGPYNYNP  342

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CGS  STVC  PS+++ WDG  LTEAAYK+IADG L G Y  P I
Sbjct  343  GAACGSPGSTVCREPSAHVHWDGIHLTEAAYKYIADGWLNGLYAYPSI  390



>ref|XP_008655207.1| PREDICTED: uncharacterized protein LOC100382211 isoform X1 [Zea 
mays]
Length=391

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N +L+  + RLR +YP T +++AD+Y    RL   P+K+GF +  + ACCGGGGPYNY+ 
Sbjct  279  NWMLREAVGRLRRKYPTTKLVFADFYRPVARLLRRPAKFGFTEEPIRACCGGGGPYNYNP  338

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CGS  +TVC +PS+++ WDG  LTEAAYK+IADG L G Y  P +
Sbjct  339  GAACGSPGATVCRDPSAHVHWDGIHLTEAAYKYIADGWLSGLYAYPPV  386



>emb|CDX90163.1| BnaA08g18210D [Brassica napus]
Length=390

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 70/112 (63%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  L+ EL RL++ YP   IIYADYYN+    +  P+KYGFKN  + ACCG GG YN+  
Sbjct  265  NEQLKTELKRLQKLYPHVNIIYADYYNSIHTFFQEPAKYGFKNRPLAACCGVGGKYNFTV  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
              +CG      C NPS Y++WDG  LTEAAY  IA GLL GPY TP  +  C
Sbjct  325  NEECGYGGVNYCQNPSEYVNWDGYHLTEAAYHKIAHGLLNGPYATPAFDWSC  376



>gb|AFW80395.1| esterase [Zea mays]
Length=367

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N +LQ +L  LR +YP   I+YADYY AAM    +P ++GF +  +  CCGGGGPYN++ 
Sbjct  259  NAVLQRKLRALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPLRTCCGGGGPYNFNP  318

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC +PS+Y +WDG  LTEAAY  IAD +L GPYT+P++
Sbjct  319  KASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  366



>ref|NP_174188.1| lipase ARAB-1 [Arabidopsis thaliana]
 sp|Q38894.1|GDL13_ARATH RecName: Full=GDSL esterase/lipase At1g28670; AltName: Full=Extracellular 
lipase At1g28670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA93262.1| lipase [Arabidopsis thaliana]
 dbj|BAC43359.1| putative lipase [Arabidopsis thaliana]
 gb|AEE31012.1| lipase ARAB-1 [Arabidopsis thaliana]
Length=384

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  L+ EL RL++ YP   IIYADY+N+  R Y  P+KYGFKN  + ACCG GG YN+  
Sbjct  265  NEQLKTELKRLQKFYPHVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTI  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
              +CG      C NPS Y++WDG  LTEAAY+ + +G+L GPY TP  +  C+
Sbjct  325  GKECGYEGVNYCQNPSEYVNWDGYHLTEAAYQKMTEGILNGPYATPAFDWSCL  377



>ref|XP_006643908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=377

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N +LQ++L  LR  YP+  I+YADYY AAM    +P ++GF++  +  CCGGGGPYN++ 
Sbjct  269  NAVLQDKLQLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNP  328

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC +PS+Y +WDG  LTEA Y  IA+ +L GPYT+P++
Sbjct  329  KASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  376



>ref|XP_008655208.1| PREDICTED: uncharacterized protein LOC100382211 isoform X2 [Zea 
mays]
Length=386

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N +L+  + RLR +YP T +++AD+Y    RL   P+K+GF +  + ACCGGGGPYNY+ 
Sbjct  274  NWMLREAVGRLRRKYPTTKLVFADFYRPVARLLRRPAKFGFTEEPIRACCGGGGPYNYNP  333

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CGS  +TVC +PS+++ WDG  LTEAAYK+IADG L G Y  P +
Sbjct  334  GAACGSPGATVCRDPSAHVHWDGIHLTEAAYKYIADGWLSGLYAYPPV  381



>ref|NP_001150078.1| esterase [Zea mays]
 gb|ACG37721.1| esterase precursor [Zea mays]
Length=397

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGP--YNYD  432
            NR L+ +LD L+++YP T I+Y DY+ AA++   +P K+GF   + ACCG GG   YN++
Sbjct  286  NRELKQQLDELQKKYPKTKIMYGDYFKAALQFVVNPGKFGFSTALQACCGAGGQGNYNFN  345

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
                CG   ++VC NPSSY+SWDG  +TEAAY+ +ADG L GPY  P I
Sbjct  346  LKKKCGEQGASVCSNPSSYVSWDGIHMTEAAYRKVADGWLNGPYAQPPI  394



>ref|XP_010052211.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76147.1| hypothetical protein EUGRSUZ_D00523 [Eucalyptus grandis]
Length=367

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  L+ EL  LREQYP   I+YADYY AAM +Y SP  YGF   T  ACCGGGGP+N++ 
Sbjct  258  NNYLKQELQNLREQYPHARIMYADYYGAAMTIYRSPKHYGFYGGTPRACCGGGGPHNFNT  317

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   +T C +PS+++ WDG   TE+AY  IA G++ G +T+P +
Sbjct  318  TAVCGQTGATACKDPSAFMDWDGIHFTESAYHHIAKGMINGGFTSPPL  365



>ref|XP_010499396.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=397

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVD  420
            LQ EL +L++ YP   IIYADYY A +R+Y  P K+GF N  + ACCG GGPYN+     
Sbjct  269  LQAELKKLQKLYPHVNIIYADYYKALLRIYQEPEKFGFMNRPLSACCGVGGPYNFTSFWQ  328

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG+     C+ PS Y++WDG  +TEAAY  IA+G+LKG Y  P  N  C+
Sbjct  329  CGTDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKGAYAVPPFNWSCL  378



>ref|NP_001149156.1| esterase precursor [Zea mays]
 gb|ACG34406.1| esterase precursor [Zea mays]
Length=370

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N +LQ +L  LR +YP   I+YADYY AAM    +P ++GF +  +  CCGGGGPYN++ 
Sbjct  262  NAVLQRKLRALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPLRTCCGGGGPYNFNP  321

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC +PS+Y +WDG  LTEAAY  IAD +L GPYT+P++
Sbjct  322  KASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  369



>ref|XP_010478242.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L+ EL RL++ YP   IIYADY+N+  R +  P+KYGFKN + ACCG GG YN+   
Sbjct  265  NEQLKTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGFKNPLAACCGVGGQYNFTID  324

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             +CG      C NPS +++WDG  LTEA Y+ +A  LL GPY TP  +  C+
Sbjct  325  KECGYEGVGYCQNPSEHVNWDGYHLTEATYQKMAHSLLNGPYATPAFDWSCL  376



>ref|XP_009601721.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=389

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N LLQ EL  LR+ +P   IIYADYYNAAM+ Y SP  +GF K  + ACCG GGPYN+  
Sbjct  265  NELLQKELHLLRKLHPSATIIYADYYNAAMQFYVSPMSHGFTKGALDACCGAGGPYNFKF  324

Query  428  LVDCGS-ASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
               CG   +  +C + S Y SWDG   TEAAYKWIA GLL+G +T P +   C
Sbjct  325  SAVCGDPPARNICSDTSLYASWDGMHFTEAAYKWIARGLLEGTFTFPPLAKIC  377



>emb|CDY30822.1| BnaC05g21980D [Brassica napus]
Length=401

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVD  420
            LQ EL++LRE YP   IIYADYYNA +RL+  P  +GF +  + ACCG GGPYN+     
Sbjct  273  LQAELNKLRELYPHVNIIYADYYNALLRLFQEPGNFGFIDRPLHACCGFGGPYNFTFGRK  332

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG      C +PS YI WDG  +TEA Y+ +A+G+LKGPY  P  +  C+
Sbjct  333  CGFKGVESCSDPSKYICWDGVHMTEATYRLMAEGILKGPYAIPPFDWSCL  382



>ref|XP_010499397.1| PREDICTED: GDSL esterase/lipase At1g28670 [Camelina sativa]
Length=389

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L+ EL RL++ YP   IIYADY+N+  R +  P+KYGFKN + ACCG GG YN+   
Sbjct  265  NEQLKTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGFKNPLAACCGVGGQYNFTID  324

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             +CG      C NPS +++WDG  LTEA Y+ +A  LL GPY TP  +  C+
Sbjct  325  KECGYEGVGYCQNPSEHVNWDGYHLTEATYQKMAQSLLNGPYATPAFDWSCL  376



>ref|XP_010460659.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L+ EL RL++ YP   IIYADY+N+  R +  P+KYGFKN + ACCG GG YN+   
Sbjct  265  NEQLKTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGFKNPLAACCGVGGQYNFTID  324

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
             +CG      C NPS +++WDG  LTEA Y+ +A  LL GPY TP  +  C+
Sbjct  325  KECGYEGVGYCQNPSEHVNWDGYHLTEATYQKMAQSLLNGPYATPAFDWSCL  376



>ref|NP_001042396.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAF04310.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAG87737.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N +LQ++L  LR  YP+  I+YADYY AAM    +P ++GF++  +  CCGGGGPYN++ 
Sbjct  270  NAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNP  329

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC +PS+Y +WDG  LTEA Y  IA+ +L GPYT+P++
Sbjct  330  KASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  377



>dbj|BAA94228.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAY73022.1| hypothetical protein OsI_00894 [Oryza sativa Indica Group]
Length=374

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N +LQ++L  LR  YP+  I+YADYY AAM    +P ++GF++  +  CCGGGGPYN++ 
Sbjct  266  NAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNP  325

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC +PS+Y +WDG  LTEA Y  IA+ +L GPYT+P++
Sbjct  326  KASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  373



>ref|XP_002305752.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE86263.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=380

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 72/113 (64%), Gaps = 6/113 (5%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYG------FKNTVVACCGGGGP  444
            N  L+  L  LR++YP   IIYADYY AA R Y++P  +G         T+ ACCGGGGP
Sbjct  263  NNQLKTALQMLRQKYPHARIIYADYYGAAKRFYHAPQHHGKSFELFVSGTLTACCGGGGP  322

Query  443  YNYDGLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
            YN++    CG   S  C NPSS+ +WDG  LTEAAY++IA GL+ G +TTP +
Sbjct  323  YNFNNSARCGHIGSRTCSNPSSHANWDGIHLTEAAYRYIAMGLVSGSFTTPPL  375



>ref|XP_009333827.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Pyrus x bretschneideri]
Length=392

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N +LQ +L  LR Q+P   I YADY+NA   +  SPS+YGFK    ACCG G PYN+D  
Sbjct  275  NLVLQAKLHELRTQFPHAVIAYADYWNAYFTVMKSPSQYGFKERFKACCGSGDPYNFDVS  334

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTP  291
              CG+ S+TVC +PS YI+WDG  LTEA YK ++D  LKG  T P
Sbjct  335  ATCGTPSATVCKSPSQYINWDGVHLTEAMYKVLSDTFLKGNATHP  379



>ref|XP_010462953.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=370

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  LQ EL+RL++ YP   IIYADYYN    ++  P+K+GF N  + ACCG GGPYNY  
Sbjct  240  NEQLQVELNRLQKLYPHVNIIYADYYNVLSSIFQEPAKFGFINRPLSACCGFGGPYNYTV  299

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               CG+     C +PS Y++WDG  LTEAAY  IA+G+L GPYT P  +  C+
Sbjct  300  GKKCGTDVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSGPYTIPPFDWSCL  352



>gb|EEE54111.1| hypothetical protein OsJ_00875 [Oryza sativa Japonica Group]
Length=374

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N +LQ++L  LR  YP+  I+YADYY AAM    +P ++GF++  +  CCGGGGPYN++ 
Sbjct  266  NAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFRHGALRTCCGGGGPYNFNP  325

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC +PS+Y +WDG  LTEA Y  IA+ +L GPYT+P++
Sbjct  326  KASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGPYTSPRL  373



>emb|CDY43309.1| BnaC03g58810D [Brassica napus]
Length=390

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 71/112 (63%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  L+ EL RL++ YP   IIYADYYN+    +  P+KYGFKN  + ACCG GG YN+  
Sbjct  265  NDQLKTELKRLQKLYPHVNIIYADYYNSIYTFFQEPAKYGFKNRPLAACCGVGGKYNFTV  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
              +CG      C NPS Y++WDG  LTEAAY+ IA GLL GPY TP  +  C
Sbjct  325  NEECGYRGVNYCQNPSEYVNWDGYHLTEAAYRKIAHGLLNGPYATPAFDWSC  376



>ref|XP_010041182.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  L+ EL +LREQYP   I+YADYY A++ +Y +P  YGF    + ACCGGGGPYN++ 
Sbjct  257  NNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNT  316

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG + STVC +PS+++ WDG   TEAAY +IA GL+ G + +P +
Sbjct  317  SAYCGQSGSTVCKDPSAFVDWDGIHSTEAAYHYIARGLIDGGFISPPL  364



>ref|XP_003569458.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Brachypodium 
distachyon]
Length=395

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGG-PYNYDG  429
            N+LL  EL++LR+ +P   IIYADYY AAM +Y+SP ++  +N +VACCGGG  PY    
Sbjct  262  NKLLVGELEKLRKLHPGVAIIYADYYGAAMEIYSSPEQFEIENPLVACCGGGEEPYGVSR  321

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG     VC +P  Y SWDG   TEA YK IADGLL+GPYT P I
Sbjct  322  AAGCGHGEYKVCSDPQKYGSWDGFHPTEAVYKAIADGLLRGPYTQPAI  369



>gb|KGN49290.1| hypothetical protein Csa_6G519430 [Cucumis sativus]
Length=326

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 5/117 (4%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVAC-CGGGGPYNYDG  429
            N+ LQ EL+R+R ++P+  IIYADY+N+AM+ YN P  +G KNT+ AC          DG
Sbjct  197  NKYLQEELNRIRSRHPNVQIIYADYHNSAMQFYNHPENFGLKNTLEACLVDRNETLKKDG  256

Query  428  LVDCGSASSTV----CDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
                G  + T     CD+PS Y+SWDG  LTEAAY+ IA GLL+GPYT PQ    CI
Sbjct  257  KYGLGGKTKTKTKIECDDPSKYVSWDGVHLTEAAYRLIAMGLLQGPYTHPQFTTSCI  313



>ref|NP_001043721.1| Os01g0649900 [Oryza sativa Japonica Group]
 dbj|BAB89190.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05635.1| Os01g0649900 [Oryza sativa Japonica Group]
 gb|EAY75183.1| hypothetical protein OsI_03073 [Oryza sativa Indica Group]
 gb|EAZ12905.1| hypothetical protein OsJ_02826 [Oryza sativa Japonica Group]
Length=400

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LL +EL+ LR+ + D  IIYADYY AAM ++ SP ++G ++ +VACCGG GPY     
Sbjct  269  NKLLVDELENLRKLHLDVTIIYADYYGAAMEVFLSPERFGIEDPLVACCGGRGPYGVSAS  328

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
            V CG     VCD+P+ Y SWDG   +EAAYK IA GLL+G YT P I
Sbjct  329  VRCGYGEYKVCDDPAKYASWDGFHPSEAAYKGIAIGLLQGSYTQPPI  375



>ref|XP_004968625.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=374

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N +LQ +L  LR +YP   I+YADYY AAM    +P ++GF +  +  CCGGGGPYN++ 
Sbjct  266  NAVLQQKLQALRAKYPQARIMYADYYGAAMSFAKNPKQFGFTQGPLRTCCGGGGPYNFNP  325

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC +PS+Y +WDG  LTEAAY  IA+ +L GPYT+P++
Sbjct  326  KASCGVRGSSVCTDPSAYANWDGVHLTEAAYHAIANSILNGPYTSPRL  373



>ref|XP_008361146.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g48460-like, 
partial [Malus domestica]
Length=232

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N +LQ +L  LR Q+P   I YADY+NA + +  SPS+YGF     ACCG G PYN+D  
Sbjct  115  NLVLQAKLHELRTQFPHAVIAYADYWNAYLTVMKSPSQYGFTERFKACCGSGDPYNFDVS  174

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTP  291
              CG  S+TVC +PS YI+WDG  LTEA YK ++D  LKG  T P
Sbjct  175  ATCGXPSATVCKSPSQYINWDGVHLTEAMYKVLSDTFLKGNATHP  219



>ref|XP_002457137.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
 gb|EES02257.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
Length=379

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N +LQ  L  LR +YP   I+YADYY AAM    +P ++GF +  +  CCGGGGPYN++ 
Sbjct  271  NAVLQQNLRALRVKYPQARIMYADYYGAAMSFAKNPKQFGFTEGPLRTCCGGGGPYNFNP  330

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   S+VC +PS+Y +WDG  LTEAAY  IAD +L GPYT+P++
Sbjct  331  KASCGVRGSSVCTDPSAYANWDGVHLTEAAYHAIADSILNGPYTSPRL  378



>ref|XP_010925696.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -1

Query  599  LLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGLVD  420
            LL+  LD LR +YP   I+YADYY A++++  SP ++GF + ++ACCGG GPYN+  L  
Sbjct  268  LLRRALDELRRKYPRARIMYADYYGASIQIGRSPQRFGFDDVLIACCGGDGPYNFSPLAF  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
            CG   S+VC   SS  +WDG  LTEAAY +IA  LL GPYT+P +
Sbjct  328  CGQPGSSVCSCLSSRANWDGLHLTEAAYHFIATSLLDGPYTSPPL  372



>gb|ACU18341.1| unknown [Glycine max]
Length=212

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGP-YNYDG  429
            N +LQ++L   R+QYP   I+YADYY+A   +  +PSKYGFK T   CCG G P YN+  
Sbjct  94   NLVLQDKLQEFRKQYPQAVILYADYYDAYRTVMKNPSKYGFKETFNVCCGSGEPPYNFTV  153

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
               CG+ ++TVC +PS YI+WDG  LTEA YK I+   L+G +T P  N
Sbjct  154  FATCGTPNATVCSSPSQYINWDGVHLTEAMYKVISSMFLQGNFTQPPFN  202



>ref|XP_010915608.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=368

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N+LL+  +  LR +YP+  I+YAD+Y   ++   SP ++GF N  +++CCGGGGPYN++ 
Sbjct  254  NKLLRRTVKNLRSKYPEVRIVYADFYEPVIQFVRSPERFGFSNGALISCCGGGGPYNFNP  313

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               C    +TVC +PS  I WDG  LTEAAY++IA G L+GPY  P I
Sbjct  314  RARCAEPGATVCKDPSKSIFWDGIHLTEAAYRYIATGWLQGPYANPPI  361



>emb|CDY43308.1| BnaC03g58800D [Brassica napus]
Length=399

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = -1

Query  596  LQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDGLVD  420
            L+ EL RLR+ YP   IIYADYYN+  R +  P+KYGFK   + ACCG GG YN+    +
Sbjct  268  LKTELKRLRKLYPHVNIIYADYYNSMYRFFQEPAKYGFKERPLGACCGVGGQYNFTIGEE  327

Query  419  CGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            CG      C NPS Y++WDG  LTEA ++ +A GLLKGPY TP  +  C+
Sbjct  328  CGYQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLKGPYATPAFDWSCL  377



>dbj|BAK06933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLL +EL++LR  +    IIYADYY AAM +Y SP ++G  + + ACCGGGGPY     
Sbjct  270  NRLLIDELEKLRNFHHGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGVSMT  329

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              CG     VCD+P  Y SWDG   +EAAYK IA GLL+G YT P I+
Sbjct  330  ARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  377



>dbj|BAJ93079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLL +EL++LR  +    IIYADYY AAM +Y SP ++G  + + ACCGGGGPY     
Sbjct  270  NRLLIDELEKLRNFHHGVSIIYADYYGAAMEIYRSPEQFGIDHPLAACCGGGGPYGVSMT  329

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
              CG     VCD+P  Y SWDG   +EAAYK IA GLL+G YT P I+
Sbjct  330  ARCGYGEYKVCDDPQKYGSWDGFHPSEAAYKGIAIGLLRGTYTQPSIS  377



>gb|KCW76151.1| hypothetical protein EUGRSUZ_D00528 [Eucalyptus grandis]
Length=263

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  L+ EL +LREQYP   ++YADYY A++ +Y +P  YGF    + ACCGGGGPYN++ 
Sbjct  154  NNYLKQELQKLREQYPHARVMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNT  213

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG   STVC +PS+++ WDG   TE+AY +IA GL+ G + +P +
Sbjct  214  SAYCGQPGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  261



>gb|ACF85857.1| unknown [Zea mays]
 gb|AFW86784.1| esterase [Zea mays]
Length=397

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGP--YNYD  432
            NR L+ +LD L+++YP T I+Y DY+ AA++   +P K+GF   + ACCG GG   YN++
Sbjct  286  NRELKQQLDELQKKYPKTKIMYGDYFKAALQFVVNPGKFGFSTALQACCGAGGQGNYNFN  345

Query  431  GLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
                CG   ++VC NPSSY+SWDG  +TEAAY+ +A+G L GPY  P I
Sbjct  346  LKKKCGEQGASVCSNPSSYVSWDGIHMTEAAYRKVANGWLNGPYAQPPI  394



>gb|KJB62810.1| hypothetical protein B456_009G437600 [Gossypium raimondii]
Length=391

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  LQ +LD++R+ + +  IIYADYYN AMR Y+S +++GF  T+ ACCGGGG YNY   
Sbjct  270  NEQLQEKLDQVRKLHRNVNIIYADYYNTAMRFYHSLNQFGFTETLRACCGGGGRYNYSSS  329

Query  425  VDCGSAS-STVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            + CG    +T C++PSS++SWDG   TEA Y+WI+ G+L+  Y  P  N  C 
Sbjct  330  MACGDLPLTTSCNDPSSHVSWDGLHYTEATYRWISKGVLEELYAIPYTNSLCF  382



>ref|XP_006603997.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max]
Length=365

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 77/125 (62%), Gaps = 10/125 (8%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN----TVVACCGGGGPYN  438
            N  L+  ++ LR++ PD  I Y DYY A  RL+ +P +YGF +    T  ACCG G PYN
Sbjct  247  NEQLKKAIETLRQENPDVKITYFDYYGATKRLFQAPQQYGFSSGKIETFRACCGKGEPYN  306

Query  437  YDGLVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECIFRSP  258
                + CGS ++TVC NP  YI+WDG   TEAAYK IA GL++GP+ +P +      +SP
Sbjct  307  LSAQIACGSLAATVCSNPLKYINWDGPHFTEAAYKLIAKGLIEGPFASPSL------KSP  360

Query  257  KTKLS  243
              K++
Sbjct  361  PFKIA  365



>ref|XP_006415637.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
 gb|ESQ33990.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
Length=387

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N  LQ EL+RL+   P   I+YADY+NA +  +  P+++GF N  + ACCG GGPY ++ 
Sbjct  266  NEELQAELNRLQRLNPRVTILYADYHNALLHTFQEPTRFGFMNRPLSACCGSGGPYKFNS  325

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
            +  CG+     C +PS Y+ WDG  LTE+AY+WIA GLL+G YT P  +  C+
Sbjct  326  VRQCGTKGVDCCVDPSKYVHWDGFHLTESAYRWIALGLLEGNYTVPAFDWSCL  378



>ref|XP_004485880.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=375

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N+ L   L+ LR++ P   IIYA+Y+ AA R +++P  YGF N    ACCGGGGPYN++ 
Sbjct  260  NKQLNLALETLRQKNPHARIIYANYFGAANRFFHAPRHYGFTNGASRACCGGGGPYNFNN  319

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQIN  282
               CG ++S  C +P++Y +WDG  LTEAAY+ IA GL++GP+T P +N
Sbjct  320  SARCGHSNSKACADPTTYANWDGIHLTEAAYRHIAKGLIEGPFTNPPLN  368



>ref|XP_010052212.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=392

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N  L+ EL +LREQYP   I+YADYY A++ +Y +P  YGF    + ACCGGGGPYN++ 
Sbjct  257  NNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGFYGGALTACCGGGGPYNFNT  316

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CG + STVC +PS+++ WDG   TE+AY +IA GL+ G + +P +
Sbjct  317  SAYCGQSGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDGGFISPPL  364



>ref|XP_004963464.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=390

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGF-KNTVVACCGGGGPYNYDG  429
            N +L+  +  +R +YP T ++YAD+Y    RL   P K+GF +  + ACCGGGGPYNY+ 
Sbjct  278  NWMLREAVGHMRAKYPATKLVYADFYRPVARLVRRPRKFGFTEEPLRACCGGGGPYNYNT  337

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CGS  +TVC +PS Y+ WDG  LTEAAYK+IADG L G Y  P I
Sbjct  338  EAACGSPDATVCGDPSKYVHWDGIHLTEAAYKYIADGWLDGLYAYPSI  385



>ref|XP_011086014.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Sesamum indicum]
Length=373

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKN-TVVACCGGGGPYNYDG  429
            N  L+  L+ LR +YP   IIYADYY AA++ +++P  YGF N  +VACCGGGGPYN++ 
Sbjct  258  NSNLKLALENLRHKYPHAKIIYADYYAAAIKFFHAPHHYGFWNGALVACCGGGGPYNFNN  317

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
               CGS  S  C +P++Y +WDG  LTE+AY+ I  GL+ GP+T P +
Sbjct  318  SAICGSPGSKTCLDPTTYANWDGIHLTESAYRVITMGLVNGPFTHPPL  365



>ref|XP_008812189.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=386

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = -1

Query  569  EQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDGLVDCGSASSTVC  393
            + +P   IIYADYY A + ++ SP+++GFK   + ACCGGGGPYN    V CG  ++TVC
Sbjct  275  QLHPHATIIYADYYKALLHIFRSPTQFGFKKAPLAACCGGGGPYNAS--VACGDRAATVC  332

Query  392  DNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
            ++PS Y+SWDG  LTEAAYK IA GLL+GP TTP I   C
Sbjct  333  NDPSRYVSWDGMHLTEAAYKTIAQGLLEGPDTTPPITQAC  372



>ref|XP_003593742.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63993.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=374

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVA-CCGGGGPYNYDG  429
            N  L   L  LR + P   I+YADY+ AAMR ++SP +YGF N  ++ CCGGGG YN++ 
Sbjct  259  NMQLNFALQTLRTKNPHARIMYADYFGAAMRFFHSPRQYGFTNGALSVCCGGGGRYNFND  318

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
              +CGS  S VC +PS+Y +WDG  LTEAAY+ IA GL+ GP++ P +
Sbjct  319  SAECGSKGSKVCADPSTYTNWDGIHLTEAAYRHIAKGLINGPFSIPPL  366



>ref|XP_008393854.1| PREDICTED: GDSL esterase/lipase At3g48460-like [Malus domestica]
Length=390

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N +LQ +L  LR Q+P   I YADY+NA + +  SPS+YGF     ACCG G PYN+D  
Sbjct  273  NLVLQAKLHELRTQFPHAVIAYADYWNAYLTVMKSPSQYGFTERFKACCGSGDPYNFDVS  332

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTP  291
              CG+ S+TVC +PS YI+WDG  LTEA YK ++D  LKG  T P
Sbjct  333  ATCGTPSATVCKSPSQYINWDGVHLTEAMYKVLSDTFLKGNATHP  377



>emb|CDO96750.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            NRLLQ EL+R+R+  P   IIYADYYNAAMRLY SP+KYGF+   + ACCG GGPYN + 
Sbjct  270  NRLLQKELNRIRKLLPHATIIYADYYNAAMRLYRSPNKYGFRGEALRACCGTGGPYNCNT  329

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADG  318
             + CG   +T C +PS Y++WDG  LTEAAY++ + G
Sbjct  330  SIPCGYLPATPCKDPSLYVTWDGLHLTEAAYQFGSSG  366



>ref|XP_009411654.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            NRLL  ELDRLR+ +P+  IIYA+YY+A +  + +P  +GFK  + ACCG  GPY+ +  
Sbjct  260  NRLLLAELDRLRKLHPNVMIIYANYYDAMISFFRAPEVFGFKAPLHACCGSDGPYSVNRN  319

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
              CG  ++ VC +PSS +SWDG  LTEAAY  IA  LL+GP+  P +   C
Sbjct  320  APCGHRNAKVCSDPSSSVSWDGIHLTEAAYGTIASSLLEGPHANPPLTRAC  370



>ref|XP_002893540.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69799.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1392

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
            N+ L+ EL+RL++ YP   IIYADY+N   R Y  P+KYGFK   + ACCG GG YN+  
Sbjct  265  NKQLKTELERLQKLYPHVNIIYADYHNTLYRFYQEPAKYGFKKRPLAACCGVGGQYNFTI  324

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
              +CG    + C NPS Y++WDG  LTEAAYK +A+G+L GPY  P  +  C+
Sbjct  325  GKECGYEGVSYCQNPSEYVNWDGYHLTEAAYKKMAEGILNGPYAIPSFDWSCL  377


 Score =   119 bits (297),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  605   NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
             N  L+ EL +L++ YP   IIYADYYN+  R +  P+KYGFKN  + ACCG GG YN+  
Sbjct  917   NEQLKIELKQLQKLYPHVNIIYADYYNSLYRFFQEPAKYGFKNRPLAACCGVGGQYNFTI  976

Query  428   LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               +CG    + C NPS Y++WDG  LTEA Y+ +A  LL GPYTTP  +  C+
Sbjct  977   GKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQDLLNGPYTTPAFDWSCL  1029


 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = -1

Query  605   NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNT-VVACCGGGGPYNYDG  429
             N  L+ EL RL+E Y    IIYADYYN+   LY  P KYGF+N  + ACCG GG YN+  
Sbjct  1267  NEELKTELKRLQELYDHVNIIYADYYNSLFLLYQEPVKYGFRNRPLAACCGIGGQYNFTI  1326

Query  428   LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGECI  270
               +CG    + C NPS Y++WDG  LTEA ++ +A  LL GPY TP  +  C 
Sbjct  1327  SEECGHREVSYCQNPSEYVNWDGYHLTEATHQKMAQVLLNGPYATPAFDWSCF  1379


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKY  489
            N  L+ EL RL++ YPD  IIYADY+N+  R Y  P+KY
Sbjct  624  NEQLKTELKRLQKLYPDVNIIYADYHNSLYRFYQEPAKY  662



>ref|XP_002456052.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
 gb|EES01172.1| hypothetical protein SORBIDRAFT_03g029580 [Sorghum bicolor]
Length=399

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N+LL  EL +LR+ +P   IIYADYY AAM ++ SP +YG ++ +VACCGG GPY     
Sbjct  268  NKLLVEELKKLRKLHPGVTIIYADYYGAAMEIFLSPEQYGIEHPLVACCGGEGPYGVSPT  327

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
            + CG     +CDNP  Y SWDG   +E+AY+ IA GLL G YT P I
Sbjct  328  ITCGFGEYKLCDNPEKYGSWDGFHPSESAYRAIATGLLLGSYTRPSI  374



>gb|KJB57433.1| hypothetical protein B456_009G164000 [Gossypium raimondii]
Length=379

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N  L+ EL+ +R  +P   IIYADYY A+M LY SP  +GFK+T+ ACCGG GPYN +  
Sbjct  266  NEYLKKELESMRRLHPRINIIYADYYQASMPLYLSPRSFGFKSTLTACCGGEGPYNVNVT  325

Query  425  VDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQI  285
            + CG   +  CD+PSSY++WDG+  T+ A++ I++GLL G  T P+ 
Sbjct  326  LSCGDPGTKSCDDPSSYVNWDGAHFTDEAHRVISNGLLDGSCTIPRF  372



>ref|XP_002317430.2| hypothetical protein POPTR_0011s07610g, partial [Populus trichocarpa]
 gb|EEE98042.2| hypothetical protein POPTR_0011s07610g, partial [Populus trichocarpa]
Length=210

 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVV-ACCGGGGPYNYDG  429
            N  L  EL +++  YP   IIYADYYNA M LY+SP+++GF   V+ ACCG GG YNY+ 
Sbjct  89   NEQLLAELKQIQNLYPHAKIIYADYYNAVMPLYHSPNQFGFTGGVLRACCGWGGTYNYNS  148

Query  428  LVDCGSASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLKGPYTTPQINGEC  273
              +CG+  ++VCD+PS Y++WDG   TEAAYK I + +++G Y+ P     C
Sbjct  149  SAECGNPLASVCDDPSFYVNWDGIHYTEAAYKLIFESVIEGSYSFPSFKALC  200



>gb|KHG23842.1| hypothetical protein F383_29871 [Gossypium arboreum]
Length=379

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = -1

Query  605  NRLLQNELDRLREQYPDTXIIYADYYNAAMRLYNSPSKYGFKNTVVACCGGGGPYNYDGL  426
            N LL+ EL++LR ++PD  I+YADYYN AMR Y+SP ++GFK T+ ACCG GG YNY+  
Sbjct  269  NELLRTELEKLRNRHPDINIVYADYYNIAMRFYHSPKQFGFKETLKACCGIGGLYNYNSS  328

Query  425  VDCG-SASSTVCDNPSSYISWDGSXLTEAAYKWIADGLLK  309
              CG     + C++PSSYISWDG   TEAA KW+A+ + +
Sbjct  329  RSCGYPPLKSSCNDPSSYISWDGIHYTEAANKWLANVVFE  368



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800