BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019N23

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006352713.1|  PREDICTED: uncharacterized protein LOC102605986    197   8e-55   Solanum tuberosum [potatoes]
ref|XP_009769918.1|  PREDICTED: uncharacterized protein LOC104220702    196   2e-54   Nicotiana sylvestris
ref|XP_009601758.1|  PREDICTED: uncharacterized protein LOC104096985    192   4e-53   Nicotiana tomentosiformis
ref|XP_004242382.1|  PREDICTED: ribonuclease inhibitor                  191   8e-53   Solanum lycopersicum
gb|KDP26432.1|  hypothetical protein JCGZ_17590                         187   1e-51   Jatropha curcas
gb|KDO65820.1|  hypothetical protein CISIN_1g0074791mg                  182   4e-51   Citrus sinensis [apfelsine]
ref|XP_006443678.1|  hypothetical protein CICLE_v10019392mg             182   5e-50   
ref|XP_006480172.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    183   7e-50   
ref|XP_006443679.1|  hypothetical protein CICLE_v10019392mg             183   8e-50   Citrus clementina [clementine]
ref|XP_006480171.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    182   9e-50   Citrus sinensis [apfelsine]
ref|XP_011083100.1|  PREDICTED: uncharacterized protein LOC105165...    181   3e-49   Sesamum indicum [beniseed]
ref|XP_011083098.1|  PREDICTED: uncharacterized protein LOC105165...    181   6e-49   Sesamum indicum [beniseed]
ref|XP_007201725.1|  hypothetical protein PRUPE_ppa003067mg             175   4e-47   Prunus persica
ref|XP_008235539.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    174   9e-47   Prunus mume [ume]
ref|XP_010243650.1|  PREDICTED: uncharacterized protein LOC104587...    172   7e-46   
ref|XP_010243649.1|  PREDICTED: uncharacterized protein LOC104587...    172   7e-46   
ref|XP_010243648.1|  PREDICTED: uncharacterized protein LOC104587...    172   7e-46   
ref|XP_010652448.1|  PREDICTED: protein NLRC3 isoform X1                171   1e-45   Vitis vinifera
ref|XP_007050066.1|  RNI-like superfamily protein, putative             168   2e-44   
gb|KJB42369.1|  hypothetical protein B456_007G151600                    168   2e-44   Gossypium raimondii
gb|KJB42368.1|  hypothetical protein B456_007G151600                    167   2e-44   Gossypium raimondii
ref|XP_002521155.1|  protein binding protein, putative                  167   3e-44   
ref|XP_008382798.1|  PREDICTED: protein NLRC3                           163   6e-44   
emb|CDP21849.1|  unnamed protein product                                156   9e-44   Coffea canephora [robusta coffee]
ref|XP_010091857.1|  Ribonuclease inhibitor                             160   1e-41   
ref|XP_004290025.1|  PREDICTED: protein NLRC5 isoform X1                159   2e-41   Fragaria vesca subsp. vesca
ref|XP_004493854.1|  PREDICTED: uncharacterized protein LOC101511205    157   9e-41   Cicer arietinum [garbanzo]
ref|XP_010069680.1|  PREDICTED: uncharacterized protein LOC104456...    156   4e-40   Eucalyptus grandis [rose gum]
ref|XP_006604527.1|  PREDICTED: protein NLRC3-like                      154   1e-39   Glycine max [soybeans]
ref|XP_010684911.1|  PREDICTED: uncharacterized protein LOC104899423    151   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007162646.1|  hypothetical protein PHAVU_001G168300g             150   4e-38   Phaseolus vulgaris [French bean]
gb|KGN44555.1|  hypothetical protein Csa_7G330390                       147   3e-37   Cucumis sativus [cucumbers]
emb|CDY65850.1|  BnaCnng48880D                                          147   4e-37   Brassica napus [oilseed rape]
ref|XP_004154489.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    147   4e-37   
ref|XP_004139728.1|  PREDICTED: uncharacterized protein LOC101206924    147   4e-37   Cucumis sativus [cucumbers]
ref|XP_003520623.1|  PREDICTED: protein NLRC3-like                      146   7e-37   Glycine max [soybeans]
gb|KHN09410.1|  Protein NLRC5                                           146   7e-37   Glycine soja [wild soybean]
ref|XP_008461989.1|  PREDICTED: protein NLRC3 isoform X1                145   2e-36   Cucumis melo [Oriental melon]
gb|AAD21766.1|  hypothetical protein                                    140   5e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KDO65821.1|  hypothetical protein CISIN_1g0074791mg                  139   9e-36   Citrus sinensis [apfelsine]
ref|NP_001066441.1|  Os12g0228900                                       139   1e-35   
ref|XP_010540942.1|  PREDICTED: protein NLRC3 isoform X1                143   1e-35   Tarenaya hassleriana [spider flower]
emb|CDY31987.1|  BnaA07g00080D                                          142   3e-35   Brassica napus [oilseed rape]
ref|XP_009102053.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    142   3e-35   Brassica rapa
ref|XP_006664439.1|  PREDICTED: protein NLRC3-like                      142   3e-35   
ref|XP_010416119.1|  PREDICTED: uncharacterized protein LOC104702...    141   5e-35   
ref|XP_010416125.1|  PREDICTED: uncharacterized protein LOC104702...    141   6e-35   
ref|XP_010416111.1|  PREDICTED: uncharacterized protein LOC104702...    141   6e-35   Camelina sativa [gold-of-pleasure]
dbj|BAF00875.1|  hypothetical protein                                   140   9e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480175.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   1e-34   
ref|XP_011014860.1|  PREDICTED: uncharacterized protein LOC105118...    140   1e-34   Populus euphratica
ref|XP_011014859.1|  PREDICTED: uncharacterized protein LOC105118...    140   1e-34   Populus euphratica
ref|NP_179611.2|  RNI-like superfamily protein                          140   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489083.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   1e-34   
ref|XP_010489082.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    140   2e-34   
ref|XP_011014863.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   2e-34   Populus euphratica
ref|XP_011014862.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   2e-34   Populus euphratica
ref|XP_011014861.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   2e-34   Populus euphratica
ref|XP_010489080.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   2e-34   
ref|XP_002443071.1|  hypothetical protein SORBIDRAFT_08g007590          139   2e-34   
ref|XP_010495912.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010495911.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   3e-34   Camelina sativa [gold-of-pleasure]
tpg|DAA54822.1|  TPA: hypothetical protein ZEAMMB73_341952              134   3e-34   
ref|XP_010495909.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010495908.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    139   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006300089.1|  hypothetical protein CARUB_v10016317mg             139   3e-34   Capsella rubella
gb|ABA96837.1|  Leucine Rich Repeat family protein, expressed           139   3e-34   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69043.1|  hypothetical protein OsI_37874                          139   4e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_006408937.1|  hypothetical protein EUTSA_v10001935mg             139   4e-34   Eutrema salsugineum [saltwater cress]
ref|XP_002443070.1|  hypothetical protein SORBIDRAFT_08g007580          138   4e-34   
ref|XP_002321304.2|  hypothetical protein POPTR_0014s18520g             138   7e-34   
ref|XP_008789483.1|  PREDICTED: uncharacterized protein LOC103706...    137   1e-33   
ref|XP_010940683.1|  PREDICTED: uncharacterized protein LOC105059...    137   2e-33   Elaeis guineensis
ref|XP_010940682.1|  PREDICTED: uncharacterized protein LOC105059...    138   2e-33   
ref|XP_010940684.1|  PREDICTED: uncharacterized protein LOC105059...    137   2e-33   Elaeis guineensis
ref|XP_008789482.1|  PREDICTED: uncharacterized protein LOC103706...    136   2e-33   
ref|XP_008789480.1|  PREDICTED: uncharacterized protein LOC103706...    136   3e-33   Phoenix dactylifera
ref|XP_008674147.1|  PREDICTED: uncharacterized protein LOC103650329    135   2e-32   Zea mays [maize]
emb|CBI37239.3|  unnamed protein product                                134   2e-32   Vitis vinifera
ref|XP_010652449.1|  PREDICTED: protein NLRC3 isoform X2                134   2e-32   
ref|XP_002883938.1|  leucine-rich repeat family protein                 134   3e-32   
ref|XP_003576947.1|  PREDICTED: NACHT, LRR and PYD domains-contai...    130   5e-31   
ref|XP_009405714.1|  PREDICTED: protein NLRC3 isoform X1                129   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004960752.1|  PREDICTED: uncharacterized protein LOC101762404    129   2e-30   Setaria italica
gb|KFK40400.1|  hypothetical protein AALP_AA3G368500                    127   5e-30   Arabis alpina [alpine rockcress]
ref|XP_011458062.1|  PREDICTED: protein NLRC5 isoform X2                126   1e-29   Fragaria vesca subsp. vesca
ref|XP_007151779.1|  hypothetical protein PHAVU_004G074200g             117   1e-28   Phaseolus vulgaris [French bean]
gb|KEH23987.1|  LRR ribonuclease inhibitor domain protein               123   2e-28   Medicago truncatula
ref|XP_003625467.1|  hypothetical protein MTR_7g099450                  122   6e-28   
gb|AES81685.2|  LRR ribonuclease inhibitor domain protein               121   7e-28   Medicago truncatula
ref|XP_006854345.1|  hypothetical protein AMTR_s00039p00144340          121   1e-27   
gb|EMT06714.1|  Protein NLRC3                                           119   8e-27   
ref|XP_008652837.1|  PREDICTED: uncharacterized protein LOC103632898    109   6e-26   
gb|EMS58433.1|  Protein NLRC3                                           114   5e-25   Triticum urartu
ref|XP_010540943.1|  PREDICTED: protein NLRC3 isoform X2                110   6e-24   Tarenaya hassleriana [spider flower]
ref|XP_008673554.1|  PREDICTED: uncharacterized protein LOC103649591    102   3e-23   
ref|XP_008664178.1|  PREDICTED: uncharacterized protein LOC103642767    104   4e-23   
gb|EYU17965.1|  hypothetical protein MIMGU_mgv1a0245891mg             98.6    3e-22   Erythranthe guttata [common monkey flower]
ref|XP_008664260.1|  PREDICTED: uncharacterized protein LOC103642868  91.7    2e-19   
gb|EYU17964.1|  hypothetical protein MIMGU_mgv1a0245892mg             84.0    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_008661204.1|  PREDICTED: uncharacterized protein LOC103640392  69.3    2e-11   
ref|XP_010652450.1|  PREDICTED: uncharacterized protein LOC100261...  71.2    8e-11   
gb|KJB42372.1|  hypothetical protein B456_007G151600                  69.7    3e-10   Gossypium raimondii
ref|XP_008461991.1|  PREDICTED: leucine-rich repeat-containing pr...  69.3    3e-10   Cucumis melo [Oriental melon]
gb|AFW59093.1|  hypothetical protein ZEAMMB73_800081                  69.3    4e-10   
tpg|DAA54821.1|  TPA: hypothetical protein ZEAMMB73_341952            63.9    3e-09   
gb|AFW59095.1|  hypothetical protein ZEAMMB73_800081                  66.2    3e-09   
tpg|DAA52872.1|  TPA: putative RNA helicase family protein            66.6    4e-09   
tpg|DAA52873.1|  TPA: putative RNA helicase family protein            66.6    4e-09   
tpg|DAA52871.1|  TPA: putative RNA helicase family protein            63.9    2e-08   
ref|XP_002964411.1|  hypothetical protein SELMODRAFT_405633           62.8    5e-08   
ref|XP_001751929.1|  predicted protein                                58.5    9e-07   
ref|XP_009405738.1|  PREDICTED: protein NLRC3 isoform X2              50.4    8e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_006352713.1| PREDICTED: uncharacterized protein LOC102605986 [Solanum tuberosum]
Length=627

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 134/183 (73%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E+CELT  GV  LLE LS L KP   LSIG N LGSEIG ++GKF+  GI +LDI+DIGL
Sbjct  446  ESCELTCFGVCELLEALSSLRKPLNFLSIGGNSLGSEIGTALGKFLCGGIQALDIEDIGL  505

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF +A +EIV + K+  INISKNRGGI+TA+F+SKLFSYAP+L  +NA++N MP ES
Sbjct  506  GSSGFMRAGQEIVTETKLHSINISKNRGGIETARFLSKLFSYAPDLSTVNAKYNFMPKES  565

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            L+I+ S + AA GKLE LDL GN  C      S L++++ NG   I++L SS A N PYD
Sbjct  566  LSILSSAVKAAKGKLEHLDLRGNIMCGQQVHLSELAEFQTNG-FSILELSSSPALNEPYD  624

Query  204  DDP  196
            DDP
Sbjct  625  DDP  627



>ref|XP_009769918.1| PREDICTED: uncharacterized protein LOC104220702 [Nicotiana sylvestris]
 ref|XP_009769919.1| PREDICTED: uncharacterized protein LOC104220702 [Nicotiana sylvestris]
 ref|XP_009769920.1| PREDICTED: uncharacterized protein LOC104220702 [Nicotiana sylvestris]
Length=626

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 133/183 (73%), Gaps = 2/183 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E+CELT  GV  LLE LS L KP + LSIG NYLGSEIG  +GKF+  GI + DI+DIGL
Sbjct  444  ESCELTCSGVCELLEVLSALRKPLSFLSIGGNYLGSEIGTPLGKFLCGGIQAFDIEDIGL  503

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF KA +E+V + K+  INISKNRGGI+TA+F+SKLFS+AP+L +INA++N M  ES
Sbjct  504  GSSGFLKAGKELVRESKLRSINISKNRGGIETARFLSKLFSHAPDLSSINAKYNFMAKES  563

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENS-ADASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            L+I+ SG+  A GKLE LDL GN  CE   AD S L++   +G  V+    S A NVPYD
Sbjct  564  LSILSSGIKVAKGKLEHLDLRGNIICEEELADFSELAELRTSGNFVLELSSSPAQNVPYD  623

Query  204  DDP  196
            DDP
Sbjct  624  DDP  626



>ref|XP_009601758.1| PREDICTED: uncharacterized protein LOC104096985 [Nicotiana tomentosiformis]
Length=626

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 133/183 (73%), Gaps = 2/183 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E+CELT  GV  LL  LS L KP + LSIG NYLGSEIG  +GKF+  GI + DI+DIGL
Sbjct  444  ESCELTCSGVCELLVVLSALRKPLSFLSIGGNYLGSEIGTPLGKFLCGGIQAFDIEDIGL  503

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF KA +E+V++ K+  INISKNRGGI+TA+F+SKLFS+AP+L ++NA++N M  ES
Sbjct  504  GSSGFLKAGKELVKESKLRSINISKNRGGIETARFLSKLFSHAPDLSSVNAKYNFMAKES  563

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENS-ADASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            L+I+ SG+  A GKLE LDL GN  CE   AD S L++   +G  V+    S A NVPYD
Sbjct  564  LSILSSGVKVAKGKLEHLDLRGNIICEEELADFSELAELRTSGNFVLELSSSPAQNVPYD  623

Query  204  DDP  196
            DDP
Sbjct  624  DDP  626



>ref|XP_004242382.1| PREDICTED: ribonuclease inhibitor [Solanum lycopersicum]
Length=625

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 134/183 (73%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E+CELT  GV  LLE LS L KP   LSIG N LGSEIG ++GKF+  GI +LDI+DIGL
Sbjct  444  ESCELTCFGVCELLEALSSLRKPLNFLSIGGNSLGSEIGTALGKFLCCGIQALDIEDIGL  503

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS+GF +A + IV++ K+  INISKNRGGI+TA+F+SKLFS+AP+L  +NA++N MP ES
Sbjct  504  GSTGFMRAGQAIVKETKLHSINISKNRGGIETARFLSKLFSHAPDLSTVNAKYNFMPKES  563

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            L+I+ S + AA GKLE LDL GN  C      S L++++ NG   I++L SS A N PYD
Sbjct  564  LSILSSAVKAAKGKLEHLDLRGNIICGQQVHLSELAEFQTNG-FSILELSSSPALNEPYD  622

Query  204  DDP  196
            DDP
Sbjct  623  DDP  625



>gb|KDP26432.1| hypothetical protein JCGZ_17590 [Jatropha curcas]
Length=603

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+ LS L++P  SLS+  N LGS +  ++GKF+S  I  LDI  IGL
Sbjct  422  ENCELSCDGVTQLLDTLSALQRPIKSLSLADNGLGSPVAGALGKFLSTSIRELDIGGIGL  481

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS+GF + Q+E++ DLK++ INISKNRGG++TAKF+SKL S AP++V+++A +NLMP ES
Sbjct  482  GSAGFEELQKEMMADLKLVKINISKNRGGLETAKFLSKLMSSAPDIVSVDASYNLMPTES  541

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L II S L AA G LE LDL+GN      A AS+L++++ NG+ ++I   S A +VPYDD
Sbjct  542  LIIICSALKAAKGNLECLDLNGNTWDWQQAHASILAEFQHNGRPILILPLSRATDVPYDD  601

Query  201  DP  196
            DP
Sbjct  602  DP  603



>gb|KDO65820.1| hypothetical protein CISIN_1g0074791mg, partial [Citrus sinensis]
Length=390

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 128/183 (70%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  209  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  268

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL   APELV +NA +NLMP ES
Sbjct  269  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMPLAPELVEVNAGYNLMPLES  328

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  205
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  329  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  387

Query  204  DDP  196
            D+P
Sbjct  388  DEP  390



>ref|XP_006443678.1| hypothetical protein CICLE_v10019392mg [Citrus clementina]
 ref|XP_006480174.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X4 [Citrus sinensis]
 gb|ESR56918.1| hypothetical protein CICLE_v10019392mg [Citrus clementina]
Length=549

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 129/183 (70%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  368  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  427

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL S AP+LV +NA +NLMP ES
Sbjct  428  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMSLAPDLVEVNAGYNLMPLES  487

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  205
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  488  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  546

Query  204  DDP  196
            D+P
Sbjct  547  DEP  549



>ref|XP_006480172.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X2 [Citrus sinensis]
Length=600

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 129/183 (70%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  419  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  478

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL S AP+LV +NA +NLMP ES
Sbjct  479  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMSLAPDLVEVNAGYNLMPLES  538

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  205
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  539  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  597

Query  204  DDP  196
            D+P
Sbjct  598  DEP  600



>ref|XP_006443679.1| hypothetical protein CICLE_v10019392mg [Citrus clementina]
 ref|XP_006480173.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X3 [Citrus sinensis]
 gb|ESR56919.1| hypothetical protein CICLE_v10019392mg [Citrus clementina]
Length=599

 Score =   183 bits (464),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 129/183 (70%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  418  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  477

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL S AP+LV +NA +NLMP ES
Sbjct  478  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMSLAPDLVEVNAGYNLMPLES  537

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  205
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  538  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  596

Query  204  DDP  196
            D+P
Sbjct  597  DEP  599



>ref|XP_006480171.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X1 [Citrus sinensis]
Length=602

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 129/183 (70%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+G GV  LL+ LS L +PPTSLSI  N LGS I AS+GKF    +  L+I  IGL
Sbjct  421  ENCELSGRGVSQLLDTLSTLRRPPTSLSIADNNLGSHIAASLGKFFGTSVQVLNIGAIGL  480

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF   Q+ + ++LK++ INISKNRGG++TAKF+SKL S AP+LV +NA +NLMP ES
Sbjct  481  GSSGFRVLQDGVTKELKLVNINISKNRGGVETAKFLSKLMSLAPDLVEVNAGYNLMPLES  540

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  205
            L II S L  A G L+ LDL+GN      +  S+LS++  NG L I+ LP+  A +VPYD
Sbjct  541  LTIICSALKVAKGHLQRLDLTGNNWELQPSHVSMLSEFRHNG-LPILILPTLQALDVPYD  599

Query  204  DDP  196
            D+P
Sbjct  600  DEP  602



>ref|XP_011083100.1| PREDICTED: uncharacterized protein LOC105165701 isoform X2 [Sesamum 
indicum]
Length=608

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 135/183 (74%), Gaps = 2/183 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCELT + V  LL  LS ++KP   LSI  N LGSEIGA  GKF+  G+ ++D++DIGL
Sbjct  426  ENCELTCNQVIELLGVLSTMKKPVNLLSIKGNRLGSEIGAPFGKFLCTGVRAVDVEDIGL  485

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF +A  EI  +LKI  INIS N+GGI+ AKF+S + S++ ++VAI+A +NLMP ES
Sbjct  486  GSSGFLEALREISTELKIAYINISNNQGGIEAAKFMSSIISHSQKIVAIDARYNLMPMES  545

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            L++I SG+ A+ GKLE LDL+GN+ C++ AD ASVL++ +I+G+  +     +AP+ PYD
Sbjct  546  LSVISSGMKASKGKLEHLDLAGNSFCDHLADAASVLAELQIHGQSALSLSLWAAPSAPYD  605

Query  204  DDP  196
            DDP
Sbjct  606  DDP  608



>ref|XP_011083098.1| PREDICTED: uncharacterized protein LOC105165701 isoform X1 [Sesamum 
indicum]
 ref|XP_011083099.1| PREDICTED: uncharacterized protein LOC105165701 isoform X1 [Sesamum 
indicum]
Length=620

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 135/183 (74%), Gaps = 2/183 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCELT + V  LL  LS ++KP   LSI  N LGSEIGA  GKF+  G+ ++D++DIGL
Sbjct  438  ENCELTCNQVIELLGVLSTMKKPVNLLSIKGNRLGSEIGAPFGKFLCTGVRAVDVEDIGL  497

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF +A  EI  +LKI  INIS N+GGI+ AKF+S + S++ ++VAI+A +NLMP ES
Sbjct  498  GSSGFLEALREISTELKIAYINISNNQGGIEAAKFMSSIISHSQKIVAIDARYNLMPMES  557

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            L++I SG+ A+ GKLE LDL+GN+ C++ AD ASVL++ +I+G+  +     +AP+ PYD
Sbjct  558  LSVISSGMKASKGKLEHLDLAGNSFCDHLADAASVLAELQIHGQSALSLSLWAAPSAPYD  617

Query  204  DDP  196
            DDP
Sbjct  618  DDP  620



>ref|XP_007201725.1| hypothetical protein PRUPE_ppa003067mg [Prunus persica]
 gb|EMJ02924.1| hypothetical protein PRUPE_ppa003067mg [Prunus persica]
Length=607

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+ HGV  L++ LS L++P  SLS+  N LGS++ A++GK +S  I  L+++ IGL
Sbjct  426  ENCELSCHGVTYLIDTLSTLQRPLKSLSVADNDLGSQVAAALGKLLSTSIQILNVEGIGL  485

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF + Q+ I ++LK++ +NISKNRGGI+TA F+SKL S APELV ++A +NLMP +S
Sbjct  486  GSSGFQELQDGITKELKLVKVNISKNRGGIETANFLSKLISMAPELVTVDAAYNLMPLKS  545

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L  I S L AA G +E LDL GN        AS+ +  + NG+ V+I   S  P+ PYDD
Sbjct  546  LTTICSALKAAKGNIERLDLRGNIWDYQPGYASMHADIQCNGRPVLILSSSPTPDAPYDD  605

Query  201  DP  196
            DP
Sbjct  606  DP  607



>ref|XP_008235539.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5 [Prunus 
mume]
Length=607

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 125/182 (69%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+ HGV  L++ LS LE+P  SLS+  N LGS++ A++GK +S  I  L+++ IGL
Sbjct  426  ENCELSCHGVTYLIDTLSTLERPLKSLSVADNDLGSQVAAALGKLLSTSIRILNVEGIGL  485

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF + Q+ I ++LK++ +NISKNRGGI TA F+SKL S APELV ++A +NLMP +S
Sbjct  486  GSSGFQELQDGITKELKLVKVNISKNRGGIGTANFLSKLISMAPELVTVDAAYNLMPLKS  545

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L  I S L AA G +E LDL GN        AS+ +  + NG+ V+I   S  P+ PYDD
Sbjct  546  LNTICSALKAAKGNIERLDLRGNIWDYQPGYASMHADIQCNGRPVLILSSSPTPDAPYDD  605

Query  201  DP  196
            DP
Sbjct  606  DP  607



>ref|XP_010243650.1| PREDICTED: uncharacterized protein LOC104587649 isoform X3 [Nelumbo 
nucifera]
Length=613

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 132/184 (72%), Gaps = 5/184 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  562
            ENC L+ +GV  LL  LS L KP  +LSI  N LGS++ A + KF+ +  +  L+I+DI 
Sbjct  432  ENCSLSCNGVTQLLRSLSTL-KPLRTLSISDNELGSQVAAELAKFLGTSHVRELNIEDIA  490

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            LG SGF + Q+EI E++K+  INISKNRGGI+ A FISKL   +PELVA+NA +N +PAE
Sbjct  491  LGPSGFLELQKEIPEEIKLGYINISKNRGGIEAANFISKLILRSPELVAVNAGYNFIPAE  550

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPY  208
            SLA+IGS L A+ GK+ELLDL+GN  C     +S+L++++++G+ +++ LPS  A   PY
Sbjct  551  SLALIGSALRASRGKIELLDLTGNTRCCQPHTSSMLAEFQVHGRPIVL-LPSFPASTAPY  609

Query  207  DDDP  196
            DDDP
Sbjct  610  DDDP  613



>ref|XP_010243649.1| PREDICTED: uncharacterized protein LOC104587649 isoform X2 [Nelumbo 
nucifera]
Length=621

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 132/184 (72%), Gaps = 5/184 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  562
            ENC L+ +GV  LL  LS L KP  +LSI  N LGS++ A + KF+ +  +  L+I+DI 
Sbjct  440  ENCSLSCNGVTQLLRSLSTL-KPLRTLSISDNELGSQVAAELAKFLGTSHVRELNIEDIA  498

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            LG SGF + Q+EI E++K+  INISKNRGGI+ A FISKL   +PELVA+NA +N +PAE
Sbjct  499  LGPSGFLELQKEIPEEIKLGYINISKNRGGIEAANFISKLILRSPELVAVNAGYNFIPAE  558

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPY  208
            SLA+IGS L A+ GK+ELLDL+GN  C     +S+L++++++G+ +++ LPS  A   PY
Sbjct  559  SLALIGSALRASRGKIELLDLTGNTRCCQPHTSSMLAEFQVHGRPIVL-LPSFPASTAPY  617

Query  207  DDDP  196
            DDDP
Sbjct  618  DDDP  621



>ref|XP_010243648.1| PREDICTED: uncharacterized protein LOC104587649 isoform X1 [Nelumbo 
nucifera]
Length=629

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 132/184 (72%), Gaps = 5/184 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  562
            ENC L+ +GV  LL  LS L KP  +LSI  N LGS++ A + KF+ +  +  L+I+DI 
Sbjct  448  ENCSLSCNGVTQLLRSLSTL-KPLRTLSISDNELGSQVAAELAKFLGTSHVRELNIEDIA  506

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            LG SGF + Q+EI E++K+  INISKNRGGI+ A FISKL   +PELVA+NA +N +PAE
Sbjct  507  LGPSGFLELQKEIPEEIKLGYINISKNRGGIEAANFISKLILRSPELVAVNAGYNFIPAE  566

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPY  208
            SLA+IGS L A+ GK+ELLDL+GN  C     +S+L++++++G+ +++ LPS  A   PY
Sbjct  567  SLALIGSALRASRGKIELLDLTGNTRCCQPHTSSMLAEFQVHGRPIVL-LPSFPASTAPY  625

Query  207  DDDP  196
            DDDP
Sbjct  626  DDDP  629



>ref|XP_010652448.1| PREDICTED: protein NLRC3 isoform X1 [Vitis vinifera]
Length=620

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 122/181 (67%), Gaps = 1/181 (1%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLG  556
            +C+L+ +GV  LL+ LS L+ P  SLSI  N LGS+    +GKF+   I  L+++DIGLG
Sbjct  440  DCDLSCNGVTQLLDVLSTLKNPLHSLSIAHNELGSQAAGPLGKFLRTVIRVLNVEDIGLG  499

Query  555  SSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  376
            SSGF K QE++ E++K++ INISKNRG ++TA F+ KL S APELV +NA +N MP ESL
Sbjct  500  SSGFLKLQEDMPEEVKLVSINISKNRGRLETANFLLKLMSKAPELVVVNAAYNFMPVESL  559

Query  375  AIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDDD  199
             ++ S L    GKLE LDL GNA    SA A +  +++  G+ ++I  P  A + PYDDD
Sbjct  560  TVVHSSLKVGKGKLERLDLRGNARFCQSAHAPLFDEFQHRGRPIVILPPLPAADEPYDDD  619

Query  198  P  196
            P
Sbjct  620  P  620



>ref|XP_007050066.1| RNI-like superfamily protein, putative [Theobroma cacao]
 gb|EOX94223.1| RNI-like superfamily protein, putative [Theobroma cacao]
Length=604

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 128/183 (70%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+ LS + KP  SLS+  N LGS++  ++G F    I  L+++ IGL
Sbjct  423  ENCELSYDGVTQLLDALSSVGKPLNSLSVADNGLGSQVAEALGNFWGTSIQVLNLEGIGL  482

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G SGF K ++  +EDL ++ INISKNRGGI+TAKF+SKL   AP+L+A+NA +NLMP ES
Sbjct  483  GPSGFRKLKDVGMEDLMLVEINISKNRGGIETAKFLSKLIRQAPKLIAVNAAYNLMPVES  542

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            L II S L  A G LE +DL+GN      +  ++L++++ NG+ ++I LPSS A +VPYD
Sbjct  543  LIIICSALKTATGHLEQVDLTGNIWDYQPSHDTMLAEFQHNGRPILI-LPSSVASDVPYD  601

Query  204  DDP  196
            DDP
Sbjct  602  DDP  604



>gb|KJB42369.1| hypothetical protein B456_007G151600 [Gossypium raimondii]
Length=604

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLG  556
            +CEL+  GV  LL+ LS L +P  SLS+  N LGS++  ++GKF    I  L+++ IGLG
Sbjct  424  SCELSSDGVILLLDVLSTLARPLNSLSLADNGLGSQVAEALGKFWGTSIQVLNLEGIGLG  483

Query  555  SSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  376
             SGF K ++  +E+LK++ +NISKNRGGI+TAKF+SKL  +AP+LVA+NA +NLMPAESL
Sbjct  484  PSGFRKLRDIRMENLKLVKLNISKNRGGIETAKFLSKLILHAPKLVAVNAAYNLMPAESL  543

Query  375  AIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYDD  202
             +I S L  A G +E +DL GN      +  ++L++++ NGK ++I LPSS A N+PYDD
Sbjct  544  PLICSALKTAKGLVEQVDLRGNICEYQPSHDTMLAEFQHNGKPILI-LPSSVALNIPYDD  602

Query  201  DP  196
            DP
Sbjct  603  DP  604



>gb|KJB42368.1| hypothetical protein B456_007G151600 [Gossypium raimondii]
Length=581

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLG  556
            +CEL+  GV  LL+ LS L +P  SLS+  N LGS++  ++GKF    I  L+++ IGLG
Sbjct  401  SCELSSDGVILLLDVLSTLARPLNSLSLADNGLGSQVAEALGKFWGTSIQVLNLEGIGLG  460

Query  555  SSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  376
             SGF K ++  +E+LK++ +NISKNRGGI+TAKF+SKL  +AP+LVA+NA +NLMPAESL
Sbjct  461  PSGFRKLRDIRMENLKLVKLNISKNRGGIETAKFLSKLILHAPKLVAVNAAYNLMPAESL  520

Query  375  AIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYDD  202
             +I S L  A G +E +DL GN      +  ++L++++ NGK ++I LPSS A N+PYDD
Sbjct  521  PLICSALKTAKGLVEQVDLRGNICEYQPSHDTMLAEFQHNGKPILI-LPSSVALNIPYDD  579

Query  201  DP  196
            DP
Sbjct  580  DP  581



>ref|XP_002521155.1| protein binding protein, putative [Ricinus communis]
 gb|EEF41306.1| protein binding protein, putative [Ricinus communis]
Length=598

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E+CEL+  GV  LL+ LS L+KP  SL++  N LGS I  ++GKF+   I  L+I  IGL
Sbjct  417  ESCELSCEGVTLLLDTLSTLQKPLNSLTLADNGLGSPIAGALGKFLCTPIRELNIGGIGL  476

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS+GF + Q+ ++E+LK++ INISKNRGG++TAKF+ KL S AP+LVA+ A +NLMPAES
Sbjct  477  GSAGFLELQKGMMEELKLVEINISKNRGGLETAKFLLKLMSLAPDLVAVKASYNLMPAES  536

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L +I SGL A+ G L+ LDL+GN        ASVL+ ++ NG+ ++I     AP++PYDD
Sbjct  537  LTLICSGLKASKGNLQHLDLTGNTWDYQQTHASVLADFQHNGRPILILSSIHAPHIPYDD  596

Query  201  DP  196
            DP
Sbjct  597  DP  598



>ref|XP_008382798.1| PREDICTED: protein NLRC3, partial [Malus domestica]
Length=375

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E+CEL+  GV  L++ LS L++P  SLS+  N LGS++  ++GK +S  I  L+++ IGL
Sbjct  194  ESCELSCDGVTLLIDTLSTLKRPLKSLSVADNDLGSQVAPALGKILSASIQVLNVEGIGL  253

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G SGF + Q+ I +DLK++ INISKNRGGI+ AKF+  L S APELV +N  +NL+P  S
Sbjct  254  GLSGFRELQDGITKDLKLVEINISKNRGGIEAAKFLVNLISRAPELVTVNVAYNLLPLNS  313

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L I+ S + AA G LE LDL GN     S  AS+L+  + NGK V I   S     PYDD
Sbjct  314  LTIVCSAIKAAKGHLEHLDLRGNTWDNQSGYASMLADAQCNGKPVFILSSSQTVGAPYDD  373

Query  201  DP  196
            DP
Sbjct  374  DP  375



>emb|CDP21849.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 108/150 (72%), Gaps = 1/150 (1%)
 Frame = -3

Query  642  YLGSEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDT  463
            YL S+IGA +GKF+SKG+ SLDIDDI LG  GF KAQ+EI+ DLK++ INISKN GGI+T
Sbjct  7    YLFSKIGALLGKFLSKGLQSLDIDDIDLGPPGFQKAQDEIMGDLKLVYINISKNYGGIET  66

Query  462  AKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGLAA-NGKLELLDLSGNASCENSADA  286
            A F+SKL S APEL AI+A  N MP ESL+II S L A  GK+E LDL GN S    ADA
Sbjct  67   ANFLSKLISCAPELAAIDARCNSMPVESLSIICSTLKAMRGKVEHLDLRGNTSLIRFADA  126

Query  285  SVLSKYEINGKLVIIDLPSSAPNVPYDDDP  196
            S+L + ++N K ++    S  P+ PYD DP
Sbjct  127  SLLDELKMNRKSILKLDSSYDPDAPYDQDP  156



>ref|XP_010091857.1| Ribonuclease inhibitor [Morus notabilis]
 gb|EXB46065.1| Ribonuclease inhibitor [Morus notabilis]
Length=615

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 119/184 (65%), Gaps = 7/184 (4%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E+C+L   GV  LL  LS  ++P  SLSI  N+LGS++ A +GKF+S  I  L+I  IGL
Sbjct  436  ESCDLNASGVIELLNTLSSFKRPLESLSIADNFLGSKVAAVLGKFLSTSIQVLNISGIGL  495

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
             SSGF   Q+ I +++K+I INIS+NRGGI TA F+S L   APELV +NAE+N MP ES
Sbjct  496  SSSGFEDLQQSITKEVKLIGINISRNRGGIATANFLSTLLPRAPELVFVNAEYNFMPVES  555

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEI--NGKLVIIDLPSSAPNVPY  208
              I+ S L AA G LELLDL+GN    N    ++L   EI  NGKL +I     A + PY
Sbjct  556  SRIMCSALKAAKGNLELLDLTGN----NLDSQTILGLAEIQRNGKLALIFSSLPAADAPY  611

Query  207  DDDP  196
            DDDP
Sbjct  612  DDDP  615



>ref|XP_004290025.1| PREDICTED: protein NLRC5 isoform X1 [Fragaria vesca subsp. vesca]
Length=612

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 120/182 (66%), Gaps = 2/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+ HGV  L++ LS L +P  SLSI  N LGS++   +G+F+   I  L+   IGL
Sbjct  432  ENCELSCHGVTELIKTLSSLSRPLKSLSIADNDLGSQVAGVLGEFLCTPIQVLNAGGIGL  491

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
             SSGF   QE++ ++LK++ I+ISKNRGGI+TA F+SKL S AP+L  +NA +NLMP ES
Sbjct  492  RSSGFQVLQEKLTKELKLVEIDISKNRGGIETANFLSKLMSEAPKLAIVNAAYNLMPVES  551

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L  I S +  A G L+ +DLSGN         S+L+  + N +L++I LPS  P+ PYD 
Sbjct  552  LTAICSAIKNAKGTLQRMDLSGNTWDYQPVYDSMLADIQCNERLILI-LPSLTPDAPYDA  610

Query  201  DP  196
            DP
Sbjct  611  DP  612



>ref|XP_004493854.1| PREDICTED: uncharacterized protein LOC101511205 [Cicer arietinum]
Length=616

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 114/182 (63%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E CEL+  GV   L+ LS L  P  SLSI  NYLG ++  ++G+F+S  I  LD   I  
Sbjct  435  EACELSYDGVNHFLDSLSTLRGPLKSLSIAENYLGRKVAGALGRFLSTPIEELDASGIDF  494

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G SGF   Q  I E+LK++ INISKNRGG +TAKF+SKL S AP+L+ +NA  N MP ES
Sbjct  495  GPSGFQDLQNLIKEELKLVKINISKNRGGTETAKFLSKLLSQAPQLIDVNAASNFMPIES  554

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L+II S L  A G ++ LDL+G+        AS+ +++  NGK ++I  PSS    PYD 
Sbjct  555  LSIISSALKLAKGNVQRLDLTGHKWDYKPEHASLSTEFVYNGKPILILPPSSITAAPYDH  614

Query  201  DP  196
            DP
Sbjct  615  DP  616



>ref|XP_010069680.1| PREDICTED: uncharacterized protein LOC104456563 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58100.1| hypothetical protein EUGRSUZ_H00824 [Eucalyptus grandis]
Length=603

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 119/182 (65%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+ +GV   L  LS  + P +SLSI  N LGS +  ++ K +S  I  L+I  +GL
Sbjct  422  ENCELSSNGVIEFLTTLSTSDIPLSSLSISDNSLGSHVAEALVKLLSSSIQVLNISGVGL  481

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF + Q+   + LK++ I+ISKNRGGI++AKF+SKL   AP+LV +NA FNLMP ES
Sbjct  482  GSSGFEELQKVSFKSLKLVKIDISKNRGGIESAKFLSKLMECAPQLVTVNAAFNLMPPES  541

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L II S L AA G L LL+L GN   +   DAS+L   + +G+L II   S   + PYDD
Sbjct  542  LTIICSALKAAKGNLGLLELRGNNLDKPPNDASLLVDLQRDGRLRIIFESSPTLDAPYDD  601

Query  201  DP  196
            DP
Sbjct  602  DP  603



>ref|XP_006604527.1| PREDICTED: protein NLRC3-like [Glycine max]
 gb|KHN02437.1| Protein NLRC3 [Glycine soja]
Length=604

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 116/182 (64%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+L+  GV  LL  LS  + P  SLSI  NYLGS++  ++GKF S  I  LDI  IGL
Sbjct  423  ENCDLSCVGVNNLLHILSNFKGPLKSLSIADNYLGSQVAEALGKFFSTPIEVLDIAGIGL  482

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + Q  I E +K++ INISKNRGGI TAKF+SKL S AP+LV +NA  NLMP ES
Sbjct  483  GSYGFQELQSLIKEKVKLVKINISKNRGGIATAKFLSKLLSQAPQLVDVNAASNLMPIES  542

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            LAII S L  A G ++ +DL+G+         S  +++  NG  ++I   SSA   P+D 
Sbjct  543  LAIICSALKFAKGNVQQVDLTGHIWDYKPEHVSPYTEFVHNGLPILILPSSSASAAPHDH  602

Query  201  DP  196
            DP
Sbjct  603  DP  604



>ref|XP_010684911.1| PREDICTED: uncharacterized protein LOC104899423 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010684912.1| PREDICTED: uncharacterized protein LOC104899423 [Beta vulgaris 
subsp. vulgaris]
Length=636

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 117/182 (64%), Gaps = 1/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            +NC+L+  GV  LLE L  ++ P TSLS+  N LGS+I   +G FM   I SLDI DIGL
Sbjct  455  KNCKLSSTGVTELLEVLLAIKCPLTSLSLADNDLGSQIAPLLGDFMHTSIRSLDIRDIGL  514

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GSSGF + +  + E +K+I INIS+NRGGI  A+F+ +L S A ELV + A +NLMP ES
Sbjct  515  GSSGFLELRIHMPEVVKLISINISENRGGIQAAEFLEELISRASELVDVQAGYNLMPPES  574

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L II S L  + GKL  +DL+GN     +   S LS+++ NG+ +++   S +    YDD
Sbjct  575  LNIICSSLKVSQGKLHCIDLTGNQKLSQTDHVSKLSEFQHNGEPIVLISTSPSQETLYDD  634

Query  201  DP  196
            DP
Sbjct  635  DP  636



>ref|XP_007162646.1| hypothetical protein PHAVU_001G168300g [Phaseolus vulgaris]
 gb|ESW34640.1| hypothetical protein PHAVU_001G168300g [Phaseolus vulgaris]
Length=604

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+L+  GV  LL  LS  + P  SLSI  NYLGS++  ++G F S  I  LDI  IGL
Sbjct  423  ENCDLSCVGVNHLLHVLSSFKGPLKSLSIADNYLGSQVTEALGNFFSTPIEVLDIAGIGL  482

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + +  I E+LK++ INISKNRGGI+TAKF+SKL S AP+LV +NA  NLMP ES
Sbjct  483  GSYGFQELKNLIKEELKLVKINISKNRGGIETAKFLSKLLSQAPQLVEVNAASNLMPIES  542

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVP-YD  205
            LAI+ S L  A G ++ +DL+G+     S   S+ +++ ++ +L I+ LPSS+ +   +D
Sbjct  543  LAIVCSALKFAKGNVQHVDLTGHIWDCKSEHVSLCTEF-VHNELPILVLPSSSISAALHD  601

Query  204  DDP  196
             DP
Sbjct  602  HDP  604



>gb|KGN44555.1| hypothetical protein Csa_7G330390 [Cucumis sativus]
Length=533

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 5/184 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  352  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  411

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF    E +     I+ INISKNRGGI+ A F+ KL S A +LV++NA +NLMP ES
Sbjct  412  GPCGFQDLVEGVTAGSNIVNINISKNRGGIEIATFLLKLLSGASDLVSVNASYNLMPVES  471

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVP--Y  208
            L II S L  A GKLELLDL GN   +  A  S++++++ + K ++I   SS+PN+   Y
Sbjct  472  LDIIRSALKIAKGKLELLDLRGNNWDDQKAQDSLVAEFQNSVKKILI--YSSSPNLDGLY  529

Query  207  DDDP  196
            D DP
Sbjct  530  DADP  533



>emb|CDY65850.1| BnaCnng48880D [Brassica napus]
Length=602

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS +EKP   LS+  N LGSE+  ++   ++  I SLDI  IGL
Sbjct  419  ENCELSCCGVIEFLDTLSTVEKPLKFLSVADNALGSEVAEAVMNSLTVSIESLDISSIGL  478

Query  558  GSSGFSKAQEEIVEDLK-IICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF +  + +V+ +K ++ INISKNRGG++TA+F+SKL   AP+LV+++A +NLMPAE
Sbjct  479  GPVGFLELGKRLVKGVKKLMSINISKNRGGLETARFLSKLIPLAPKLVSVDASYNLMPAE  538

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPY  208
            SL ++   L +A G L+ LD++GN    + AD +S+L +++ NG+ + +   SS  +VPY
Sbjct  539  SLLMLCDSLRSAKGDLKRLDMTGNICISSEADHSSLLDEFQHNGEPIFVLPSSSTSHVPY  598

Query  207  DDDP  196
            DD+P
Sbjct  599  DDEP  602



>ref|XP_004154489.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101227026 
[Cucumis sativus]
Length=604

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 5/184 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  482

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF    E +     I+ INISKNRGGI+ A F+ KL S A +LV++NA +NLMP ES
Sbjct  483  GPCGFQDLVEGVTAGSNIVNINISKNRGGIEIATFLLKLLSGASDLVSVNASYNLMPVES  542

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVP--Y  208
            L II S L  A GKLELLDL GN   +  A  S++++++ + K ++I   SS+PN+   Y
Sbjct  543  LDIIRSALKIAKGKLELLDLRGNNWDDQKAQDSLVAEFQNSVKKILI--YSSSPNLDGLY  600

Query  207  DDDP  196
            D DP
Sbjct  601  DADP  604



>ref|XP_004139728.1| PREDICTED: uncharacterized protein LOC101206924 [Cucumis sativus]
Length=604

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 5/184 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  482

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF    E +     I+ INISKNRGGI+ A F+ KL S A +LV++NA +NLMP ES
Sbjct  483  GPCGFQDLVEGVTAGSNIVNINISKNRGGIEIATFLLKLLSGASDLVSVNASYNLMPVES  542

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVP--Y  208
            L II S L  A GKLELLDL GN   +  A  S++++++ + K ++I   SS+PN+   Y
Sbjct  543  LDIIRSALKIAKGKLELLDLRGNNWDDQKAQDSLVAEFQNSVKKILI--YSSSPNLDGLY  600

Query  207  DDDP  196
            D DP
Sbjct  601  DADP  604



>ref|XP_003520623.1| PREDICTED: protein NLRC3-like [Glycine max]
Length=604

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 114/183 (62%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+L+  GV  LL  LS  + P  SLSI  NYLG ++  ++G F    I  LDI  IGL
Sbjct  423  ENCDLSCVGVNLLLHYLSTFKGPLKSLSIAENYLGRQVVEALGNFFHTPIEVLDIAGIGL  482

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + Q  I E++K++ INISKNRGG +TAKF+SKL S AP+LV +NA  NLMP ES
Sbjct  483  GSDGFQELQSLIKEEIKLVKINISKNRGGTETAKFLSKLLSQAPQLVDVNAACNLMPIES  542

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  205
            LAII   L  A G ++ +DL+G+         S  +++  NG L I+ LPS S    P+D
Sbjct  543  LAIICCALKFAKGNVQQVDLTGHIWDYKPEHVSPYAEFVHNG-LPILVLPSPSVSAAPHD  601

Query  204  DDP  196
             DP
Sbjct  602  HDP  604



>gb|KHN09410.1| Protein NLRC5 [Glycine soja]
Length=604

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 114/183 (62%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+L+  GV  LL  LS  + P  SLSI  NYLG ++  ++G F    I  LDI  IGL
Sbjct  423  ENCDLSCVGVNLLLHYLSTFKGPLKSLSIAENYLGRQVVEALGNFFHTPIEVLDIAGIGL  482

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + Q  I E++K++ INISKNRGG +TAKF+SKL S AP+LV +NA  NLMP ES
Sbjct  483  GSDGFQELQSLIKEEIKLVKINISKNRGGTETAKFLSKLLSQAPQLVDVNAACNLMPIES  542

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPS-SAPNVPYD  205
            LAII   L  A G ++ +DL+G+         S  +++  NG L I+ LPS S    P+D
Sbjct  543  LAIICCALKFAKGNVQQVDLTGHIWDYKPEHVSPYAEFVHNG-LPILVLPSPSVSAAPHD  601

Query  204  DDP  196
             DP
Sbjct  602  HDP  604



>ref|XP_008461989.1| PREDICTED: protein NLRC3 isoform X1 [Cucumis melo]
 ref|XP_008461990.1| PREDICTED: protein NLRC3 isoform X1 [Cucumis melo]
Length=604

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 116/184 (63%), Gaps = 5/184 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  482

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF    E + E   I+ INISKNRGGI+ A F+ KL S   +LV++NA +NLMP ES
Sbjct  483  GPCGFQDLVEGVTEGSNIVNINISKNRGGIEIATFLLKLLSGGSDLVSVNASYNLMPVES  542

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVP--Y  208
            L II S L  A GKLELLDL GN   +  A  S++++++ + K ++I   SS+P +   Y
Sbjct  543  LDIIRSALKIAKGKLELLDLRGNNWDDQKAQDSLVAEFQNSVKKILI--YSSSPTLDGLY  600

Query  207  DDDP  196
            D DP
Sbjct  601  DGDP  604



>gb|AAD21766.1| hypothetical protein [Arabidopsis thaliana]
Length=271

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 123/186 (66%), Gaps = 7/186 (4%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  ++    +  I SL+I  IGL
Sbjct  88   ENCELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAVVNSFTISIESLNIMGIGL  147

Query  558  GSSGF---SKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMP  388
            G  GF    +  E++ +  K++ INISKNRGG++TA+F+SKL   AP+L++I+A +NLMP
Sbjct  148  GPLGFLALGRKLEKVSK--KLLSINISKNRGGLETARFLSKLIPLAPKLISIDASYNLMP  205

Query  387  AESLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNV  214
             E+L ++   L  A G L+ LD++GN+   + AD +S+L +++ NG+ + +   SS  +V
Sbjct  206  PEALLMLCDSLRTAKGDLKRLDMTGNSCISHEADHSSLLHEFQHNGEPIFVLPSSSVSHV  265

Query  213  PYDDDP  196
            PYDDDP
Sbjct  266  PYDDDP  271



>gb|KDO65821.1| hypothetical protein CISIN_1g0074791mg, partial [Citrus sinensis]
Length=295

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = -3

Query  633  SEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKF  454
            S I AS+GKF    +  L+I  IGLGSSGF   Q+ + ++LK++ INISKNRGG++TAKF
Sbjct  149  SHIAASLGKFFGTSVQVLNIGAIGLGSSGFRVLQDGVTKELKLVNINISKNRGGVETAKF  208

Query  453  ISKLFSYAPELVAINAEFNLMPAESLAIIGSGL-AANGKLELLDLSGNASCENSADASVL  277
            +SKL   APELV +NA +NLMP ESL II S L  A G L+ LDL+GN      +  S+L
Sbjct  209  LSKLMPLAPELVEVNAGYNLMPLESLTIICSALKVAKGHLQRLDLTGNNWELQPSHVSML  268

Query  276  SKYEINGKLVIIDLPS-SAPNVPYDDDP  196
            S++  NG L I+ LP+  A +VPYDD+P
Sbjct  269  SEFRHNG-LPILILPTLQALDVPYDDEP  295



>ref|NP_001066441.1| Os12g0228900 [Oryza sativa Japonica Group]
 dbj|BAF29460.1| Os12g0228900 [Oryza sativa Japonica Group]
Length=304

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 110/183 (60%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+LT  GV  LLECLS + +P   LSI  N+LGS +  ++ KF+  G+  L+I+DIG 
Sbjct  123  ENCDLTNIGVTELLECLSSVSEPLNLLSIADNHLGSSVAVALAKFLGSGVRELNIEDIGF  182

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF   +E +  D+ +  IN+SKNRGGI  A+F+S+L   AP LV++NA  NL+P ES
Sbjct  183  GPLGFQILEEALPADVALSHINVSKNRGGIRAARFVSRLIKQAPGLVSVNAGSNLLPPES  242

Query  378  LAIIGSGLAANG--KLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            + +I   L       LE LDL GN    ++A  + L ++  +GK ++I         PYD
Sbjct  243  MEVICDVLKQKNTCNLERLDLMGNMHLSDAAFPAAL-EFRKHGKQILIVPSQPGACAPYD  301

Query  204  DDP  196
            DDP
Sbjct  302  DDP  304



>ref|XP_010540942.1| PREDICTED: protein NLRC3 isoform X1 [Tarenaya hassleriana]
Length=602

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 126/184 (68%), Gaps = 3/184 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+ LS+LEKP  SLSI  N LGS +  +IG F++  I SL+I  +GL
Sbjct  419  ENCELSCDGVIDLLDSLSLLEKPLKSLSIADNALGSGVADAIGDFLASPIQSLNISGMGL  478

Query  558  GSSGFSKAQEEIVEDLKIIC-INISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            GS GF + Q +IV++L ++  INISKNRGG++ A+F+SKL   AP+L++ +  +NLMP+E
Sbjct  479  GSIGFLELQRKIVKELMMLLNINISKNRGGLEAARFLSKLIPLAPKLLSADTSYNLMPSE  538

Query  381  SLAIIGSGL-AANGKLELLDLSGNA-SCENSADASVLSKYEINGKLVIIDLPSSAPNVPY  208
            SL+++ + L +  G LE +D++GN+ S     D  +  +++ NGK + +   S A NVPY
Sbjct  539  SLSLLCTSLKSTKGDLESIDMTGNSCSYRTDNDHPLFHEFQRNGKPIFVLPKSPASNVPY  598

Query  207  DDDP  196
            DDDP
Sbjct  599  DDDP  602



>emb|CDY31987.1| BnaA07g00080D [Brassica napus]
Length=604

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS +EKP   LS+  N LGSE+  +I   +   I SLDI  IGL
Sbjct  421  ENCELSCCGVIEFLDTLSTVEKPLKFLSVADNALGSEVAEAIMNSLILSIESLDISSIGL  480

Query  558  GSSGFSKAQEEIVEDLK-IICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF +  + +V+ +K ++ INISKNRGG++TA+F+SKL   AP+LV+++A +NLMP E
Sbjct  481  GPVGFLELGKRLVKGVKKLMSINISKNRGGLETARFLSKLIPLAPKLVSVDASYNLMPPE  540

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPY  208
            SL ++   L +A G L+ LD++GN    +  D +S+L +++ NG+ + +   SS  +VPY
Sbjct  541  SLLMLCDSLRSAKGDLKRLDMTGNICISSETDHSSLLGEFQHNGEPIFVLPSSSTSHVPY  600

Query  207  DDDP  196
            DD+P
Sbjct  601  DDEP  604



>ref|XP_009102053.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103828197 
[Brassica rapa]
Length=609

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS +EKP   LS+  N LGSE+  +I   +   I SLDI  IGL
Sbjct  426  ENCELSCCGVIEFLDTLSTVEKPLKFLSVADNALGSEVAEAIMNSLILSIESLDISSIGL  485

Query  558  GSSGFSKAQEEIVEDLK-IICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF +  + +V+ +K ++ INISKNRGG++TA+F+SKL   AP+LV+++A +NLMP E
Sbjct  486  GPVGFLELGKRLVKGVKKLMSINISKNRGGLETARFLSKLIPLAPKLVSVDASYNLMPPE  545

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPY  208
            SL ++   L +A G L+ LD++GN    +  D +S+L +++ NG+ + +   SS  +VPY
Sbjct  546  SLLMLCDSLRSAKGDLKRLDMTGNICISSETDHSSLLGEFQHNGEPIFVLPSSSTSHVPY  605

Query  207  DDDP  196
            DD+P
Sbjct  606  DDEP  609



>ref|XP_006664439.1| PREDICTED: protein NLRC3-like [Oryza brachyantha]
Length=631

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 115/183 (63%), Gaps = 4/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+LT  GV  LLECLS + +P   LSI  N+LGS + A++ KF+  G+  L+I+DIGL
Sbjct  451  ENCDLTNIGVTELLECLSSVSEPLNLLSISDNHLGSSVAAALAKFLGSGVRELNIEDIGL  510

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF   +E +  ++ +  IN+SKNRGGI  A F+S+L   AP LV++NA  NL+P ES
Sbjct  511  GPIGFQILEEALPAEVALSHINVSKNRGGIRAAHFVSRLIRQAPVLVSVNAGSNLLPPES  570

Query  378  LAIIGSGLAANG-KLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            + +I + L  N   LE LDL GN    ++A  + L ++   GK +++ LPS      PYD
Sbjct  571  MEVICNVLKQNTCNLERLDLMGNMHLSDAAFPAAL-EFRKRGKQILV-LPSQPGACAPYD  628

Query  204  DDP  196
            DDP
Sbjct  629  DDP  631



>ref|XP_010416119.1| PREDICTED: uncharacterized protein LOC104702013 isoform X2 [Camelina 
sativa]
Length=605

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 123/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  422  ENCELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  481

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ I+ISKNRGG++TA+F+SKL   AP L++++A +NLMP E
Sbjct  482  GPLGFLALGSKLEKGSKKLLSIDISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPE  541

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  ANG L+ LD++GN    + AD S +LS+++ NG+ + + LPSS A +VP
Sbjct  542  SLLMLCDSLRTANGGLKRLDMTGNNCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVP  600

Query  210  YDDDP  196
            YDDDP
Sbjct  601  YDDDP  605



>ref|XP_010416125.1| PREDICTED: uncharacterized protein LOC104702013 isoform X3 [Camelina 
sativa]
Length=598

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 123/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  415  ENCELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  474

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ I+ISKNRGG++TA+F+SKL   AP L++++A +NLMP E
Sbjct  475  GPLGFLALGSKLEKGSKKLLSIDISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPE  534

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  ANG L+ LD++GN    + AD S +LS+++ NG+ + + LPSS A +VP
Sbjct  535  SLLMLCDSLRTANGGLKRLDMTGNNCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVP  593

Query  210  YDDDP  196
            YDDDP
Sbjct  594  YDDDP  598



>ref|XP_010416111.1| PREDICTED: uncharacterized protein LOC104702013 isoform X1 [Camelina 
sativa]
Length=612

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 123/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  429  ENCELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  488

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ I+ISKNRGG++TA+F+SKL   AP L++++A +NLMP E
Sbjct  489  GPLGFLALGSKLEKGSKKLLSIDISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPE  548

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  ANG L+ LD++GN    + AD S +LS+++ NG+ + + LPSS A +VP
Sbjct  549  SLLMLCDSLRTANGGLKRLDMTGNNCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVP  607

Query  210  YDDDP  196
            YDDDP
Sbjct  608  YDDDP  612



>dbj|BAF00875.1| hypothetical protein [Arabidopsis thaliana]
Length=518

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 123/186 (66%), Gaps = 7/186 (4%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  ++    +  I SL+I  IGL
Sbjct  335  ENCELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAVVNSFTISIESLNIMGIGL  394

Query  558  GSSGF---SKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMP  388
            G  GF    +  E++ +  K++ INISKNRGG++TA+F+SKL   AP+L++I+A +NLMP
Sbjct  395  GPLGFLALGRKLEKVSK--KLLSINISKNRGGLETARFLSKLIPLAPKLISIDASYNLMP  452

Query  387  AESLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNV  214
             E+L ++   L  A G L+ LD++GN+   + AD +S+L +++ NG+ + +   SS  +V
Sbjct  453  PEALLMLCDSLRTAKGDLKRLDMTGNSCISHEADHSSLLHEFQHNGEPIFVLPSSSVSHV  512

Query  213  PYDDDP  196
            PYDDDP
Sbjct  513  PYDDDP  518



>ref|XP_006480175.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 3-like 
isoform X5 [Citrus sinensis]
Length=507

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 3/148 (2%)
 Frame = -3

Query  633  SEIGASIGKFMSKGILSLDIDDIGLGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKF  454
            S I AS+GKF    +  L+I  IGLGSSGF   Q+ + ++LK++ INISKNRGG++TAKF
Sbjct  361  SHIAASLGKFFGTSVQVLNIGAIGLGSSGFRVLQDGVTKELKLVNINISKNRGGVETAKF  420

Query  453  ISKLFSYAPELVAINAEFNLMPAESLAIIGSGL-AANGKLELLDLSGNASCENSADASVL  277
            +SKL S AP+LV +NA +NLMP ESL II S L  A G L+ LDL+GN      +  S+L
Sbjct  421  LSKLMSLAPDLVEVNAGYNLMPLESLTIICSALKVAKGHLQRLDLTGNNWELQPSHVSML  480

Query  276  SKYEINGKLVIIDLPS-SAPNVPYDDDP  196
            S++  NG L I+ LP+  A +VPYDD+P
Sbjct  481  SEFRHNG-LPILILPTLQALDVPYDDEP  507



>ref|XP_011014860.1| PREDICTED: uncharacterized protein LOC105118587 isoform X2 [Populus 
euphratica]
Length=606

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  425  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  484

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  485  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  544

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  545  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  603

Query  204  DDP  196
            DDP
Sbjct  604  DDP  606



>ref|XP_011014859.1| PREDICTED: uncharacterized protein LOC105118587 isoform X1 [Populus 
euphratica]
Length=607

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  426  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  485

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  486  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  545

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  546  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  604

Query  204  DDP  196
            DDP
Sbjct  605  DDP  607



>ref|NP_179611.2| RNI-like superfamily protein [Arabidopsis thaliana]
 gb|AEC06982.1| RNI-like superfamily protein [Arabidopsis thaliana]
Length=604

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 123/186 (66%), Gaps = 7/186 (4%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  ++    +  I SL+I  IGL
Sbjct  421  ENCELSCCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAVVNSFTISIESLNIMGIGL  480

Query  558  GSSGF---SKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMP  388
            G  GF    +  E++ +  K++ INISKNRGG++TA+F+SKL   AP+L++I+A +NLMP
Sbjct  481  GPLGFLALGRKLEKVSK--KLLSINISKNRGGLETARFLSKLIPLAPKLISIDASYNLMP  538

Query  387  AESLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNV  214
             E+L ++   L  A G L+ LD++GN+   + AD +S+L +++ NG+ + +   SS  +V
Sbjct  539  PEALLMLCDSLRTAKGDLKRLDMTGNSCISHEADHSSLLHEFQHNGEPIFVLPSSSVSHV  598

Query  213  PYDDDP  196
            PYDDDP
Sbjct  599  PYDDDP  604



>ref|XP_010489083.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X4 [Camelina sativa]
 ref|XP_010489084.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X5 [Camelina sativa]
 ref|XP_010489085.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X4 [Camelina sativa]
Length=524

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 122/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ L +LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  341  ENCELSCCGVIEFLDTLFMLEKPFKLLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  400

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ INISKNRGG++TA+F+SKL   AP L++++A +NLMP E
Sbjct  401  GPLGFLALGSKLEKGSKKLLSINISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPE  460

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  A G L+ LD++GN+   + AD S +LS+++ NG+ + + LPSS A +VP
Sbjct  461  SLLMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVP  519

Query  210  YDDDP  196
            YDDDP
Sbjct  520  YDDDP  524



>ref|XP_010489082.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X3 [Camelina sativa]
Length=603

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 122/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ L +LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  420  ENCELSCCGVIEFLDTLFMLEKPFKLLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  479

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ INISKNRGG++TA+F+SKL   AP L++++A +NLMP E
Sbjct  480  GPLGFLALGSKLEKGSKKLLSINISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPE  539

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  A G L+ LD++GN+   + AD S +LS+++ NG+ + + LPSS A +VP
Sbjct  540  SLLMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVP  598

Query  210  YDDDP  196
            YDDDP
Sbjct  599  YDDDP  603



>ref|XP_011014863.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 isoform 
X5 [Populus euphratica]
Length=571

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  390  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  449

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  450  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  509

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  510  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  568

Query  204  DDP  196
            DDP
Sbjct  569  DDP  571



>ref|XP_011014862.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 isoform 
X4 [Populus euphratica]
Length=578

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  397  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  456

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  457  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  516

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  517  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  575

Query  204  DDP  196
            DDP
Sbjct  576  DDP  578



>ref|XP_011014861.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 isoform 
X3 [Populus euphratica]
Length=599

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  G   LL+ LS L++P  SLS+  N LGSE+   + K +   I +L++  +GL
Sbjct  418  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSEVAGPLQKILGTAIKTLNVGGVGL  477

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  478  GSLGFQELEKGLMTELKLVDINISKNRGGFETARFLAKLISLAPNIIAINTAYNLMPLES  537

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            L +I S L  + G LE LDL+GN        AS+++++  NG+ ++I LPS  A +VPYD
Sbjct  538  LTVICSALKLSKGSLERLDLTGNNWDFQPNHASMVAEFHHNGRPILI-LPSYLAVDVPYD  596

Query  204  DDP  196
            DDP
Sbjct  597  DDP  599



>ref|XP_010489080.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X1 [Camelina sativa]
 ref|XP_010489081.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X2 [Camelina sativa]
Length=610

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 122/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ L +LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  427  ENCELSCCGVIEFLDTLFMLEKPFKLLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  486

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ INISKNRGG++TA+F+SKL   AP L++++A +NLMP E
Sbjct  487  GPLGFLALGSKLEKGSKKLLSINISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPE  546

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  A G L+ LD++GN+   + AD S +LS+++ NG+ + + LPSS A +VP
Sbjct  547  SLLMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHNGEPIFV-LPSSLASHVP  605

Query  210  YDDDP  196
            YDDDP
Sbjct  606  YDDDP  610



>ref|XP_002443071.1| hypothetical protein SORBIDRAFT_08g007590 [Sorghum bicolor]
 gb|EES16909.1| hypothetical protein SORBIDRAFT_08g007590 [Sorghum bicolor]
Length=606

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 116/182 (64%), Gaps = 2/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LLECL+ +++P   LSI  N+LGS + A++ KF+   + +L+  DIGL
Sbjct  426  ENCELSSIGVIMLLECLTTVKQPLDVLSIADNHLGSSVAAALAKFLGSHVRALNATDIGL  485

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP LV++NA  NL+P ES
Sbjct  486  GTLGFQILEEALPTEVALSHINISKNRGGIRAAYFVSRLIGRAPNLVSVNAAANLLPPES  545

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L +I + L      LE +DL+GN    ++   + L +++ +GK +++  P+ +   PYDD
Sbjct  546  LEVICNSLKQGTCYLERVDLTGNMHLSSNIFPAFL-EFKKHGKPILVVPPNLSTCAPYDD  604

Query  201  DP  196
            DP
Sbjct  605  DP  606



>ref|XP_010495912.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X4 [Camelina sativa]
Length=524

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 122/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  341  ENCELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  400

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ INISKNRGG +TA+F+SKL   AP L++++A +NLMP E
Sbjct  401  GPLGFLALGRKLEKGSKKLLSINISKNRGGQETARFLSKLIPLAPRLISVDASYNLMPPE  460

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  A G L+ LD++GN+   + AD S +LS+++ +G+ + + LPSS A +VP
Sbjct  461  SLLMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHSGEPIFV-LPSSLASHVP  519

Query  210  YDDDP  196
            YDDDP
Sbjct  520  YDDDP  524



>ref|XP_010495911.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X3 [Camelina sativa]
Length=525

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 122/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  342  ENCELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  401

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ INISKNRGG +TA+F+SKL   AP L++++A +NLMP E
Sbjct  402  GPLGFLALGRKLEKGSKKLLSINISKNRGGQETARFLSKLIPLAPRLISVDASYNLMPPE  461

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  A G L+ LD++GN+   + AD S +LS+++ +G+ + + LPSS A +VP
Sbjct  462  SLLMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHSGEPIFV-LPSSLASHVP  520

Query  210  YDDDP  196
            YDDDP
Sbjct  521  YDDDP  525



>tpg|DAA54822.1| TPA: hypothetical protein ZEAMMB73_341952 [Zea mays]
Length=250

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 116/182 (64%), Gaps = 2/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LLECL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  70   ENCELSSIGVIILLECLTNAKQLLDVLSIADNHLGSSVAAALARFLGSHVRALNATDIGL  129

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP+LV++NA  NL+P ES
Sbjct  130  GTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPDLVSVNAAGNLLPPES  189

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L +I + L      LE +DL+GN    ++   + L +++ +GK +++  P+ + + PYDD
Sbjct  190  LEVICNSLKQGTCNLERVDLTGNMHLSSNIFPAFL-EFKKHGKPILVVPPNLSTSAPYDD  248

Query  201  DP  196
            DP
Sbjct  249  DP  250



>ref|XP_010495909.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X2 [Camelina sativa]
Length=602

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 122/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  419  ENCELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  478

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ INISKNRGG +TA+F+SKL   AP L++++A +NLMP E
Sbjct  479  GPLGFLALGRKLEKGSKKLLSINISKNRGGQETARFLSKLIPLAPRLISVDASYNLMPPE  538

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  A G L+ LD++GN+   + AD S +LS+++ +G+ + + LPSS A +VP
Sbjct  539  SLLMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHSGEPIFV-LPSSLASHVP  597

Query  210  YDDDP  196
            YDDDP
Sbjct  598  YDDDP  602



>ref|XP_010495908.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 5-like 
isoform X1 [Camelina sativa]
Length=609

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 122/185 (66%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  I SL+I  IGL
Sbjct  426  ENCELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSFTVSIESLNISGIGL  485

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ INISKNRGG +TA+F+SKL   AP L++++A +NLMP E
Sbjct  486  GPLGFLALGRKLEKGSKKLLSINISKNRGGQETARFLSKLIPLAPRLISVDASYNLMPPE  545

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADAS-VLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L  A G L+ LD++GN+   + AD S +LS+++ +G+ + + LPSS A +VP
Sbjct  546  SLLMLCDSLRTAKGDLKRLDMTGNSCINHKADHSTLLSEFQHSGEPIFV-LPSSLASHVP  604

Query  210  YDDDP  196
            YDDDP
Sbjct  605  YDDDP  609



>ref|XP_006300089.1| hypothetical protein CARUB_v10016317mg [Capsella rubella]
 gb|EOA32987.1| hypothetical protein CARUB_v10016317mg [Capsella rubella]
Length=603

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 123/186 (66%), Gaps = 7/186 (4%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I    +  + S++I  IGL
Sbjct  420  ENCELSSCGVIEFLDTLSMLEKPLKFLSVADNALGSEVAEAIVNAFTFSVESINISGIGL  479

Query  558  GSSGFSKAQEEIVE-DLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF     ++ +   K++ INISKNRGG++TA+F+SKL   AP L++++A +NLMP E
Sbjct  480  GPLGFLALGRKLEKGSKKLLSINISKNRGGLETARFLSKLIPLAPRLISVDASYNLMPPE  539

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSA--DASVLSKYEINGKLVIIDLPSS-APNV  214
            SL ++   L  A G L+ LD++GN SC N A   +++L +++ NG+ + + LPSS A +V
Sbjct  540  SLLMLCDSLRTAKGDLKRLDMTGN-SCINQAAEHSTLLCEFQHNGEPIFV-LPSSFASHV  597

Query  213  PYDDDP  196
            PYDDDP
Sbjct  598  PYDDDP  603



>gb|ABA96837.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ20033.1| hypothetical protein OsJ_35632 [Oryza sativa Japonica Group]
Length=648

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 110/183 (60%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+LT  GV  LLECLS + +P   LSI  N+LGS +  ++ KF+  G+  L+I+DIG 
Sbjct  467  ENCDLTNIGVTELLECLSSVSEPLNLLSIADNHLGSSVAVALAKFLGSGVRELNIEDIGF  526

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF   +E +  D+ +  IN+SKNRGGI  A+F+S+L   AP LV++NA  NL+P ES
Sbjct  527  GPLGFQILEEALPADVALSHINVSKNRGGIRAARFVSRLIKQAPGLVSVNAGSNLLPPES  586

Query  378  LAIIGSGLAANGK--LELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            + +I   L       LE LDL GN    ++A  + L ++  +GK ++I         PYD
Sbjct  587  MEVICDVLKQKNTCNLERLDLMGNMHLSDAAFPAAL-EFRKHGKQILIVPSQPGACAPYD  645

Query  204  DDP  196
            DDP
Sbjct  646  DDP  648



>gb|EEC69043.1| hypothetical protein OsI_37874 [Oryza sativa Indica Group]
Length=648

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 110/183 (60%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+LT  GV  LLECLS + +P   LSI  N+LGS +  ++ KF+  G+  L+I+DIG 
Sbjct  467  ENCDLTNIGVTELLECLSSVSEPLNLLSIADNHLGSSVAVALAKFLGSGVRELNIEDIGF  526

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF   +E +  D+ +  IN+SKNRGGI  A+F+S+L   AP LV++NA  NL+P ES
Sbjct  527  GPLGFQILEEALPADVALSHINVSKNRGGIRAARFVSRLIKQAPGLVSVNAGSNLLPPES  586

Query  378  LAIIGSGLAANGK--LELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            + +I   L       LE LDL GN    ++A  + L ++  +GK ++I         PYD
Sbjct  587  MEVICDVLKQKNTCNLERLDLMGNMHLSDAAFPAAL-EFRKHGKQILIVPSQPGACAPYD  645

Query  204  DDP  196
            DDP
Sbjct  646  DDP  648



>ref|XP_006408937.1| hypothetical protein EUTSA_v10001935mg [Eutrema salsugineum]
 gb|ESQ50390.1| hypothetical protein EUTSA_v10001935mg [Eutrema salsugineum]
Length=603

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 121/184 (66%), Gaps = 3/184 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS  E+P   LS+  N LG E+  +I   ++  I SL+I  IGL
Sbjct  420  ENCELSCCGVIEFLDTLSTRERPLKFLSVADNALGREVSEAIVNSLTISIESLNISGIGL  479

Query  558  GSSGFSKAQEEIVEDLK-IICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF +   ++V+ LK +  INISKNRGG++TA+F+SKL   AP+LV+++A +NLMP E
Sbjct  480  GPVGFLELGRKLVKGLKKLRSINISKNRGGLETARFLSKLIPLAPKLVSVDASYNLMPPE  539

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPY  208
            SL ++   L +A G L+ LD++GN    + AD +S+L +++ N + + +   SSA +VPY
Sbjct  540  SLLMLRDSLRSAKGDLKRLDMTGNNCISHEADHSSLLGEFQHNREPIFVLSSSSASHVPY  599

Query  207  DDDP  196
            DD+P
Sbjct  600  DDEP  603



>ref|XP_002443070.1| hypothetical protein SORBIDRAFT_08g007580 [Sorghum bicolor]
 gb|EES16908.1| hypothetical protein SORBIDRAFT_08g007580 [Sorghum bicolor]
Length=579

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 116/182 (64%), Gaps = 2/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LLECL+ +++P   LSI  N+LGS + A++ KF+   + +L+  DIGL
Sbjct  399  ENCELSSIGVIMLLECLTTVKQPLDVLSIADNHLGSSVAAALAKFLGSHVRALNATDIGL  458

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP LV++NA  NL+P ES
Sbjct  459  GTLGFQILEEALPTEVALSHINISKNRGGIRAAYFVSRLIGRAPNLVSVNAAANLLPPES  518

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L +I + L      LE ++L+GN    ++   + L +++ +GK +++  P+ +   PYDD
Sbjct  519  LEVICNSLKQGTCNLERVNLTGNMHLSSNIFPAFL-EFKKHGKPILVVPPNLSTCAPYDD  577

Query  201  DP  196
            DP
Sbjct  578  DP  579



>ref|XP_002321304.2| hypothetical protein POPTR_0014s18520g [Populus trichocarpa]
 gb|EEE99619.2| hypothetical protein POPTR_0014s18520g [Populus trichocarpa]
Length=651

 Score =   138 bits (348),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 123/183 (67%), Gaps = 3/183 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  G   LL+ LS L++P  SLS+  N LGS++   + K +   I +L++  +GL
Sbjct  470  ENCELSCSGATELLDSLSNLKRPLNSLSLADNGLGSDVAGPLQKILGTSIKTLNVGGVGL  529

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + ++ ++ +LK++ INISKNRGG +TA+F++KL S AP ++AIN  +NLMP ES
Sbjct  530  GSLGFQELEKGLMAELKLVDINISKNRGGFETARFLAKLMSLAPNIIAINTAYNLMPLES  589

Query  378  LAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSS-APNVPYD  205
            L +I S L  + G LE LDL+GN        AS+++++  NG+ + I LPS  A +VPYD
Sbjct  590  LTVICSALKLSKGSLERLDLTGNNWDYQPNHASMVAEFHRNGRPIFI-LPSYLAVDVPYD  648

Query  204  DDP  196
            DDP
Sbjct  649  DDP  651



>ref|XP_008789483.1| PREDICTED: uncharacterized protein LOC103706967 isoform X3 [Phoenix 
dactylifera]
Length=506

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 118/185 (64%), Gaps = 6/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  562
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+++G
Sbjct  324  ENCNLSGMGVAELLRNLPTLKEPLKTLSLADNDLGSFVAAPLAKFLGNSGVRVLNIEEVG  383

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            LG  GF + ++E+   + +  INISKNRGGI  A FI+K+    P+LV+INA  N+MPAE
Sbjct  384  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFIAKVILQVPDLVSINAGGNIMPAE  443

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGK--LVIIDLPSSAPNVP  211
            S+ II   L  + GKLE LDL+GN     S+  ++L ++  +GK  + I  LP++    P
Sbjct  444  SVEIIYDALKQSKGKLERLDLTGNTQLCQSSYIAMLLEFHCHGKPIVAISSLPTA--ETP  501

Query  210  YDDDP  196
            YDDDP
Sbjct  502  YDDDP  506



>ref|XP_010940683.1| PREDICTED: uncharacterized protein LOC105059159 isoform X2 [Elaeis 
guineensis]
Length=668

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 115/183 (63%), Gaps = 2/183 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  562
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+DI 
Sbjct  486  ENCNLSGMGVSELLGNLPTLKEPLKTLSLADNDLGSYVAAPLAKFLGNSGVRVLNIEDIE  545

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            LG  GF + ++E+   + +  INISKNRGGI  A F++K+   AP+LV+INA  N+MP E
Sbjct  546  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFVAKVILQAPDLVSINAGGNIMPPE  605

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            S+ +I   L  + GKLE LD +GN    +S+  SVL ++  +GK +++       + PYD
Sbjct  606  SVKVIYDALKQSKGKLERLDFTGNTQLCHSSYISVLLEFHCHGKPIVVIPSLRTTDAPYD  665

Query  204  DDP  196
            DDP
Sbjct  666  DDP  668



>ref|XP_010940682.1| PREDICTED: uncharacterized protein LOC105059159 isoform X1 [Elaeis 
guineensis]
Length=683

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 115/183 (63%), Gaps = 2/183 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  562
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+DI 
Sbjct  501  ENCNLSGMGVSELLGNLPTLKEPLKTLSLADNDLGSYVAAPLAKFLGNSGVRVLNIEDIE  560

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            LG  GF + ++E+   + +  INISKNRGGI  A F++K+   AP+LV+INA  N+MP E
Sbjct  561  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFVAKVILQAPDLVSINAGGNIMPPE  620

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            S+ +I   L  + GKLE LD +GN    +S+  SVL ++  +GK +++       + PYD
Sbjct  621  SVKVIYDALKQSKGKLERLDFTGNTQLCHSSYISVLLEFHCHGKPIVVIPSLRTTDAPYD  680

Query  204  DDP  196
            DDP
Sbjct  681  DDP  683



>ref|XP_010940684.1| PREDICTED: uncharacterized protein LOC105059159 isoform X3 [Elaeis 
guineensis]
Length=641

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 115/183 (63%), Gaps = 2/183 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  562
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+DI 
Sbjct  459  ENCNLSGMGVSELLGNLPTLKEPLKTLSLADNDLGSYVAAPLAKFLGNSGVRVLNIEDIE  518

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            LG  GF + ++E+   + +  INISKNRGGI  A F++K+   AP+LV+INA  N+MP E
Sbjct  519  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFVAKVILQAPDLVSINAGGNIMPPE  578

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            S+ +I   L  + GKLE LD +GN    +S+  SVL ++  +GK +++       + PYD
Sbjct  579  SVKVIYDALKQSKGKLERLDFTGNTQLCHSSYISVLLEFHCHGKPIVVIPSLRTTDAPYD  638

Query  204  DDP  196
            DDP
Sbjct  639  DDP  641



>ref|XP_008789482.1| PREDICTED: uncharacterized protein LOC103706967 isoform X2 [Phoenix 
dactylifera]
Length=572

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 118/185 (64%), Gaps = 6/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  562
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+++G
Sbjct  390  ENCNLSGMGVAELLRNLPTLKEPLKTLSLADNDLGSFVAAPLAKFLGNSGVRVLNIEEVG  449

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            LG  GF + ++E+   + +  INISKNRGGI  A FI+K+    P+LV+INA  N+MPAE
Sbjct  450  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFIAKVILQVPDLVSINAGGNIMPAE  509

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGK--LVIIDLPSSAPNVP  211
            S+ II   L  + GKLE LDL+GN     S+  ++L ++  +GK  + I  LP++    P
Sbjct  510  SVEIIYDALKQSKGKLERLDLTGNTQLCQSSYIAMLLEFHCHGKPIVAISSLPTA--ETP  567

Query  210  YDDDP  196
            YDDDP
Sbjct  568  YDDDP  572



>ref|XP_008789480.1| PREDICTED: uncharacterized protein LOC103706967 isoform X1 [Phoenix 
dactylifera]
Length=620

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 118/185 (64%), Gaps = 6/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIG  562
            ENC L+G GV  LL  L  L++P  +LS+  N LGS + A + KF+ + G+  L+I+++G
Sbjct  438  ENCNLSGMGVAELLRNLPTLKEPLKTLSLADNDLGSFVAAPLAKFLGNSGVRVLNIEEVG  497

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            LG  GF + ++E+   + +  INISKNRGGI  A FI+K+    P+LV+INA  N+MPAE
Sbjct  498  LGPLGFQELEKEMPNKMALFDINISKNRGGIRAAYFIAKVILQVPDLVSINAGGNIMPAE  557

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGK--LVIIDLPSSAPNVP  211
            S+ II   L  + GKLE LDL+GN     S+  ++L ++  +GK  + I  LP++    P
Sbjct  558  SVEIIYDALKQSKGKLERLDLTGNTQLCQSSYIAMLLEFHCHGKPIVAISSLPTA--ETP  615

Query  210  YDDDP  196
            YDDDP
Sbjct  616  YDDDP  620



>ref|XP_008674147.1| PREDICTED: uncharacterized protein LOC103650329 [Zea mays]
Length=651

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 116/182 (64%), Gaps = 2/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LLECL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  471  ENCELSSIGVIILLECLTNAKQLLDVLSIADNHLGSSVAAALARFLGSHVRALNATDIGL  530

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP+LV++NA  NL+P ES
Sbjct  531  GTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPDLVSVNAAGNLLPPES  590

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L +I + L      LE +DL+GN    ++   + L +++ +GK +++  P+ + + PYDD
Sbjct  591  LEVICNSLKQGTCNLERVDLTGNMHLSSNIFPAFL-EFKKHGKPILVVPPNLSTSAPYDD  649

Query  201  DP  196
            DP
Sbjct  650  DP  651



>emb|CBI37239.3| unnamed protein product [Vitis vinifera]
Length=580

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLG  556
            +C+L+ +GV  LL+ LS L+ P  SLSI  N LGS+    +GKF+   I  L+++DIGLG
Sbjct  440  DCDLSCNGVTQLLDVLSTLKNPLHSLSIAHNELGSQAAGPLGKFLRTVIRVLNVEDIGLG  499

Query  555  SSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  376
            SSGF K QE++ E++K++ INISKNRG ++TA F+ KL S APELV +NA +N MP ESL
Sbjct  500  SSGFLKLQEDMPEEVKLVSINISKNRGRLETANFLLKLMSKAPELVVVNAAYNFMPVESL  559

Query  375  AIIGSGL  355
             ++ S L
Sbjct  560  TVVHSSL  566



>ref|XP_010652449.1| PREDICTED: protein NLRC3 isoform X2 [Vitis vinifera]
Length=589

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLG  556
            +C+L+ +GV  LL+ LS L+ P  SLSI  N LGS+    +GKF+   I  L+++DIGLG
Sbjct  440  DCDLSCNGVTQLLDVLSTLKNPLHSLSIAHNELGSQAAGPLGKFLRTVIRVLNVEDIGLG  499

Query  555  SSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESL  376
            SSGF K QE++ E++K++ INISKNRG ++TA F+ KL S APELV +NA +N MP ESL
Sbjct  500  SSGFLKLQEDMPEEVKLVSINISKNRGRLETANFLLKLMSKAPELVVVNAAYNFMPVESL  559

Query  375  AIIGSGL  355
             ++ S L
Sbjct  560  TVVHSSL  566



>ref|XP_002883938.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60197.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=603

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 119/184 (65%), Gaps = 3/184 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ LS+LEKP   LS+  N LGSE+  +I   ++  I SL+I  +GL
Sbjct  420  ENCELSCCGVIEFLDTLSMLEKPIKFLSVADNALGSEVAEAIVNSITVSIESLNISGVGL  479

Query  558  GSSGF-SKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF +  ++      K++ INISKNRGG++TA+F+SKL   AP+L++I+A +NLMP E
Sbjct  480  GPLGFLALGRKLEKGLKKLLSINISKNRGGLETARFMSKLIPLAPKLISIDASYNLMPPE  539

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSK-YEINGKLVIIDLPSSAPNVPY  208
            +L ++   L  A   L+ LD++GN+   + AD S L + ++ NG+ + +   SS  +VPY
Sbjct  540  ALLMLCESLRTAKCDLKRLDMTGNSCISHEADHSSLHREFQHNGEPIFVLPSSSVSHVPY  599

Query  207  DDDP  196
            DDDP
Sbjct  600  DDDP  603



>ref|XP_003576947.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 [Brachypodium 
distachyon]
 ref|XP_010238597.1| PREDICTED: NACHT, LRR and PYD domains-containing protein 13 [Brachypodium 
distachyon]
Length=653

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 109/182 (60%), Gaps = 2/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+L+  GV  LLECL+ + +P   LSI  NYLGS + A++ KF+   +  L+++DIGL
Sbjct  473  ENCDLSSIGVTKLLECLTSVNRPLDMLSIADNYLGSSVAAALVKFLGSHVRELNVEDIGL  532

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF   +E +  ++ +  INISKNRGGI TA FIS+L   AP LV++NA  NL+P ES
Sbjct  533  GPLGFQILEEALPREVHLSHINISKNRGGIRTAHFISRLILQAPNLVSVNAGSNLLPPES  592

Query  378  LAIIGSGLAANG-KLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L +I + L      L  LDL GN    +SA     S+++ +G+ +++          YD 
Sbjct  593  LEVICNALKQTTCNLVRLDLMGNVHL-SSAIFPAASEFKKHGEPILVVPSQPGACATYDA  651

Query  201  DP  196
            DP
Sbjct  652  DP  653



>ref|XP_009405714.1| PREDICTED: protein NLRC3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009405722.1| PREDICTED: protein NLRC3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009405731.1| PREDICTED: protein NLRC3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=621

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 108/182 (59%), Gaps = 5/182 (3%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIGL  559
            NC L+  GV  LL  L  L+    S S+  N LGS I A + KF+ S  +  L+I+D+ L
Sbjct  443  NCNLSCTGVAELLRSLPTLKG---SFSVAENNLGSSIAAPLAKFLASSSVRKLNIEDVEL  499

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G+ GF + +++I + + +  INISKNRGG+  A FI KL  Y+P +  INA  NLMP ES
Sbjct  500  GTLGFQQLEDQIPKKMALQSINISKNRGGLRAAYFIVKLLMYSPSIAYINAGGNLMPPES  559

Query  378  LAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
              +I   L  + GKLE LDL GN     S  AS L+++ ++G+ ++I     A + PYDD
Sbjct  560  SEVIYGALKQSQGKLETLDLGGNTQLCQSNYASRLTEFRLHGRPIVIVPLLPASSTPYDD  619

Query  201  DP  196
            DP
Sbjct  620  DP  621



>ref|XP_004960752.1| PREDICTED: uncharacterized protein LOC101762404 [Setaria italica]
Length=656

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 113/182 (62%), Gaps = 2/182 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+L+  GV  LLECL+ +++P   LSI  N LGS + A + KF+   +  L+I+DI L
Sbjct  476  ENCDLSSIGVSELLECLTYVKQPLDVLSIADNPLGSSVAAVLAKFLGSHVRDLNIEDIDL  535

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G+ GF   +E +  ++ +  INISKNRGGI  A F+SKL    P LV++NA  N++P ES
Sbjct  536  GALGFQILEEALPMEVALSHINISKNRGGIRAAYFVSKLILQTPNLVSVNAAANILPPES  595

Query  378  LAIIGSGLAANG-KLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDD  202
            L +I + L      LE +DL+GN    +++  + L +++ +GK +++   + +   PYDD
Sbjct  596  LEVICNTLKQRTCNLERVDLTGNFHLSSTSFPAFL-EFKKHGKPILVVPSNLSTCAPYDD  654

Query  201  DP  196
            DP
Sbjct  655  DP  656



>gb|KFK40400.1| hypothetical protein AALP_AA3G368500 [Arabis alpina]
Length=602

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 119/185 (64%), Gaps = 5/185 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV   L+ L  L+K    LSI  N LGSE+   I   ++  I SL+I  IGL
Sbjct  419  ENCELSCCGVIEFLDTLLTLKKSLKFLSIADNALGSEVSEGIVNSLTIAIESLNISGIGL  478

Query  558  GSSGFSKAQEEIVEDLKIIC-INISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            G  GF + + ++ + +K +  INISKNRGG++TA+F+SKL   AP+LV+++  +NLMP E
Sbjct  479  GPGGFLELRRKLEKGMKKLSSINISKNRGGLETARFLSKLIPLAPKLVSVDTSYNLMPPE  538

Query  381  SLAIIGSGLA-ANGKLELLDLSGNASCENSAD-ASVLSKYEINGKLVIIDLPSS-APNVP  211
            SL ++   L    G L+ +D++GN+   +  D +S+L +++ NG+ + + LPSS   +VP
Sbjct  539  SLLMLCDSLRNTKGDLKRIDMTGNSFISHETDHSSLLGEFQHNGEPIFV-LPSSLTSHVP  597

Query  210  YDDDP  196
            YDD+P
Sbjct  598  YDDEP  602



>ref|XP_011458062.1| PREDICTED: protein NLRC5 isoform X2 [Fragaria vesca subsp. vesca]
Length=578

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+ HGV  L++ LS L +P  SLSI  N LGS++   +G+F+   I  L+   IGL
Sbjct  432  ENCELSCHGVTELIKTLSSLSRPLKSLSIADNDLGSQVAGVLGEFLCTPIQVLNAGGIGL  491

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
             SSGF   QE++ ++LK++ I+ISKNRGGI+TA F+SKL S AP+L  +NA +NLMP ES
Sbjct  492  RSSGFQVLQEKLTKELKLVEIDISKNRGGIETANFLSKLMSEAPKLAIVNAAYNLMPVES  551

Query  378  LAIIGSGL  355
            L  I S +
Sbjct  552  LTAICSAI  559



>ref|XP_007151779.1| hypothetical protein PHAVU_004G074200g, partial [Phaseolus vulgaris]
 gb|ESW23773.1| hypothetical protein PHAVU_004G074200g, partial [Phaseolus vulgaris]
Length=170

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 84/128 (66%), Gaps = 3/128 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+L+  GV  LL  LS  + P   L I  NYLG +    I  F+   I  LDI  IGL
Sbjct  28   ENCDLSYVGVNHLLHVLSSFKGPLKFLFIADNYLG-KFHWEI--FLVPTIEVLDIGGIGL  84

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            GS GF + Q  I E+LK++ INISKNRGGI+TAKF+SKL S AP+LV +NA  NLMP ES
Sbjct  85   GSYGFQELQNLIKEELKLVKINISKNRGGIETAKFLSKLLSQAPQLVEVNAASNLMPIES  144

Query  378  LAIIGSGL  355
            LAI+ S L
Sbjct  145  LAIVYSAL  152



>gb|KEH23987.1| LRR ribonuclease inhibitor domain protein [Medicago truncatula]
Length=620

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 108/184 (59%), Gaps = 3/184 (2%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E C+L+   V  LL+ L VL     SLSI  N LGS++  ++G+F+S  I  LD   I L
Sbjct  437  EACDLSCDVVNHLLDSLPVLNGTLKSLSIAENCLGSKVAGALGRFLSTPIEVLDASGIDL  496

Query  558  GSSGFSKAQE--EIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPA  385
              SGF + Q    I E+L ++ INISKNRGGI TA+F+SKL   AP LV +NA  N MP 
Sbjct  497  LPSGFLELQNMLTIEEELSLVIINISKNRGGIQTARFLSKLLPQAPRLVDVNASSNCMPI  556

Query  384  ESLAIIGSGLA-ANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPY  208
            ESL+II S L  A G +  LDL+G+         S+ +++  NGK +++   SSA   P 
Sbjct  557  ESLSIISSALKFAKGNVLNLDLTGHDWDYTPELTSLCTEFVHNGKPILMLPVSSATAAPI  616

Query  207  DDDP  196
            D DP
Sbjct  617  DHDP  620



>ref|XP_003625467.1| hypothetical protein MTR_7g099450 [Medicago truncatula]
Length=602

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 108/186 (58%), Gaps = 5/186 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E C+L+   V  LL+ L VL     SLSI  N LGS++  ++G+F+S  I  LD   I L
Sbjct  417  EACDLSCDVVNHLLDSLPVLNGTLKSLSIAENCLGSKVAGALGRFLSTPIEVLDASGIDL  476

Query  558  GSSGFSKAQE--EIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPA  385
              SGF + Q    I E+L ++ INISKNRGGI TA+F+SKL   AP LV +NA  N MP 
Sbjct  477  LPSGFLELQNMLTIEEELSLVIINISKNRGGIQTARFLSKLLPQAPRLVDVNASSNCMPI  536

Query  384  ESLAIIGSGL---AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNV  214
            ESL+II S L    A G +  LDL+G+         S+ +++  NGK +++   SSA   
Sbjct  537  ESLSIISSALKFAKAAGNVLNLDLTGHDWDYTPELTSLCTEFVHNGKPILMLPVSSATAA  596

Query  213  PYDDDP  196
            P D DP
Sbjct  597  PIDHDP  602



>gb|AES81685.2| LRR ribonuclease inhibitor domain protein [Medicago truncatula]
Length=622

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 108/186 (58%), Gaps = 5/186 (3%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            E C+L+   V  LL+ L VL     SLSI  N LGS++  ++G+F+S  I  LD   I L
Sbjct  437  EACDLSCDVVNHLLDSLPVLNGTLKSLSIAENCLGSKVAGALGRFLSTPIEVLDASGIDL  496

Query  558  GSSGFSKAQE--EIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPA  385
              SGF + Q    I E+L ++ INISKNRGGI TA+F+SKL   AP LV +NA  N MP 
Sbjct  497  LPSGFLELQNMLTIEEELSLVIINISKNRGGIQTARFLSKLLPQAPRLVDVNASSNCMPI  556

Query  384  ESLAIIGSGL---AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNV  214
            ESL+II S L    A G +  LDL+G+         S+ +++  NGK +++   SSA   
Sbjct  557  ESLSIISSALKFAKAAGNVLNLDLTGHDWDYTPELTSLCTEFVHNGKPILMLPVSSATAA  616

Query  213  PYDDDP  196
            P D DP
Sbjct  617  PIDHDP  622



>ref|XP_006854345.1| hypothetical protein AMTR_s00039p00144340 [Amborella trichopoda]
 gb|ERN15812.1| hypothetical protein AMTR_s00039p00144340 [Amborella trichopoda]
Length=647

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 109/183 (60%), Gaps = 2/183 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKG-ILSLDIDDIG  562
            +NC+L+  G    L+  S      T+LSI  NYLGS     +G F+    I  LDI+ IG
Sbjct  465  DNCDLSSVGATQFLDIFSTSCGHLTALSIAYNYLGSRAVIPLGNFLEASCIRRLDIEAIG  524

Query  561  LGSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            L  SG +   + +  +L++  IN+SKNRGGI T+ F+S+L   +P+L++++A +N +P E
Sbjct  525  LDCSGLTDFAKALPSNLELAHINLSKNRGGIGTSTFVSQLILRSPDLLSVDASYNFVPQE  584

Query  381  SLAIIGSGL-AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYD  205
            SL +I + L  + GKL+ LDL+GN     S  AS+  +++  G+ V++   S  P V YD
Sbjct  585  SLPLIHAALRQSKGKLKRLDLTGNPGLCQSKIASMFDEFQNMGEPVVLFPSSPIPRVSYD  644

Query  204  DDP  196
            DDP
Sbjct  645  DDP  647



>gb|EMT06714.1| Protein NLRC3 [Aegilops tauschii]
Length=693

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 98/181 (54%), Gaps = 21/181 (12%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+L+  GV  LLECL+ + KP   LSI  N+LGS + A++ KF+   +  L+++DIGL
Sbjct  534  ENCDLSSIGVTKLLECLAPINKPLDMLSIADNHLGSSVAATLVKFLGSHVRELNVEDIGL  593

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF   +E +   + +  INISKNRGG+ TA F+S+L   AP L+++NA  NL+P ES
Sbjct  594  GPIGFQILEEALPRKVNLSHINISKNRGGMGTAHFVSRLILQAPNLISVNAGSNLLPPES  653

Query  378  LAIIGSGLAANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNVPYDDD  199
            L +I + L      E                     ++  GK +++         PYD D
Sbjct  654  LEVICNALKQTTFFE---------------------FKKRGKPILLVPSQQGSCAPYDAD  692

Query  198  P  196
            P
Sbjct  693  P  693



>ref|XP_008652837.1| PREDICTED: uncharacterized protein LOC103632898 [Zea mays]
Length=149

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LLECL+  ++    LSI  N+LGS + A++ +F+   + +L+   IGL
Sbjct  15   ENCELSSIGVIILLECLTNAKQLLDVLSIADNHLGSSVAAALARFLGSHVQALNATYIGL  74

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G+ GF   +E +  ++ +  INISKNRGGI  A F+SKL   AP LV+INA  NL+P ES
Sbjct  75   GTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSKLICQAPNLVSINATGNLLPPES  134

Query  378  LAIIGSGL  355
            L +I + L
Sbjct  135  LEVICNSL  142



>gb|EMS58433.1| Protein NLRC3 [Triticum urartu]
Length=628

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENC+L+  GV  LLECL+ + K    LSI  N+LGS + A++ KF+   +  L+++DIGL
Sbjct  439  ENCDLSSVGVTKLLECLTSINKLLDMLSIADNHLGSSVAATLVKFLGSHVRELNVEDIGL  498

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G  GF   +E +   + +  INISKNRGG+ TA FIS+L   AP LV+++A  NL+P ES
Sbjct  499  GPIGFQILEEALPRKVNLSHINISKNRGGMGTAHFISRLIVQAPNLVSVDAGSNLLPPES  558

Query  378  LAIIGSGLAANGKLEL  331
            L +I + L      E 
Sbjct  559  LEVICNALKQTTLFEF  574



>ref|XP_010540943.1| PREDICTED: protein NLRC3 isoform X2 [Tarenaya hassleriana]
Length=560

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 95/131 (73%), Gaps = 1/131 (1%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+ LS+LEKP  SLSI  N LGS +  +IG F++  I SL+I  +GL
Sbjct  419  ENCELSCDGVIDLLDSLSLLEKPLKSLSIADNALGSGVADAIGDFLASPIQSLNISGMGL  478

Query  558  GSSGFSKAQEEIVEDLKIIC-INISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAE  382
            GS GF + Q +IV++L ++  INISKNRGG++ A+F+SKL   AP+L++ +  +NLMP+E
Sbjct  479  GSIGFLELQRKIVKELMMLLNINISKNRGGLEAARFLSKLIPLAPKLLSADTSYNLMPSE  538

Query  381  SLAIIGSGLAA  349
            SL+++ + L +
Sbjct  539  SLSLLCTSLKS  549



>ref|XP_008673554.1| PREDICTED: uncharacterized protein LOC103649591 [Zea mays]
Length=151

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 80/125 (64%), Gaps = 0/125 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  17   ENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALNATDIGL  76

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLMPAES  379
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP LV++NA  NL    +
Sbjct  77   GTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPNLVSVNAAGNLWTLCN  136

Query  378  LAIIG  364
            + +IG
Sbjct  137  MCMIG  141



>ref|XP_008664178.1| PREDICTED: uncharacterized protein LOC103642767 [Zea mays]
Length=231

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 76/116 (66%), Gaps = 0/116 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  13   ENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALNATDIGL  72

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPELVAINAEFNLM  391
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP LV++NA +NL 
Sbjct  73   GTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPNLVSVNAAWNLW  128



>gb|EYU17965.1| hypothetical protein MIMGU_mgv1a0245891mg, partial [Erythranthe 
guttata]
Length=99

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = -3

Query  483  NRGGIDTAKFISKLFSYAPELVAINAEFNLMPAESLAIIGSGL-AANGKLELLDLSGNAS  307
            N+GGI+ A+FIS L ++A ++ AI+A +NLMP ESL++I +GL A+ G LE LDLSGN+ 
Sbjct  2    NQGGIEAARFISSLVTHAHKITAIDARYNLMPTESLSVISAGLRASKGTLEHLDLSGNSL  61

Query  306  CENSAD-ASVLSKYEINGKLVIIDLPSSAPNVPYDDDP  196
            C+   D ASVL+++ I+G   +    S+APNVPYD+DP
Sbjct  62   CDQLVDEASVLAEFRIHGHCPLNISLSAAPNVPYDNDP  99



>ref|XP_008664260.1| PREDICTED: uncharacterized protein LOC103642868 [Zea mays]
Length=125

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 68/106 (64%), Gaps = 0/106 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  17   ENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALNATDIGL  76

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAPEL  421
            G+ GF   +E +  ++ +  INISKNRGGI  A F+S+L   AP L
Sbjct  77   GTVGFQILEETLPTEVALSHINISKNRGGIRAAYFVSRLICRAPNL  122



>gb|EYU17964.1| hypothetical protein MIMGU_mgv1a0245892mg, partial [Erythranthe 
guttata]
Length=372

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCELT   V  LL  LS ++KP   LSI  N LGS+IG S+G+++  G+ ++DI+DIGL
Sbjct  290  ENCELTCDQVIELLGVLSTMKKPLNLLSIKGNRLGSKIGVSLGEYLRSGVCAVDIEDIGL  349

Query  558  GSSGFSKAQEEIVEDLKIICINI  490
            GSSGF +A +EI ++LKI+ INI
Sbjct  350  GSSGFREALKEISKELKIVYINI  372



>ref|XP_008661204.1| PREDICTED: uncharacterized protein LOC103640392 [Zea mays]
Length=156

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LLECL+ +++    LSI  N+LGS + A++ +F+   + +L   DIGL
Sbjct  66   ENCELSSIGVITLLECLTNVKQLLDVLSIADNHLGSSMAAALARFLGSHVRALTATDIGL  125

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGG  472
            G  GF   +E +  ++ +  INISKN  G
Sbjct  126  GIVGFQTLEETLPTEVALSHINISKNLVG  154



>ref|XP_010652450.1| PREDICTED: uncharacterized protein LOC100261775 isoform X3 [Vitis 
vinifera]
Length=517

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLG  556
            +C+L+ +GV  LL+ LS L+ P  SLSI  N LGS+    +GKF+   I  L+++DIGLG
Sbjct  440  DCDLSCNGVTQLLDVLSTLKNPLHSLSIAHNELGSQAAGPLGKFLRTVIRVLNVEDIGLG  499

Query  555  SSGFSKAQEEIVEDLK  508
            SSGF K QE++ E+ K
Sbjct  500  SSGFLKLQEDMPEEQK  515



>gb|KJB42372.1| hypothetical protein B456_007G151600 [Gossypium raimondii]
Length=502

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGLG  556
            +CEL+  GV  LL+ LS L +P  SLS+  N LGS++  ++GKF    I  L+++ IGLG
Sbjct  352  SCELSSDGVILLLDVLSTLARPLNSLSLADNGLGSQVAEALGKFWGTSIQVLNLEGIGLG  411

Query  555  SSGFSKAQEEIVEDLKIICINI  490
             SGF K ++  +E+LK++ +NI
Sbjct  412  PSGFRKLRDIRMENLKLVKLNI  433



>ref|XP_008461991.1| PREDICTED: leucine-rich repeat-containing protein 16A isoform 
X2 [Cucumis melo]
Length=506

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL  LS L KP  SLS+  N LGS +  ++G FM K I  L+++ IGL
Sbjct  423  ENCELSCDGVTQLLNVLSTLRKPLRSLSVADNSLGSSVAGALGVFMGKSIQILNVEGIGL  482

Query  558  GSSGFSKAQEEIVEDLKIICINI  490
            G  GF    E + E   I+ INI
Sbjct  483  GPCGFQDLVEGVTEGSNIVNINI  505



>gb|AFW59093.1| hypothetical protein ZEAMMB73_800081 [Zea mays]
Length=821

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  434  ENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALNATDIGL  493

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAK  457
            G+ GF   +E +  ++ +  INISK    +DT K
Sbjct  494  GTVGFQILEETLPTEVALSHINISK----VDTLK  523



>tpg|DAA54821.1| TPA: hypothetical protein ZEAMMB73_341952 [Zea mays]
Length=166

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LLECL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  70   ENCELSSIGVIILLECLTNAKQLLDVLSIADNHLGSSVAAALARFLGSHVRALNATDIGL  129

Query  558  GSSGFSKAQEEIVEDLKIICINI  490
            G+ GF   +E +  ++ +  INI
Sbjct  130  GTVGFQILEETLPTEVALSHINI  152



>gb|AFW59095.1| hypothetical protein ZEAMMB73_800081 [Zea mays]
Length=404

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 58/94 (62%), Gaps = 4/94 (4%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  17   ENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALNATDIGL  76

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRGGIDTAK  457
            G+ GF   +E +  ++ +  INISK    +DT K
Sbjct  77   GTVGFQILEETLPTEVALSHINISK----VDTLK  106



>tpg|DAA52872.1| TPA: putative RNA helicase family protein [Zea mays]
Length=911

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  137  ENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALNATDIGL  196

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRG  475
            G+ GF   +E +  ++ +  INIS + G
Sbjct  197  GTVGFQILEETLPTEVALSHINISVSLG  224



>tpg|DAA52873.1| TPA: putative RNA helicase family protein [Zea mays]
Length=940

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  137  ENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALNATDIGL  196

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRG  475
            G+ GF   +E +  ++ +  INIS + G
Sbjct  197  GTVGFQILEETLPTEVALSHINISVSLG  224



>tpg|DAA52871.1| TPA: putative RNA helicase family protein [Zea mays]
Length=484

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -3

Query  738  ENCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGILSLDIDDIGL  559
            ENCEL+  GV  LL+CL+  ++    LSI  N+LGS + A++ +F+   + +L+  DIGL
Sbjct  137  ENCELSSIGVIILLDCLTNAKQLLDVLSIADNHLGSPVAAALARFLGSHVRALNATDIGL  196

Query  558  GSSGFSKAQEEIVEDLKIICINISKNRG  475
            G+ GF   +E +  ++ +  INIS + G
Sbjct  197  GTVGFQILEETLPTEVALSHINISVSLG  224



>ref|XP_002964411.1| hypothetical protein SELMODRAFT_405633 [Selaginella moellendorffii]
 gb|EFJ34744.1| hypothetical protein SELMODRAFT_405633 [Selaginella moellendorffii]
Length=572

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 94/187 (50%), Gaps = 10/187 (5%)
 Frame = -3

Query  732  CELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSK-GILSLDIDDIGLG  556
            CEL+ +G+  LL+ L        SLS+  N  G    A + K++ K  +  LDI +IGLG
Sbjct  388  CELSWNGLSSLLDSLVSTNHRLRSLSVADNSFGRSGSAVLAKYLQKSAVKELDISEIGLG  447

Query  555  SSGF-SKAQEEIVEDLKIICINISKNRGGIDTAKFISKLFSYAP-ELVAINAEFNLMPAE  382
            S G  S+    ++++  +  +NISKNR     A+ +  + S     L  INA FNL+  E
Sbjct  448  SLGCSSELASALIQNQTLEHLNISKNRIAFPGAELLHAVISKGQGVLTDINASFNLLNVE  507

Query  381  SLAIIGSGL----AANGKLELLDLSGNASCENSADASVLSKYEINGKLVIIDLPSSAPNV  214
            ++  + S L    A  G+++ LDL GN        A++   +   G   I+ L SS   V
Sbjct  508  AMKRLASALQTKAALGGRMKRLDLLGNPGIP-PPGANLFGSFS-EGPDAIVLLSSSQFYV  565

Query  213  P-YDDDP  196
            P +DDDP
Sbjct  566  PLHDDDP  572



>ref|XP_001751929.1| predicted protein [Physcomitrella patens]
 gb|EDQ83364.1| predicted protein [Physcomitrella patens]
Length=284

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 94/196 (48%), Gaps = 23/196 (12%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFMSKGIL-SLDIDDIGL  559
            +C++T      +L  LS  +     LS+  N LGS +  S+ +F+ K  L +LD+ DI L
Sbjct  96   SCQMTATSAIVMLNALSNSQTTLRRLSLAGNSLGSTVVQSLAQFLRKCPLENLDVSDIDL  155

Query  558  GSSGFSKA-QEEIVEDLKIICINISKNR-GGIDTAKFISKLFSYAPELVAINAEFNLMPA  385
            G +G S   +E ++ +  ++ I+ISKNR  G+      S + +    L +INA  NL+ +
Sbjct  156  GPTGCSDVLKETLITNGTLLHIDISKNRICGLGAVMLASIISAGTSRLTSINASANLLSS  215

Query  384  ESLAIIGSGLA-------ANGKLELLDLSGNASCENSADASVLSKYE-INGK-----LVI  244
            ES+  I   +        + G+   LDL  N         S L K   ++G+     +++
Sbjct  216  ESIQHIAKNIQNSKTYVESTGRSISLDLRNNP-------GSFLCKLAGLHGRVGACTVLL  268

Query  243  IDLPSSAPNVPYDDDP  196
             D      +V +DDDP
Sbjct  269  SDSSCETHSVLHDDDP  284



>ref|XP_009405738.1| PREDICTED: protein NLRC3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=523

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -3

Query  735  NCELTGHGVKCLLECLSVLEKPPTSLSIGSNYLGSEIGASIGKFM-SKGILSLDIDDIGL  559
            NC L+  GV  LL  L  L+    S S+  N LGS I A + KF+ S  +  L+I+D+ L
Sbjct  443  NCNLSCTGVAELLRSLPTLKG---SFSVAENNLGSSIAAPLAKFLASSSVRKLNIEDVEL  499

Query  558  GSSGFSKAQEEIVEDLKIICINI  490
            G+ GF + +++I + + +  INI
Sbjct  500  GTLGFQQLEDQIPKKMALQSINI  522



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210