BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019L21

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789545.1|  PREDICTED: crt homolog 3                           216   2e-63   Nicotiana sylvestris
ref|XP_009603800.1|  PREDICTED: crt homolog 3 isoform X1                213   3e-62   Nicotiana tomentosiformis
ref|XP_004252884.1|  PREDICTED: crt homolog 1                           212   6e-62   Solanum lycopersicum
ref|XP_011009129.1|  PREDICTED: uncharacterized protein LOC105114312    209   2e-61   Populus euphratica
gb|KEH28374.1|  CRT (chloroquine-resistance transporter)-like tra...    206   6e-61   Medicago truncatula
ref|XP_006349792.1|  PREDICTED: crt homolog 1-like                      209   7e-61   Solanum tuberosum [potatoes]
ref|XP_011014422.1|  PREDICTED: crt homolog 1                           209   8e-61   Populus euphratica
ref|XP_007146130.1|  hypothetical protein PHAVU_006G014700g             209   8e-61   Phaseolus vulgaris [French bean]
emb|CBI24254.3|  unnamed protein product                                205   3e-60   Vitis vinifera
gb|AET00194.2|  CRT (chloroquine-resistance transporter)-like tra...    207   3e-60   Medicago truncatula
ref|XP_003617235.1|  Crt-like protein                                   207   3e-60   
ref|XP_002276436.2|  PREDICTED: uncharacterized protein LOC100265...    207   4e-60   Vitis vinifera
ref|XP_010651520.1|  PREDICTED: uncharacterized protein LOC100265...    207   6e-60   
ref|XP_004500069.1|  PREDICTED: crt homolog 1-like                      204   3e-59   Cicer arietinum [garbanzo]
ref|XP_003622835.1|  hypothetical protein MTR_7g054190                  204   6e-59   
ref|XP_010673766.1|  PREDICTED: crt homolog 1                           204   8e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004491229.1|  PREDICTED: crt homolog 3-like isoform X1           202   2e-58   Cicer arietinum [garbanzo]
ref|XP_010276678.1|  PREDICTED: crt homolog 1-like                      202   4e-58   Nelumbo nucifera [Indian lotus]
gb|EYU46190.1|  hypothetical protein MIMGU_mgv1a006625mg                201   7e-58   Erythranthe guttata [common monkey flower]
emb|CDP19492.1|  unnamed protein product                                201   1e-57   Coffea canephora [robusta coffee]
ref|XP_008782109.1|  PREDICTED: uncharacterized protein LOC103701724    198   2e-57   
gb|EPS58244.1|  hypothetical protein M569_16572                         189   5e-57   Genlisea aurea
ref|XP_010938545.1|  PREDICTED: crt homolog 1-like                      199   5e-57   Elaeis guineensis
gb|KHN23935.1|  Crt like 1                                              195   1e-56   Glycine soja [wild soybean]
gb|KHN28163.1|  Crt like 1                                              194   2e-56   Glycine soja [wild soybean]
ref|XP_007211784.1|  hypothetical protein PRUPE_ppa009706mg             192   6e-56   
dbj|BAB10035.1|  unnamed protein product                                191   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009603801.1|  PREDICTED: crt homolog 3 isoform X2                195   8e-56   Nicotiana tomentosiformis
dbj|BAK05407.1|  predicted protein                                      193   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003528593.1|  PREDICTED: crt homolog 1-like                      195   1e-55   Glycine max [soybeans]
ref|XP_003556785.1|  PREDICTED: crt homolog 1-like                      195   2e-55   Glycine max [soybeans]
dbj|BAJ91104.1|  predicted protein                                      195   2e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009368723.1|  PREDICTED: crt homolog 2-like isoform X2           192   2e-55   
gb|KFK25491.1|  hypothetical protein AALP_AA8G121700                    194   3e-55   Arabis alpina [alpine rockcress]
gb|AAM60923.1|  unknown                                                 194   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001078575.1|  CRT (chloroquine-resistance transporter)-lik...    194   6e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009368715.1|  PREDICTED: crt homolog 1-like isoform X1           194   6e-55   Pyrus x bretschneideri [bai li]
gb|KDO54774.1|  hypothetical protein CISIN_1g0128212mg                  186   9e-55   Citrus sinensis [apfelsine]
ref|XP_006399733.1|  hypothetical protein EUTSA_v10015653mg             192   2e-54   Eutrema salsugineum [saltwater cress]
ref|XP_009403363.1|  PREDICTED: crt homolog 1-like                      192   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN12034.1|  Crt like 1                                              187   3e-54   Glycine soja [wild soybean]
ref|XP_010519808.1|  PREDICTED: crt homolog 1                           191   5e-54   Tarenaya hassleriana [spider flower]
ref|XP_002871515.1|  hypothetical protein ARALYDRAFT_488059             191   5e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_010453280.1|  PREDICTED: crt homolog 1-like                      191   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003545164.1|  PREDICTED: crt homolog 1-like                      191   7e-54   Glycine max [soybeans]
ref|XP_004140194.1|  PREDICTED: crt homolog 2-like                      191   9e-54   Cucumis sativus [cucumbers]
ref|XP_008449652.1|  PREDICTED: crt homolog 3                           191   9e-54   Cucumis melo [Oriental melon]
ref|XP_011080445.1|  PREDICTED: crt homolog 1                           188   2e-53   
ref|XP_006470531.1|  PREDICTED: crt homolog 1-like                      190   2e-53   Citrus sinensis [apfelsine]
ref|XP_006446307.1|  hypothetical protein CICLE_v10017793mg             189   3e-53   Citrus clementina [clementine]
ref|XP_010491972.1|  PREDICTED: crt homolog 1-like                      189   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_002313263.2|  hypothetical protein POPTR_0009s07350g             189   6e-53   
ref|XP_008227269.1|  PREDICTED: crt homolog 1                           188   7e-53   Prunus mume [ume]
ref|XP_010419799.1|  PREDICTED: crt homolog 1-like                      188   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006287749.1|  hypothetical protein CARUB_v10000960mg             186   3e-52   Capsella rubella
gb|KJB35699.1|  hypothetical protein B456_006G124500                    186   3e-52   Gossypium raimondii
gb|KHG29231.1|  Crt                                                     187   6e-52   Gossypium arboreum [tree cotton]
ref|XP_010091885.1|  Exocyst complex component 5                        183   2e-51   
gb|KJB83544.1|  hypothetical protein B456_013G253300                    184   4e-51   Gossypium raimondii
gb|KHG16222.1|  Crt                                                     183   6e-51   Gossypium arboreum [tree cotton]
ref|XP_002456955.1|  hypothetical protein SORBIDRAFT_03g046260          179   2e-49   Sorghum bicolor [broomcorn]
gb|AFW83925.1|  hypothetical protein ZEAMMB73_730584                    179   3e-49   
gb|EMS46347.1|  hypothetical protein TRIUR3_26464                       175   7e-49   Triticum urartu
ref|XP_008656855.1|  PREDICTED: crt homolog 1-like isoform X1           179   9e-49   Zea mays [maize]
ref|XP_006856983.1|  hypothetical protein AMTR_s00190p00035510          177   1e-48   Amborella trichopoda
ref|XP_010492995.1|  PREDICTED: crt homolog 1-like                      176   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010031716.1|  PREDICTED: crt homolog 1                           176   4e-48   Eucalyptus grandis [rose gum]
ref|XP_003567491.1|  PREDICTED: crt homolog 1-like                      175   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_010420740.1|  PREDICTED: crt homolog 1-like                      174   1e-47   Camelina sativa [gold-of-pleasure]
ref|NP_001140411.1|  hypothetical protein                               174   1e-47   Zea mays [maize]
ref|XP_002873945.1|  predicted protein                                  174   2e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_006400494.1|  hypothetical protein EUTSA_v10015536mg             174   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010454210.1|  PREDICTED: crt homolog 1-like                      174   2e-47   Camelina sativa [gold-of-pleasure]
emb|CDY44914.1|  BnaA02g04190D                                          173   4e-47   Brassica napus [oilseed rape]
ref|XP_006287751.1|  hypothetical protein CARUB_v10000962mg             172   4e-47   Capsella rubella
gb|AAM62809.1|  unknown                                                 172   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568373.1|  CRT (chloroquine-resistance transporter)-like t...    172   6e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126357.1|  PREDICTED: crt homolog 1                           172   6e-47   Brassica rapa
ref|XP_007141505.1|  hypothetical protein PHAVU_008G201700g             172   7e-47   Phaseolus vulgaris [French bean]
ref|XP_006646693.1|  PREDICTED: crt homolog 1-like                      170   9e-47   Oryza brachyantha
ref|NP_001154721.1|  CRT (chloroquine-resistance transporter)-lik...    173   1e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDY62039.1|  BnaCnng39070D                                          171   2e-46   Brassica napus [oilseed rape]
emb|CDX91169.1|  BnaC02g04280D                                          171   3e-46   
gb|KFK26200.1|  hypothetical protein AALP_AA8G215600                    171   3e-46   Arabis alpina [alpine rockcress]
emb|CDX85698.1|  BnaA02g01150D                                          171   3e-46   
ref|XP_009125851.1|  PREDICTED: LOW QUALITY PROTEIN: crt homolog 1      171   3e-46   Brassica rapa
emb|CDY02751.1|  BnaC02g11380D                                          170   1e-45   
ref|XP_007015262.1|  CRT-like transporter 3 isoform 1                   169   1e-45   
gb|KDP43205.1|  hypothetical protein JCGZ_22757                         167   1e-44   Jatropha curcas
gb|KJB35701.1|  hypothetical protein B456_006G124500                    159   3e-42   Gossypium raimondii
gb|KJB83545.1|  hypothetical protein B456_013G253300                    157   3e-41   Gossypium raimondii
gb|EEE56025.1|  hypothetical protein OsJ_04807                          155   4e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004971309.1|  PREDICTED: crt homolog 1-like                      157   4e-41   Setaria italica
gb|EMT33351.1|  hypothetical protein F775_26728                         154   1e-40   
ref|XP_010099798.1|  hypothetical protein L484_004373                   147   1e-38   
dbj|BAD88271.1|  hypothetical protein                                   148   1e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EAY77278.1|  hypothetical protein OsI_05253                          146   4e-37   Oryza sativa Indica Group [Indian rice]
gb|ABK23422.1|  unknown                                                 144   3e-36   Picea sitchensis
ref|XP_006283786.1|  hypothetical protein CARUB_v10004876mg             137   4e-34   Capsella rubella
ref|XP_009414763.1|  PREDICTED: crt homolog 3                           136   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN08975.1|  Crt like 1                                              134   3e-33   Glycine soja [wild soybean]
ref|NP_001242115.1|  uncharacterized protein LOC100787260               134   3e-33   Glycine max [soybeans]
ref|XP_007136303.1|  hypothetical protein PHAVU_009G035000g             134   4e-33   Phaseolus vulgaris [French bean]
ref|XP_002869717.1|  hypothetical protein ARALYDRAFT_492400             134   5e-33   
ref|XP_001754536.1|  predicted protein                                  132   6e-33   
ref|XP_008775799.1|  PREDICTED: crt homolog 3-like                      134   6e-33   Phoenix dactylifera
ref|XP_003602864.1|  hypothetical protein MTR_3g099780                  129   9e-33   
ref|XP_004288863.2|  PREDICTED: crt homolog 1-like                      134   1e-32   Fragaria vesca subsp. vesca
ref|XP_010943152.1|  PREDICTED: crt homolog 3                           133   1e-32   Elaeis guineensis
ref|XP_010061564.1|  PREDICTED: crt homolog 1                           132   3e-32   Eucalyptus grandis [rose gum]
ref|NP_194177.2|  CRT (chloroquine-resistance transporter)-like t...    132   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002527366.1|  conserved hypothetical protein                     130   9e-32   Ricinus communis
ref|XP_003522773.1|  PREDICTED: crt homolog 1-like isoform X1           130   1e-31   Glycine max [soybeans]
ref|XP_008647667.1|  PREDICTED: uncharacterized protein LOC100277...    129   1e-31   Zea mays [maize]
ref|XP_008365244.1|  PREDICTED: uncharacterized protein LOC103428888    130   1e-31   
emb|CDY61009.1|  BnaA01g35140D                                          130   2e-31   Brassica napus [oilseed rape]
ref|NP_001144179.1|  uncharacterized protein LOC100277036               129   2e-31   Zea mays [maize]
ref|XP_008219232.1|  PREDICTED: crt homolog 1                           130   3e-31   Prunus mume [ume]
ref|XP_002986821.1|  hypothetical protein SELMODRAFT_182638             129   4e-31   Selaginella moellendorffii
gb|AES73115.2|  CRT (chloroquine-resistance transporter)-like tra...    129   5e-31   Medicago truncatula
emb|CDP00923.1|  unnamed protein product                                129   6e-31   Coffea canephora [robusta coffee]
emb|CDY56575.1|  BnaC01g41530D                                          128   7e-31   Brassica napus [oilseed rape]
gb|EYU36442.1|  hypothetical protein MIMGU_mgv1a010446mg                126   8e-31   Erythranthe guttata [common monkey flower]
ref|XP_007018275.1|  CRT-like transporter 2                             128   1e-30   Theobroma cacao [chocolate]
gb|KDP41501.1|  hypothetical protein JCGZ_15908                         128   1e-30   Jatropha curcas
ref|XP_007222981.1|  hypothetical protein PRUPE_ppa008968mg             126   1e-30   
gb|KJB58831.1|  hypothetical protein B456_009G228500                    128   1e-30   Gossypium raimondii
ref|XP_001763845.1|  predicted protein                                  126   1e-30   
gb|KJB58832.1|  hypothetical protein B456_009G228500                    127   1e-30   Gossypium raimondii
ref|XP_009138072.1|  PREDICTED: crt homolog 1                           127   2e-30   Brassica rapa
ref|XP_002969295.1|  hypothetical protein SELMODRAFT_170659             126   2e-30   
ref|XP_011074278.1|  PREDICTED: crt homolog 1-like                      127   2e-30   Sesamum indicum [beniseed]
gb|KHG30118.1|  Crt                                                     126   4e-30   Gossypium arboreum [tree cotton]
ref|XP_010448563.1|  PREDICTED: crt homolog 2                           126   4e-30   Camelina sativa [gold-of-pleasure]
gb|EYU36446.1|  hypothetical protein MIMGU_mgv1a023373mg                126   4e-30   Erythranthe guttata [common monkey flower]
ref|XP_006413428.1|  hypothetical protein EUTSA_v10025263mg             125   9e-30   Eutrema salsugineum [saltwater cress]
ref|XP_004238016.1|  PREDICTED: crt homolog 1 isoform X1                124   1e-29   Solanum lycopersicum
ref|XP_010320227.1|  PREDICTED: crt homolog 1 isoform X2                124   2e-29   Solanum lycopersicum
ref|XP_008347822.1|  PREDICTED: uncharacterized protein LOC103410954    125   2e-29   
ref|XP_006651138.1|  PREDICTED: crt homolog 1-like                      124   3e-29   Oryza brachyantha
ref|XP_010439030.1|  PREDICTED: LOW QUALITY PROTEIN: crt homolog ...    123   4e-29   
gb|EYU36445.1|  hypothetical protein MIMGU_mgv1a020365mg                123   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_009795852.1|  PREDICTED: crt homolog 1 isoform X1                122   2e-28   Nicotiana sylvestris
ref|XP_009605243.1|  PREDICTED: crt homolog 1-like                      122   2e-28   Nicotiana tomentosiformis
ref|XP_006338029.1|  PREDICTED: crt homolog 3-like isoform X1           121   2e-28   Solanum tuberosum [potatoes]
ref|XP_010671420.1|  PREDICTED: crt homolog 2                           121   2e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004501667.1|  PREDICTED: crt homolog 2-like isoform X1           121   3e-28   Cicer arietinum [garbanzo]
ref|XP_004501668.1|  PREDICTED: crt homolog 2-like isoform X2           120   3e-28   Cicer arietinum [garbanzo]
ref|XP_011458905.1|  PREDICTED: LOW QUALITY PROTEIN: crt homolog ...    120   7e-28   Fragaria vesca subsp. vesca
ref|NP_001049282.1|  Os03g0199000                                       114   2e-27   
gb|KFK29005.1|  hypothetical protein AALP_AA7G076900                    117   4e-27   Arabis alpina [alpine rockcress]
ref|XP_004962898.1|  PREDICTED: crt homolog 1-like                      117   4e-27   Setaria italica
ref|XP_006852886.1|  hypothetical protein AMTR_s00033p00216940          117   7e-27   Amborella trichopoda
ref|XP_002468330.1|  hypothetical protein SORBIDRAFT_01g043890          116   2e-26   
ref|XP_008444904.1|  PREDICTED: uncharacterized protein LOC103488...    114   2e-26   
gb|AFW89349.1|  hypothetical protein ZEAMMB73_630257                    115   3e-26   
ref|XP_010254583.1|  PREDICTED: crt homolog 2                           115   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_006664586.1|  PREDICTED: crt homolog 1-like                      114   4e-26   Oryza brachyantha
ref|NP_001144440.1|  uncharacterized protein LOC100277401               115   4e-26   Zea mays [maize]
ref|XP_008444902.1|  PREDICTED: crt homolog 1 isoform X1                115   5e-26   Cucumis melo [Oriental melon]
gb|EEC74695.1|  hypothetical protein OsI_10400                          114   7e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_011074279.1|  PREDICTED: uncharacterized protein LOC105159044    114   1e-25   Sesamum indicum [beniseed]
ref|XP_004985325.1|  PREDICTED: crt homolog 1-like isoform X2           112   2e-25   
ref|XP_004985324.1|  PREDICTED: crt homolog 1-like isoform X1           112   2e-25   Setaria italica
ref|NP_001066868.1|  Os12g0511300                                       111   4e-25   
gb|EEC69365.1|  hypothetical protein OsI_38489                          111   5e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_004152605.1|  PREDICTED: crt homolog 1-like                      112   5e-25   Cucumis sativus [cucumbers]
dbj|BAJ93958.1|  predicted protein                                      106   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003576016.1|  PREDICTED: crt homolog 1-like                      109   3e-24   Brachypodium distachyon [annual false brome]
ref|XP_010542173.1|  PREDICTED: crt homolog 1                           107   1e-23   Tarenaya hassleriana [spider flower]
gb|EMS60940.1|  Crt-like protein 1                                      106   2e-23   Triticum urartu
ref|XP_003561943.1|  PREDICTED: crt homolog 3-like                      106   4e-23   Brachypodium distachyon [annual false brome]
ref|XP_010099562.1|  hypothetical protein L484_011568                   105   6e-23   
gb|EMT28281.1|  hypothetical protein F775_30487                         105   7e-23   
gb|EMS45976.1|  Crt-like protein 1                                      103   2e-22   Triticum urartu
gb|KDO81242.1|  hypothetical protein CISIN_1g014092mg                   103   3e-22   Citrus sinensis [apfelsine]
gb|EMT20926.1|  hypothetical protein F775_01320                         103   3e-22   
ref|XP_006433790.1|  hypothetical protein CICLE_v10000856mg             104   5e-22   
ref|XP_006472425.1|  PREDICTED: crt homolog 1-like isoform X2           103   5e-22   Citrus sinensis [apfelsine]
ref|XP_006472424.1|  PREDICTED: crt homolog 1-like isoform X1           103   5e-22   Citrus sinensis [apfelsine]
ref|XP_006472426.1|  PREDICTED: crt homolog 1-like isoform X3           100   3e-21   
ref|XP_002283727.1|  PREDICTED: crt homolog 1                           101   3e-21   Vitis vinifera
emb|CAN72155.1|  hypothetical protein VITISV_019018                     100   6e-21   Vitis vinifera
emb|CAB45081.1|  hypothetical protein                                 95.5    3e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KHN08288.1|  Crt like 3                                            91.3    4e-18   Glycine soja [wild soybean]
ref|XP_010320228.1|  PREDICTED: crt homolog 3 isoform X3              88.2    5e-18   Solanum lycopersicum
ref|XP_002526058.1|  conserved hypothetical protein                   76.3    2e-14   
gb|KJB35700.1|  hypothetical protein B456_006G124500                  67.0    1e-13   Gossypium raimondii
gb|KEH17262.1|  CRT (chloroquine-resistance transporter)-like tra...  67.4    2e-13   Medicago truncatula
gb|KJB83546.1|  hypothetical protein B456_013G253300                  67.4    2e-13   Gossypium raimondii
ref|XP_002526057.1|  conserved hypothetical protein                   65.1    5e-13   
ref|XP_005650231.1|  hypothetical protein COCSUDRAFT_64779            75.9    9e-13   Coccomyxa subellipsoidea C-169
ref|XP_002526059.1|  hypothetical protein RCOM_1478870                69.7    2e-12   
gb|KDO54776.1|  hypothetical protein CISIN_1g0128212mg                67.4    4e-12   Citrus sinensis [apfelsine]
gb|KCW68526.1|  hypothetical protein EUGRSUZ_F02159                   66.2    1e-11   Eucalyptus grandis [rose gum]
ref|XP_002955483.1|  hypothetical protein VOLCADRAFT_96374            58.5    2e-08   Volvox carteri f. nagariensis
gb|AEW09112.1|  hypothetical protein CL4012Contig1_03                 52.4    5e-06   Pinus radiata
gb|AFG66928.1|  hypothetical protein CL4012Contig1_03                 52.0    8e-06   Pinus taeda
gb|AFG66930.1|  hypothetical protein CL4012Contig1_03                 52.0    8e-06   Pinus taeda
ref|XP_011396396.1|  hypothetical protein F751_4405                   55.5    8e-06   Auxenochlorella protothecoides
ref|XP_008647668.1|  PREDICTED: uncharacterized protein LOC100277...  46.2    1e-05   Zea mays [maize]
gb|KCW68528.1|  hypothetical protein EUGRSUZ_F02159                   44.7    3e-05   Eucalyptus grandis [rose gum]
ref|XP_004341623.1|  transmembrane protein                            54.7    3e-05   Acanthamoeba castellanii str. Neff
gb|KIZ05413.1|  hypothetical protein MNEG_2548                        53.9    3e-05   Monoraphidium neglectum
ref|XP_001689582.1|  predicted protein                                51.6    5e-05   Chlamydomonas reinhardtii
ref|XP_009824222.1|  hypothetical protein H257_02337                  53.1    7e-05   Aphanomyces astaci
ref|XP_004338113.1|  transmembrane protein                            52.0    2e-04   Acanthamoeba castellanii str. Neff
ref|XP_005537125.1|  hypothetical protein, conserved                  50.4    7e-04   Cyanidioschyzon merolae strain 10D



>ref|XP_009789545.1| PREDICTED: crt homolog 3 [Nicotiana sylvestris]
Length=442

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQG-CDGAPLLPLLFVIVNM  504
            Y  VFI LLLPFLSKLWG+PF QLP Y++DGAACFLN+GT+ G CDGAPLLPLLF+IVNM
Sbjct  301  YQAVFICLLLPFLSKLWGVPFTQLPNYLRDGAACFLNIGTLSGGCDGAPLLPLLFIIVNM  360

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            GFNISLLHLL+ISSAVVSCLAST SVPISVF+FTLPLPYLGVASSLPPGFI GA ILVLG
Sbjct  361  GFNISLLHLLQISSAVVSCLASTVSVPISVFLFTLPLPYLGVASSLPPGFIAGAIILVLG  420

Query  323  MLIYAWTPSLHMAKAST*FC  264
            MLIY W PS  +       C
Sbjct  421  MLIYTWRPSSRLNNQEIDNC  440



>ref|XP_009603800.1| PREDICTED: crt homolog 3 isoform X1 [Nicotiana tomentosiformis]
Length=441

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQG-CDGAPLLPLLFVIVNM  504
            Y  VFI LLLPFLSKLWG+PF QLP Y++DGAACFLN+GT+ G CDGAPLLPLLF+IVNM
Sbjct  300  YQAVFICLLLPFLSKLWGVPFTQLPNYLRDGAACFLNIGTLSGGCDGAPLLPLLFIIVNM  359

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            GFNISLLHLL+ISSAVVSCLAST SVPISVF+FTLPLPYLGVASSLPPGF+ GA ILVLG
Sbjct  360  GFNISLLHLLQISSAVVSCLASTVSVPISVFLFTLPLPYLGVASSLPPGFVAGAIILVLG  419

Query  323  MLIYAWTP  300
            MLIY W P
Sbjct  420  MLIYTWRP  427



>ref|XP_004252884.1| PREDICTED: crt homolog 1 [Solanum lycopersicum]
Length=455

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 121/148 (82%), Gaps = 8/148 (5%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQG-CDGAPLLPLLFVIVNM  504
            Y  VFI LLLPFLSKLWG+PF QLP Y++DGAACFLN+GT+ G C GAPLLPLLF+IVNM
Sbjct  315  YQAVFICLLLPFLSKLWGVPFTQLPNYLRDGAACFLNIGTLSGGCAGAPLLPLLFIIVNM  374

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            G+NISLLHLLKISSAV+SCLAST SVPISVF+FTLPLPYLGVASSLPPGFI GA ILV+G
Sbjct  375  GYNISLLHLLKISSAVLSCLASTVSVPISVFLFTLPLPYLGVASSLPPGFISGAIILVIG  434

Query  323  MLIYAWTPSLHMAKAST*FCSAHHQCVC  240
            ML+Y W PS H+        S    C C
Sbjct  435  MLVYTWRPSSHLK-------SQEVDCHC  455



>ref|XP_011009129.1| PREDICTED: uncharacterized protein LOC105114312 [Populus euphratica]
Length=384

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ LLLPF+SKLWGIPF QLP Y+KDGA CFLN+G++  GCDGAPLLPLLFVIVNMGFN
Sbjct  258  LFVCLLLPFMSKLWGIPFSQLPNYLKDGAVCFLNIGSLSSGCDGAPLLPLLFVIVNMGFN  317

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTFSVPI+V++FTLPLPYLGVASSLP GF+ GA +LVLG+LI
Sbjct  318  ISLLHLLKISSAVVSCLASTFSVPIAVYVFTLPLPYLGVASSLPTGFVAGAIVLVLGLLI  377

Query  314  YAWTPS  297
            YAWTPS
Sbjct  378  YAWTPS  383



>gb|KEH28374.1| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=324

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 1/133 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWG+PF QLP Y+KDGAACFLN+GT+  GCDGAPLLPLLF+IVN+GFN
Sbjct  186  LFICLLLPFLSKLWGVPFSQLPNYLKDGAACFLNVGTLSSGCDGAPLLPLLFIIVNIGFN  245

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            I+LLHLLKISSAVVSCLASTFSVPIS+++FTL LPYLGVASSLP GF+ GA +L++G+LI
Sbjct  246  IALLHLLKISSAVVSCLASTFSVPISIYVFTLQLPYLGVASSLPTGFVAGAIVLIIGLLI  305

Query  314  YAWTPSLHMAKAS  276
            YAWTPS   + AS
Sbjct  306  YAWTPSNGSSGAS  318



>ref|XP_006349792.1| PREDICTED: crt homolog 1-like [Solanum tuberosum]
Length=455

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 121/149 (81%), Gaps = 10/149 (7%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  VFI LLLPFLSKLWG+PF QLP Y++DGAACFLN+GT+  GC GAPLLPLLF+IVNM
Sbjct  315  YQAVFICLLLPFLSKLWGVPFTQLPNYLRDGAACFLNIGTLSSGCAGAPLLPLLFIIVNM  374

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            G+NISLLHLLKISSAV+SCLAST SVPISVF+FTLPLPYLGVASSLPPGFI GA ILV+G
Sbjct  375  GYNISLLHLLKISSAVLSCLASTVSVPISVFLFTLPLPYLGVASSLPPGFISGAIILVIG  434

Query  323  MLIYAWTPSLHMAKAST*FCSAHHQCVCH  237
            ML+Y W PS  +          + +  CH
Sbjct  435  MLVYTWRPSSRL---------NNQEVDCH  454



>ref|XP_011014422.1| PREDICTED: crt homolog 1 [Populus euphratica]
Length=451

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ LLLPF+SKLWGIPF QLP Y+KDGA CFLN+G++  GCDGAPLLPLLFVIVNMGFN
Sbjct  325  LFVCLLLPFMSKLWGIPFSQLPNYLKDGAVCFLNIGSLSSGCDGAPLLPLLFVIVNMGFN  384

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTFSVPI+V++FTLPLPYLGVASSLP GF+ GA +LVLG+LI
Sbjct  385  ISLLHLLKISSAVVSCLASTFSVPIAVYVFTLPLPYLGVASSLPTGFVAGAIVLVLGLLI  444

Query  314  YAWTPS  297
            YAWTPS
Sbjct  445  YAWTPS  450



>ref|XP_007146130.1| hypothetical protein PHAVU_006G014700g [Phaseolus vulgaris]
 gb|ESW18124.1| hypothetical protein PHAVU_006G014700g [Phaseolus vulgaris]
Length=436

 Score =   209 bits (531),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+GT+ +GCDGAPLLPLLF++VNMGFN
Sbjct  299  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNVGTLSRGCDGAPLLPLLFIVVNMGFN  358

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHL+KISSAVVSCLASTFSVPI++++FTLPLPYLGV SSLP GF+ GA+IL++G+LI
Sbjct  359  ISLLHLIKISSAVVSCLASTFSVPIAIYVFTLPLPYLGVGSSLPAGFVAGASILIMGLLI  418

Query  314  YAWTP  300
            Y+WTP
Sbjct  419  YSWTP  423



>emb|CBI24254.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 122/135 (90%), Gaps = 2/135 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWG+PF  LP Y+KDGAACFLN+G++  GCDGAPLLPLLFV+VNMGFN
Sbjct  206  LFICLLLPFLSKLWGVPFSHLPNYLKDGAACFLNIGSLSSGCDGAPLLPLLFVVVNMGFN  265

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTFSVPI+V++FTLPLPYLGVASSLPP F+ GA IL++G++I
Sbjct  266  ISLLHLLKISSAVVSCLASTFSVPIAVYMFTLPLPYLGVASSLPPAFVTGAIILLVGLMI  325

Query  314  YAWT-PSLHMAKAST  273
            YAWT PS+ +  +S+
Sbjct  326  YAWTPPSMDLNSSSS  340



>gb|AET00194.2| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=437

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNI  492
            FI LLLPFLSKLWG+PF QLP Y+KDGAACFLN+GT+  GCDGAPLLPLLF+IVN+GFNI
Sbjct  300  FICLLLPFLSKLWGVPFSQLPNYLKDGAACFLNVGTLSSGCDGAPLLPLLFIIVNIGFNI  359

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            +LLHLLKISSAVVSCLASTFSVPIS+++FTL LPYLGVASSLP GF+ GA +L++G+LIY
Sbjct  360  ALLHLLKISSAVVSCLASTFSVPISIYVFTLQLPYLGVASSLPTGFVAGAIVLIIGLLIY  419

Query  311  AWTPSLHMAKAS  276
            AWTPS   + AS
Sbjct  420  AWTPSNGSSGAS  431



>ref|XP_003617235.1| Crt-like protein [Medicago truncatula]
Length=432

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNI  492
            FI LLLPFLSKLWG+PF QLP Y+KDGAACFLN+GT+  GCDGAPLLPLLF+IVN+GFNI
Sbjct  295  FICLLLPFLSKLWGVPFSQLPNYLKDGAACFLNVGTLSSGCDGAPLLPLLFIIVNIGFNI  354

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            +LLHLLKISSAVVSCLASTFSVPIS+++FTL LPYLGVASSLP GF+ GA +L++G+LIY
Sbjct  355  ALLHLLKISSAVVSCLASTFSVPISIYVFTLQLPYLGVASSLPTGFVAGAIVLIIGLLIY  414

Query  311  AWTPSLHMAKAS  276
            AWTPS   + AS
Sbjct  415  AWTPSNGSSGAS  426



>ref|XP_002276436.2| PREDICTED: uncharacterized protein LOC100265335 isoform X2 [Vitis 
vinifera]
Length=453

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 121/134 (90%), Gaps = 2/134 (1%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNI  492
            FI LLLPFLSKLWG+PF  LP Y+KDGAACFLN+G++  GCDGAPLLPLLFV+VNMGFNI
Sbjct  316  FICLLLPFLSKLWGVPFSHLPNYLKDGAACFLNIGSLSSGCDGAPLLPLLFVVVNMGFNI  375

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SLLHLLKISSAVVSCLASTFSVPI+V++FTLPLPYLGVASSLPP F+ GA IL++G++IY
Sbjct  376  SLLHLLKISSAVVSCLASTFSVPIAVYMFTLPLPYLGVASSLPPAFVTGAIILLVGLMIY  435

Query  311  AWT-PSLHMAKAST  273
            AWT PS+ +  +S+
Sbjct  436  AWTPPSMDLNSSSS  449



>ref|XP_010651520.1| PREDICTED: uncharacterized protein LOC100265335 isoform X1 [Vitis 
vinifera]
Length=455

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 121/136 (89%), Gaps = 4/136 (3%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ---GCDGAPLLPLLFVIVNMGF  498
            FI LLLPFLSKLWG+PF  LP Y+KDGAACFLN+G++    GCDGAPLLPLLFV+VNMGF
Sbjct  316  FICLLLPFLSKLWGVPFSHLPNYLKDGAACFLNIGSLSSAAGCDGAPLLPLLFVVVNMGF  375

Query  497  NISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGML  318
            NISLLHLLKISSAVVSCLASTFSVPI+V++FTLPLPYLGVASSLPP F+ GA IL++G++
Sbjct  376  NISLLHLLKISSAVVSCLASTFSVPIAVYMFTLPLPYLGVASSLPPAFVTGAIILLVGLM  435

Query  317  IYAWT-PSLHMAKAST  273
            IYAWT PS+ +  +S+
Sbjct  436  IYAWTPPSMDLNSSSS  451



>ref|XP_004500069.1| PREDICTED: crt homolog 1-like [Cicer arietinum]
Length=432

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 116/126 (92%), Gaps = 1/126 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+G +  GCDGAPLLP+LF+IVNMGFN
Sbjct  299  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNVGKLSSGCDGAPLLPVLFIIVNMGFN  358

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLL+LLKISSAVVSCLA+TFSVPI++++FTLPLPYLGVASSLP GF+ GA IL++G+LI
Sbjct  359  ISLLYLLKISSAVVSCLATTFSVPIAIYVFTLPLPYLGVASSLPTGFLAGAVILIMGLLI  418

Query  314  YAWTPS  297
            Y WTPS
Sbjct  419  YTWTPS  424



>ref|XP_003622835.1| hypothetical protein MTR_7g054190 [Medicago truncatula]
 gb|KEH17261.1| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=432

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+G +  GCDGAPLLPLLF+IVNMGFN
Sbjct  295  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNIGKLSSGCDGAPLLPLLFIIVNMGFN  354

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLA+T +VPIS+++FTLPLPYLGVASSLP GF+ GA IL++G+LI
Sbjct  355  ISLLHLLKISSAVVSCLATTVAVPISIYMFTLPLPYLGVASSLPTGFLAGAIILIMGLLI  414

Query  314  YAWTP  300
            Y WTP
Sbjct  415  YTWTP  419



>ref|XP_010673766.1| PREDICTED: crt homolog 1 [Beta vulgaris subsp. vulgaris]
Length=437

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +FI LLLPFLSKLWGIPF Q+P+Y KDGAACFLN+ T+  GC+GAPLLP+LF++VNM
Sbjct  300  YQAIFICLLLPFLSKLWGIPFTQMPSYFKDGAACFLNMNTLSTGCNGAPLLPVLFIVVNM  359

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            GFNISLLHLLKISSAVVSCLAST SVP+SVF+FTLPLPYLG  ++LPPGF+ GA +LVLG
Sbjct  360  GFNISLLHLLKISSAVVSCLASTVSVPLSVFVFTLPLPYLGAGTALPPGFVAGAVVLVLG  419

Query  323  MLIYAWTPSLHMAKAST  273
            +  Y+W P++  A A+T
Sbjct  420  LFFYSWKPAMVPASATT  436



>ref|XP_004491229.1| PREDICTED: crt homolog 3-like isoform X1 [Cicer arietinum]
Length=433

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWG+PF QLP Y+KDGAACFLN+GT+  GCDGAP+LPLLF+IVN+GFN
Sbjct  299  LFICLLLPFLSKLWGVPFSQLPKYLKDGAACFLNVGTLSSGCDGAPMLPLLFIIVNIGFN  358

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ++LLHLLKISSAVVSCLASTFSVPISV++FTLPLPYLGVASSLP GF+ GA IL+ G LI
Sbjct  359  VALLHLLKISSAVVSCLASTFSVPISVYVFTLPLPYLGVASSLPTGFVAGAIILITGSLI  418

Query  314  YAWTP  300
            Y WTP
Sbjct  419  YGWTP  423



>ref|XP_010276678.1| PREDICTED: crt homolog 1-like [Nelumbo nucifera]
Length=470

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 4/142 (3%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNI  492
            FI LLLPFLSK WG+PF QLP+Y+KDGAACFLN+G++  GCDGAPLLP+LFVIVNM FNI
Sbjct  330  FICLLLPFLSKFWGVPFPQLPSYLKDGAACFLNIGSLSSGCDGAPLLPILFVIVNMSFNI  389

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            +LLHLLKISSAVVSCLA TFSVP+SV++FTLPLPY+GVAS+LP GF++G AILV+GMLIY
Sbjct  390  ALLHLLKISSAVVSCLAYTFSVPLSVYVFTLPLPYIGVASTLPQGFVLGVAILVVGMLIY  449

Query  311  AWTPSLHMAKAST*FCSAH-HQ  249
            +W+PSL     +T   +AH HQ
Sbjct  450  SWSPSLGPTPRTT--TTAHPHQ  469



>gb|EYU46190.1| hypothetical protein MIMGU_mgv1a006625mg [Erythranthe guttata]
Length=437

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQG-CDGAPLLPLLFVIVNM  504
            Y  VFI LLLPFLS LWGIPF QLP Y+KDGAACFLN+GT+   C+GAPLLPLLFVIVNM
Sbjct  298  YQAVFICLLLPFLSNLWGIPFSQLPNYLKDGAACFLNVGTMSNRCNGAPLLPLLFVIVNM  357

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            GFNISLLHLLKISSAVVSCLAST SVPISV++FTLPLPYLG+ASSLPPGF+ G  IL++G
Sbjct  358  GFNISLLHLLKISSAVVSCLASTLSVPISVYMFTLPLPYLGIASSLPPGFVGGGIILIVG  417

Query  323  MLIYAWT  303
            MLIY WT
Sbjct  418  MLIYIWT  424



>emb|CDP19492.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFN  495
            VFI LLLPFLSKLWGIPF QLP YVKDGAACFLN+GT + GCDGAPLLPLLFVIVNMG+N
Sbjct  314  VFICLLLPFLSKLWGIPFDQLPLYVKDGAACFLNIGTGLGGCDGAPLLPLLFVIVNMGYN  373

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            +SLLHLLKISSAVVSCLAST SVPISVF+FTLPLPYL  A+SLPPGFI GA  LV GM I
Sbjct  374  VSLLHLLKISSAVVSCLASTVSVPISVFLFTLPLPYLDAAASLPPGFIAGAITLVAGMFI  433

Query  314  YAWTPSLHMAK  282
            Y   PS+   K
Sbjct  434  YCCKPSIRPTK  444



>ref|XP_008782109.1| PREDICTED: uncharacterized protein LOC103701724 [Phoenix dactylifera]
Length=372

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWG+PF QLPTY++DGAACFLN+G++  GC+GAP+LPLLFVIVNM FN
Sbjct  230  LFICLLLPFLSKLWGVPFNQLPTYIRDGAACFLNIGSLSSGCEGAPVLPLLFVIVNMAFN  289

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTFSVP+S++ FTLPLPY+GVASSLP GF+ GA +LV G+L+
Sbjct  290  ISLLHLLKISSAVVSCLASTFSVPLSIYAFTLPLPYIGVASSLPAGFVAGAVVLVAGLLL  349

Query  314  YAWTP  300
            Y+WTP
Sbjct  350  YSWTP  354



>gb|EPS58244.1| hypothetical protein M569_16572, partial [Genlisea aurea]
Length=127

 Score =   189 bits (481),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFN  495
            +FI LL+PFLS LWGIPF QLP Y++DGAACFLN+G + + CDGAPLLP++FV+VNMG+N
Sbjct  3    IFICLLIPFLSNLWGIPFRQLPDYIRDGAACFLNVGAMSKRCDGAPLLPVMFVVVNMGYN  62

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHL+KISSAVVSCLAST SVP++V++FTLPLPYLGV+SSLP GF+ GAA+L +G+L+
Sbjct  63   ISLLHLIKISSAVVSCLASTISVPVAVYLFTLPLPYLGVSSSLPRGFVAGAAVLAVGILV  122

Query  314  YAWTP  300
            Y W P
Sbjct  123  YVWKP  127



>ref|XP_010938545.1| PREDICTED: crt homolog 1-like [Elaeis guineensis]
Length=449

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWG+PF QLPTY+KDGAACFLN+G++  GC+GAP+LPLLFVIVNM FN
Sbjct  307  LFICLLLPFLSKLWGVPFNQLPTYIKDGAACFLNIGSLSSGCEGAPVLPLLFVIVNMAFN  366

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTFSVP+S++ FTLPLPY+GVASSLP GF+ GA +LV G+L+
Sbjct  367  ISLLHLLKISSAVVSCLASTFSVPLSIYAFTLPLPYIGVASSLPAGFVTGAVVLVAGLLL  426

Query  314  YAWTP  300
            Y+WTP
Sbjct  427  YSWTP  431



>gb|KHN23935.1| Crt like 1 [Glycine soja]
Length=337

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 122/133 (92%), Gaps = 1/133 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWG+PF QLP Y+KDGAACFLN+GT+ +GCDGAPLLPLLF+IVNMGFN
Sbjct  203  LFICLLLPFLSKLWGVPFGQLPNYLKDGAACFLNVGTLSRGCDGAPLLPLLFIIVNMGFN  262

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTFSVPI++++FTLPLPY+GVASSLP GF+ GA IL++G+LI
Sbjct  263  ISLLHLLKISSAVVSCLASTFSVPIAIYVFTLPLPYIGVASSLPAGFVAGAIILIIGLLI  322

Query  314  YAWTPSLHMAKAS  276
            YAWTPS   + AS
Sbjct  323  YAWTPSNSSSTAS  335



>gb|KHN28163.1| Crt like 1 [Glycine soja]
Length=337

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 1/133 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+GT+ + CDGAPLLPLLFVIVNMGFN
Sbjct  203  LFICLLLPFLSKLWGIPFGQLPNYLKDGAACFLNVGTLSRACDGAPLLPLLFVIVNMGFN  262

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTFSVPI++++FTLPLPYLGVASSLP GF+ GA IL++G+LI
Sbjct  263  ISLLHLLKISSAVVSCLASTFSVPIAIYVFTLPLPYLGVASSLPTGFVAGAIILIIGLLI  322

Query  314  YAWTPSLHMAKAS  276
            YAWTPS   + AS
Sbjct  323  YAWTPSNGSSTAS  335



>ref|XP_007211784.1| hypothetical protein PRUPE_ppa009706mg [Prunus persica]
 gb|EMJ12983.1| hypothetical protein PRUPE_ppa009706mg [Prunus persica]
Length=281

 Score =   192 bits (487),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 120/133 (90%), Gaps = 1/133 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP Y+K+GAACFLN+GT+  GCDGAPLLPLLFV+VNMGFN
Sbjct  143  IFICLLLPFLSKLWGIPFVQLPNYLKEGAACFLNMGTLSSGCDGAPLLPLLFVVVNMGFN  202

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVS LASTFSVPISV++FTLPLPYLGVA+SLP GF+ G  ILV+G+LI
Sbjct  203  ISLLHLLKISSAVVSSLASTFSVPISVYVFTLPLPYLGVAASLPTGFVSGTIILVIGLLI  262

Query  314  YAWTPSLHMAKAS  276
            YAWTPS++   AS
Sbjct  263  YAWTPSVYPTSAS  275



>dbj|BAB10035.1| unnamed protein product [Arabidopsis thaliana]
Length=276

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 116/133 (87%), Gaps = 3/133 (2%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFN  495
            + I+LLLPFLSKLWGIPF QL TY+KDGA CFLN GTI +GCDGAP LPLLFVI+N+G+N
Sbjct  134  ICIALLLPFLSKLWGIPFNQLGTYLKDGAVCFLNNGTITKGCDGAPFLPLLFVIMNIGYN  193

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            I+LL LLKISSAVVSCLAST SVPI+VF+FT+PLPYLGVASSLP GF+ G  ILVLGM++
Sbjct  194  IALLRLLKISSAVVSCLASTVSVPIAVFLFTMPLPYLGVASSLPKGFMGGTIILVLGMIL  253

Query  314  YAWTPSLHMAKAS  276
            Y+WTP  H A +S
Sbjct  254  YSWTP--HGANSS  264



>ref|XP_009603801.1| PREDICTED: crt homolog 3 isoform X2 [Nicotiana tomentosiformis]
Length=411

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 1/114 (1%)
 Frame = -3

Query  638  KLWGIPFFQLPTYVKDGAACFLNLGTIQG-CDGAPLLPLLFVIVNMGFNISLLHLLKISS  462
            KLWG+PF QLP Y++DGAACFLN+GT+ G CDGAPLLPLLF+IVNMGFNISLLHLL+ISS
Sbjct  284  KLWGVPFTQLPNYLRDGAACFLNIGTLSGGCDGAPLLPLLFIIVNMGFNISLLHLLQISS  343

Query  461  AVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTP  300
            AVVSCLAST SVPISVF+FTLPLPYLGVASSLPPGF+ GA ILVLGMLIY W P
Sbjct  344  AVVSCLASTVSVPISVFLFTLPLPYLGVASSLPPGFVAGAIILVLGMLIYTWRP  397



>dbj|BAK05407.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=350

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +F+ LLLPFLSKLWGIPF  LPTY++DGAACFLN+G++  GC+GAPLLPLLFV+VNM
Sbjct  213  YQAIFMCLLLPFLSKLWGIPFHLLPTYIRDGAACFLNMGSLSAGCEGAPLLPLLFVVVNM  272

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
             FNISLLHLLKISSAVVSCLASTFSVP+S++ FTLPLPY+GVAS+LPPGF+ GAA+L+ G
Sbjct  273  AFNISLLHLLKISSAVVSCLASTFSVPLSIYAFTLPLPYIGVASTLPPGFVAGAAVLIAG  332

Query  323  MLIYA  309
            +L Y+
Sbjct  333  LLTYS  337



>ref|XP_003528593.1| PREDICTED: crt homolog 1-like [Glycine max]
Length=426

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 1/133 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+GT+ + CDGAPLLPLLFVIVNMGFN
Sbjct  292  LFICLLLPFLSKLWGIPFGQLPNYLKDGAACFLNVGTLSRACDGAPLLPLLFVIVNMGFN  351

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTFSVPI++++FTLPLPYLGVASSLP GF+ GA IL++G+LI
Sbjct  352  ISLLHLLKISSAVVSCLASTFSVPIAIYVFTLPLPYLGVASSLPTGFVAGAIILIIGLLI  411

Query  314  YAWTPSLHMAKAS  276
            YAWTPS   + AS
Sbjct  412  YAWTPSNGSSTAS  424



>ref|XP_003556785.1| PREDICTED: crt homolog 1-like [Glycine max]
Length=428

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 122/133 (92%), Gaps = 1/133 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWG+PF QLP Y+KDGAACFLN+GT+ +GCDGAPLLPLLF+IVNMGFN
Sbjct  294  LFICLLLPFLSKLWGVPFGQLPNYLKDGAACFLNVGTLSRGCDGAPLLPLLFIIVNMGFN  353

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTFSVPI++++FTLPLPY+GVASSLP GF+ GA IL++G+LI
Sbjct  354  ISLLHLLKISSAVVSCLASTFSVPIAIYVFTLPLPYIGVASSLPAGFVAGAIILIIGLLI  413

Query  314  YAWTPSLHMAKAS  276
            YAWTPS   + AS
Sbjct  414  YAWTPSNSSSTAS  426



>dbj|BAJ91104.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +F+ LLLPFLSKLWGIPF  LPTY++DGAACFLN+G++  GC+GAPLLPLLFV+VNM
Sbjct  304  YQAIFMCLLLPFLSKLWGIPFHLLPTYIRDGAACFLNMGSLSAGCEGAPLLPLLFVVVNM  363

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
             FNISLLHLLKISSAVVSCLASTFSVP+S++ FTLPLPY+GVAS+LPPGF+ GAA+L+ G
Sbjct  364  AFNISLLHLLKISSAVVSCLASTFSVPLSIYAFTLPLPYIGVASTLPPGFVAGAAVLIAG  423

Query  323  MLIYA  309
            +L Y+
Sbjct  424  LLTYS  428



>ref|XP_009368723.1| PREDICTED: crt homolog 2-like isoform X2 [Pyrus x bretschneideri]
Length=356

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 1/133 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP+Y+KDGAACFLN+GT+  GCDGAPLLPLLFVIVNMGFN
Sbjct  218  LFICLLLPFLSKLWGIPFGQLPSYLKDGAACFLNMGTLSTGCDGAPLLPLLFVIVNMGFN  277

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVS LASTFSVPISV++FTLPLPYLGVA+SLP GF+ G  +LV+G+LI
Sbjct  278  ISLLHLLKISSAVVSSLASTFSVPISVYVFTLPLPYLGVAASLPTGFVSGTIVLVIGLLI  337

Query  314  YAWTPSLHMAKAS  276
            YAWTPS++   AS
Sbjct  338  YAWTPSVYPTNAS  350



>gb|KFK25491.1| hypothetical protein AALP_AA8G121700 [Arabis alpina]
Length=449

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 113/124 (91%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y+KDGA CFLN+GT+ +GCDGAPLLPLLFVIVN+G+NI+
Sbjct  309  IALLLPFLSKLWGIPFNQLGSYLKDGAVCFLNIGTMTKGCDGAPLLPLLFVIVNIGYNIA  368

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLKISSAVVSCLAST SVPI+VF+FTLPLPYLGVASSLP GF+ G  ILVLGM++Y+
Sbjct  369  LLRLLKISSAVVSCLASTVSVPIAVFLFTLPLPYLGVASSLPKGFMGGTIILVLGMILYS  428

Query  308  WTPS  297
            WTP 
Sbjct  429  WTPQ  432



>gb|AAM60923.1| unknown [Arabidopsis thaliana]
Length=452

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL TY+KDGA CFLN GTI +GCDGAP LPLLFVI+N+G+NI+
Sbjct  312  IALLLPFLSKLWGIPFNQLGTYLKDGAVCFLNNGTITKGCDGAPFLPLLFVIMNIGYNIA  371

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLKISSAVVSCLAST SVPI+VF+FT+PLPYLGVASSLP GF+ G  ILVLGM++Y+
Sbjct  372  LLRLLKISSAVVSCLASTVSVPIAVFLFTMPLPYLGVASSLPKGFMGGTIILVLGMILYS  431

Query  308  WTPSLHMAKAS  276
            WTP  H A +S
Sbjct  432  WTP--HGANSS  440



>ref|NP_001078575.1| CRT (chloroquine-resistance transporter)-like transporter 3 [Arabidopsis 
thaliana]
 gb|AAM13018.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91339.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44200.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED91770.1| CRT (chloroquine-resistance transporter)-like transporter 3 [Arabidopsis 
thaliana]
Length=452

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 3/131 (2%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL TY+KDGA CFLN GTI +GCDGAP LPLLFVI+N+G+NI+
Sbjct  312  IALLLPFLSKLWGIPFNQLGTYLKDGAVCFLNNGTITKGCDGAPFLPLLFVIMNIGYNIA  371

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLKISSAVVSCLAST SVPI+VF+FT+PLPYLGVASSLP GF+ G  ILVLGM++Y+
Sbjct  372  LLRLLKISSAVVSCLASTVSVPIAVFLFTMPLPYLGVASSLPKGFMGGTIILVLGMILYS  431

Query  308  WTPSLHMAKAS  276
            WTP  H A +S
Sbjct  432  WTP--HGANSS  440



>ref|XP_009368715.1| PREDICTED: crt homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=454

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 1/133 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP+Y+KDGAACFLN+GT+  GCDGAPLLPLLFVIVNMGFN
Sbjct  316  LFICLLLPFLSKLWGIPFGQLPSYLKDGAACFLNMGTLSTGCDGAPLLPLLFVIVNMGFN  375

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVS LASTFSVPISV++FTLPLPYLGVA+SLP GF+ G  +LV+G+LI
Sbjct  376  ISLLHLLKISSAVVSSLASTFSVPISVYVFTLPLPYLGVAASLPTGFVSGTIVLVIGLLI  435

Query  314  YAWTPSLHMAKAS  276
            YAWTPS++   AS
Sbjct  436  YAWTPSVYPTNAS  448



>gb|KDO54774.1| hypothetical protein CISIN_1g0128212mg, partial [Citrus sinensis]
Length=200

 Score =   186 bits (472),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP Y++DGAACFLNLGT+  GCDGAPLLPLLFV+VNMGFN
Sbjct  63   LFICLLLPFLSKLWGIPFSQLPIYLRDGAACFLNLGTLSSGCDGAPLLPLLFVLVNMGFN  122

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSA+VS LASTFSVPISV++FTLPLPYLGVASSLP GF+ GA ILV+G+LI
Sbjct  123  ISLLHLLKISSAIVSSLASTFSVPISVYVFTLPLPYLGVASSLPTGFVAGAVILVMGLLI  182

Query  314  YAWTPS  297
            Y+WTP+
Sbjct  183  YSWTPT  188



>ref|XP_006399733.1| hypothetical protein EUTSA_v10015653mg [Eutrema salsugineum]
 gb|ESQ41186.1| hypothetical protein EUTSA_v10015653mg [Eutrema salsugineum]
Length=453

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y+KDGA CFLN+GT+  GCDGAPLLPLLFVIVN+G+NI+
Sbjct  313  IALLLPFLSKLWGIPFNQLGSYLKDGAVCFLNIGTMTIGCDGAPLLPLLFVIVNIGYNIA  372

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLKISSAVVSCLAST SVPI+VF+FT+PLPYLGVASSLP GF+ G  ILVLGML+Y+
Sbjct  373  LLRLLKISSAVVSCLASTVSVPIAVFLFTMPLPYLGVASSLPKGFMGGTMILVLGMLLYS  432

Query  308  WTPS  297
            WTP 
Sbjct  433  WTPQ  436



>ref|XP_009403363.1| PREDICTED: crt homolog 1-like [Musa acuminata subsp. malaccensis]
Length=436

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFN  495
            +FI LL+PFLSKLWGI F QLP+Y++DG ACFLN+G++ +GC+GAP+LP+LFVIVNM FN
Sbjct  302  LFICLLMPFLSKLWGIHFSQLPSYIRDGTACFLNIGSLSKGCEGAPILPVLFVIVNMAFN  361

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVSCLASTF+VP++++ FTLPLPY+G ASSLP GFI GAA+LV G+L+
Sbjct  362  ISLLHLLKISSAVVSCLASTFAVPLAIYAFTLPLPYIGAASSLPTGFIAGAAVLVSGLLL  421

Query  314  YAWTPS  297
            Y W PS
Sbjct  422  YCWAPS  427



>gb|KHN12034.1| Crt like 1, partial [Glycine soja]
Length=299

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ LLLPFLSKLWGIPF QLP Y+KDGAACFLN GT+  GCDGAPLLPLLF+IVN+GFN
Sbjct  161  LFVCLLLPFLSKLWGIPFSQLPNYLKDGAACFLNFGTLSSGCDGAPLLPLLFIIVNIGFN  220

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            I+LLHLLKISSAVVSCLASTFSVPIS+++FT+PLPYLGVASSLP GF+ GA IL+LG+LI
Sbjct  221  IALLHLLKISSAVVSCLASTFSVPISIYVFTMPLPYLGVASSLPTGFMAGAIILILGLLI  280

Query  314  YAWTP  300
            YAWTP
Sbjct  281  YAWTP  285



>ref|XP_010519808.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
Length=454

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y++DGAACF+N+GT+  GC+GAPLLP+LFVIVN+ +NI+
Sbjct  318  IALLLPFLSKLWGIPFNQLFSYLRDGAACFMNIGTMTMGCEGAPLLPVLFVIVNIAYNIA  377

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVSCLAST SVPI+V++FTLPLPYLGVASSLP GF+ G  ILVLGMLIYA
Sbjct  378  LLRLIKISSAVVSCLASTVSVPIAVYMFTLPLPYLGVASSLPTGFVAGTFILVLGMLIYA  437

Query  308  WTPS  297
            WTPS
Sbjct  438  WTPS  441



>ref|XP_002871515.1| hypothetical protein ARALYDRAFT_488059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47774.1| hypothetical protein ARALYDRAFT_488059 [Arabidopsis lyrata subsp. 
lyrata]
Length=454

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL TY+KDGA CFLN GTI +GCDGAP LP+LFVI+N+G+NI+
Sbjct  314  IALLLPFLSKLWGIPFNQLGTYLKDGAVCFLNHGTITKGCDGAPFLPILFVIMNIGYNIA  373

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLKISSAVVSCLAST SVPI+VF+FT+PLPYLGVASSLP GF+ G  ILVLGM++Y+
Sbjct  374  LLRLLKISSAVVSCLASTVSVPIAVFLFTMPLPYLGVASSLPKGFMGGTIILVLGMILYS  433

Query  308  WTPS  297
            WTP 
Sbjct  434  WTPQ  437



>ref|XP_010453280.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=462

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y+KDGA CFLN+GT+ +GCDGAPLLPLLFVIVN+G+NI+
Sbjct  322  IALLLPFLSKLWGIPFNQLGSYLKDGAVCFLNIGTLTKGCDGAPLLPLLFVIVNIGYNIA  381

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLK+S+AVVSCLAST SVPI+VF+FTLPLPYLGVASSLP GF+ G  ILVLGM++Y+
Sbjct  382  LLRLLKLSTAVVSCLASTISVPIAVFLFTLPLPYLGVASSLPTGFMGGTIILVLGMILYS  441

Query  308  WTPS  297
            WTP 
Sbjct  442  WTPQ  445



>ref|XP_003545164.1| PREDICTED: crt homolog 1-like [Glycine max]
Length=438

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ LLLPFLSKLWGIPF QLP Y+KDGAACFLN GT+  GCDGAPLLPLLF+IVN+GFN
Sbjct  300  LFVCLLLPFLSKLWGIPFSQLPNYLKDGAACFLNFGTLSSGCDGAPLLPLLFIIVNIGFN  359

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            I+LLHLLKISSAVVSCLASTFSVPIS+++FT+PLPYLGVASSLP GF+ GA IL+LG+LI
Sbjct  360  IALLHLLKISSAVVSCLASTFSVPISIYVFTMPLPYLGVASSLPTGFMAGAIILILGLLI  419

Query  314  YAWTPS  297
            YAWTPS
Sbjct  420  YAWTPS  425



>ref|XP_004140194.1| PREDICTED: crt homolog 2-like [Cucumis sativus]
 ref|XP_004156047.1| PREDICTED: crt homolog 2-like [Cucumis sativus]
 gb|KGN48096.1| hypothetical protein Csa_6G430720 [Cucumis sativus]
Length=459

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMGFNI  492
            VFI  LLPFLSKLWGIPF QLP+Y++DGAACFLN G++ GCDGAPLLPLLF++VN+GFNI
Sbjct  320  VFILALLPFLSKLWGIPFTQLPSYLRDGAACFLNYGSLSGCDGAPLLPLLFILVNIGFNI  379

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SLLHLLKISSAVVS LASTFSVPISV++FTLPLPY+GVAS+LP GF+ GA ILVLG+LIY
Sbjct  380  SLLHLLKISSAVVSSLASTFSVPISVYMFTLPLPYIGVASALPSGFVAGAVILVLGLLIY  439

Query  311  AWTPS  297
            AWTPS
Sbjct  440  AWTPS  444



>ref|XP_008449652.1| PREDICTED: crt homolog 3 [Cucumis melo]
Length=459

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMGFNI  492
            VFI  LLPFLSKLWGIPF QLP+Y++DGAACFLN G++ GCDGAPLLPLLF++VN+GFNI
Sbjct  320  VFILALLPFLSKLWGIPFTQLPSYLRDGAACFLNYGSLSGCDGAPLLPLLFILVNIGFNI  379

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SLLHLLKISSAVVS LASTFSVPISV++FTLPLPY+GVAS+LP GF+ GA ILVLG+LIY
Sbjct  380  SLLHLLKISSAVVSSLASTFSVPISVYMFTLPLPYIGVASALPSGFVAGAVILVLGLLIY  439

Query  311  AWTPS  297
            AWTPS
Sbjct  440  AWTPS  444



>ref|XP_011080445.1| PREDICTED: crt homolog 1 [Sesamum indicum]
Length=398

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQG-CDGAPLLPLLFVIVNM  504
            Y   FI +LLPFLS LWGIPF QL  Y+KDGAACFLN+G +   C+GAPLLP+LFVIVNM
Sbjct  260  YQAAFICILLPFLSNLWGIPFGQLLNYLKDGAACFLNVGAMSNRCNGAPLLPVLFVIVNM  319

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            GFNISLLHLLKISSAVVSCLAST SVPISV+ FTLPLPYLGVA+SLPPGF+ G  +LV+G
Sbjct  320  GFNISLLHLLKISSAVVSCLASTLSVPISVYFFTLPLPYLGVATSLPPGFVAGTIVLVVG  379

Query  323  MLIYAWT  303
            +LIY W 
Sbjct  380  LLIYIWR  386



>ref|XP_006470531.1| PREDICTED: crt homolog 1-like [Citrus sinensis]
Length=455

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNI  492
            FI LLLPFLSKLWGIPF QLP Y++DGAACFLNLGT+  GCDGAPLLPLLFV+VNMGFNI
Sbjct  319  FICLLLPFLSKLWGIPFSQLPIYLRDGAACFLNLGTLSSGCDGAPLLPLLFVLVNMGFNI  378

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SLLHLLKISSA+VS LASTFSVPISV++FTLPLPYLGVASSLP GF+ GA ILV+G+LIY
Sbjct  379  SLLHLLKISSAIVSSLASTFSVPISVYVFTLPLPYLGVASSLPTGFVAGAVILVMGLLIY  438

Query  311  AWTPS  297
            +WTP+
Sbjct  439  SWTPT  443



>ref|XP_006446307.1| hypothetical protein CICLE_v10017793mg [Citrus clementina]
 gb|ESR59547.1| hypothetical protein CICLE_v10017793mg [Citrus clementina]
Length=456

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNI  492
            FI LLLPFLSKLWGIPF QLP Y++DGAACFLNLGT+  GCDGAPLLPLLFV+VNMGFNI
Sbjct  320  FICLLLPFLSKLWGIPFSQLPIYLRDGAACFLNLGTLSSGCDGAPLLPLLFVLVNMGFNI  379

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SLLHLLKISSA+VS LASTFSVPISV++FTLPLPYLGVASSLP GF+ GA ILV+G+LIY
Sbjct  380  SLLHLLKISSAIVSSLASTFSVPISVYVFTLPLPYLGVASSLPTGFVAGAVILVMGLLIY  439

Query  311  AWTPS  297
            +WTP+
Sbjct  440  SWTPT  444



>ref|XP_010491972.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=460

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 112/124 (90%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y+KDGA CFLN+GT+ +GCDGAP LPLLFVIVN+G+NI+
Sbjct  320  IALLLPFLSKLWGIPFNQLGSYLKDGAVCFLNIGTLTKGCDGAPFLPLLFVIVNIGYNIA  379

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLK+S+AVVSCLAST SVPI+VF+FT+PLPYLGVASSLP GF+ G  ILVLGM++Y+
Sbjct  380  LLRLLKLSTAVVSCLASTISVPIAVFLFTMPLPYLGVASSLPTGFMGGTIILVLGMILYS  439

Query  308  WTPS  297
            WTP 
Sbjct  440  WTPQ  443



>ref|XP_002313263.2| hypothetical protein POPTR_0009s07350g [Populus trichocarpa]
 gb|EEE87218.2| hypothetical protein POPTR_0009s07350g [Populus trichocarpa]
Length=477

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ LLLPF+SKLWGIPF QLP Y+KDGA CFLN+G++  GCDGAPLLPLLFVIVNMGFN
Sbjct  325  LFVCLLLPFMSKLWGIPFSQLPNYLKDGAVCFLNIGSLSSGCDGAPLLPLLFVIVNMGFN  384

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVS LASTFSVPI+V++FTLPLPYLGVASSLP GF+ GA +LVLG+LI
Sbjct  385  ISLLHLLKISSAVVSSLASTFSVPIAVYVFTLPLPYLGVASSLPTGFVAGAIVLVLGLLI  444

Query  314  YAWTPSLHMAK  282
            YAWTPS    +
Sbjct  445  YAWTPSRKWCR  455



>ref|XP_008227269.1| PREDICTED: crt homolog 1 [Prunus mume]
Length=453

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 114/124 (92%), Gaps = 1/124 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+GT+  GCDGAPLLPLLFV+VNMGFN
Sbjct  315  IFICLLLPFLSKLWGIPFGQLPNYLKDGAACFLNMGTLSSGCDGAPLLPLLFVVVNMGFN  374

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAV+S LASTFSVPISV++FTLPLPYLGVA+SLP GF+ G  ILV+G+LI
Sbjct  375  ISLLHLLKISSAVLSSLASTFSVPISVYVFTLPLPYLGVAASLPTGFVAGTIILVIGLLI  434

Query  314  YAWT  303
            YAWT
Sbjct  435  YAWT  438



>ref|XP_010419799.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=458

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y+KDGA CFLN+GT+ +GCDGAP LPLLFVIVN+G+NI+
Sbjct  318  IALLLPFLSKLWGIPFNQLGSYLKDGAVCFLNIGTLTKGCDGAPFLPLLFVIVNIGYNIA  377

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLK+S+AVVSCLAST SVPI+V +FTLPLPYLGVASSLP GF+ G  ILVLGM++Y+
Sbjct  378  LLRLLKLSTAVVSCLASTISVPIAVLLFTLPLPYLGVASSLPAGFMGGTIILVLGMILYS  437

Query  308  WTPS  297
            WTP 
Sbjct  438  WTPQ  441



>ref|XP_006287749.1| hypothetical protein CARUB_v10000960mg [Capsella rubella]
 gb|EOA20647.1| hypothetical protein CARUB_v10000960mg [Capsella rubella]
Length=445

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y+KDGA CFLN+GT+ +GCDGAP LPLLFVIVN+G+NI+
Sbjct  305  IALLLPFLSKLWGIPFNQLGSYLKDGAGCFLNIGTVTKGCDGAPFLPLLFVIVNIGYNIA  364

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
             L L+K+SSAVVSCLAST SVPI+VF+FT+PLPYLGVASSLP GFI G  ILVLGM++Y+
Sbjct  365  HLRLIKLSSAVVSCLASTVSVPIAVFLFTMPLPYLGVASSLPTGFIGGTIILVLGMILYS  424

Query  308  WT  303
            WT
Sbjct  425  WT  426



>gb|KJB35699.1| hypothetical protein B456_006G124500 [Gossypium raimondii]
Length=445

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI--QGCDGAPLLPLLFVIVNMGF  498
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+G      CDGAPLLPLLFVIVNMGF
Sbjct  308  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNIGGTLSSRCDGAPLLPLLFVIVNMGF  367

Query  497  NISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGML  318
            NISLLHLLKISSAVVS LASTFSVPISV++FTLPLPYLGVASSLP GF+ GA ILV G+L
Sbjct  368  NISLLHLLKISSAVVSSLASTFSVPISVYVFTLPLPYLGVASSLPTGFVAGAIILVTGLL  427

Query  317  IYAWTPS  297
            IYAWTPS
Sbjct  428  IYAWTPS  434



>gb|KHG29231.1| Crt [Gossypium arboreum]
Length=521

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI--QGCDGAPLLPLLFVIVNMGF  498
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+G      CDGAPLLPLLFVIVNMGF
Sbjct  384  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNIGGTLSSRCDGAPLLPLLFVIVNMGF  443

Query  497  NISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGML  318
            NISLLHLLKISSAVVS LASTFSVPISV++FTLPLPYLGVASSLP GF+ GA ILV G+L
Sbjct  444  NISLLHLLKISSAVVSSLASTFSVPISVYVFTLPLPYLGVASSLPTGFVAGAIILVTGLL  503

Query  317  IYAWTPS  297
            IYAWTPS
Sbjct  504  IYAWTPS  510



>ref|XP_010091885.1| Exocyst complex component 5 [Morus notabilis]
 gb|EXB46715.1| Exocyst complex component 5 [Morus notabilis]
Length=391

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = -3

Query  617  FQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVSCLA  441
            FQLP Y+KDGAACFLN+GT+  GCDGAPLLPLLFVIVNMGFNISLLHLLKISS VVSCLA
Sbjct  269  FQLPNYLKDGAACFLNIGTLSSGCDGAPLLPLLFVIVNMGFNISLLHLLKISSGVVSCLA  328

Query  440  STFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMAKAS  276
            STFSVPISV++FTLPLPYLGVASSLP GF+ G  +LV+G+LIYAWT S   +  S
Sbjct  329  STFSVPISVYLFTLPLPYLGVASSLPRGFVAGTIVLVMGLLIYAWTSSEGSSDTS  383



>gb|KJB83544.1| hypothetical protein B456_013G253300 [Gossypium raimondii]
Length=447

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 112/124 (90%), Gaps = 2/124 (2%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI--QGCDGAPLLPLLFVIVNMGF  498
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+G     GCDGAPLLPLLF+IVNMGF
Sbjct  310  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNMGGTLSSGCDGAPLLPLLFIIVNMGF  369

Query  497  NISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGML  318
            NI+LLHLLKISSAVVS LASTFSVPISV+IFTLPLPYLGVASSLP GF+ GA ILV+G+L
Sbjct  370  NIALLHLLKISSAVVSSLASTFSVPISVYIFTLPLPYLGVASSLPAGFVAGAIILVMGLL  429

Query  317  IYAW  306
            IYAW
Sbjct  430  IYAW  433



>gb|KHG16222.1| Crt [Gossypium arboreum]
Length=445

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 112/124 (90%), Gaps = 2/124 (2%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI--QGCDGAPLLPLLFVIVNMGF  498
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+G     GCDGAPLLPLLF+IVNMGF
Sbjct  308  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNMGGTLSTGCDGAPLLPLLFIIVNMGF  367

Query  497  NISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGML  318
            NI+LLHLLKISSAVVS LASTFSVPISV+IFTLPLPYLGVASSLP GF+ GA ILV+G+L
Sbjct  368  NIALLHLLKISSAVVSSLASTFSVPISVYIFTLPLPYLGVASSLPAGFVAGAIILVMGLL  427

Query  317  IYAW  306
            IYAW
Sbjct  428  IYAW  431



>ref|XP_002456955.1| hypothetical protein SORBIDRAFT_03g046260 [Sorghum bicolor]
 gb|EES02075.1| hypothetical protein SORBIDRAFT_03g046260 [Sorghum bicolor]
Length=444

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMG  501
            Y  +F+ LLLPFLSKLWG+PF  LPTY+KDGAACFLN+G+I GC+GAPLLPLLFV+VNMG
Sbjct  305  YQALFMCLLLPFLSKLWGVPFHVLPTYIKDGAACFLNMGSISGCEGAPLLPLLFVLVNMG  364

Query  500  FNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGM  321
            +NISLLHLLKISSAV+S LASTFSVP+S++ FTLPLPY+GVASSLPPGF+ GAA+L  G+
Sbjct  365  YNISLLHLLKISSAVISSLASTFSVPLSIYAFTLPLPYIGVASSLPPGFVAGAAVLTAGL  424

Query  320  LIYAWTPSLH  291
            L+Y+   + H
Sbjct  425  LLYSLPQAQH  434



>gb|AFW83925.1| hypothetical protein ZEAMMB73_730584 [Zea mays]
Length=441

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMG  501
            Y  +F+ LLLPFLSKLWG+PF  LPTY+KDGAACFLN+G+I GC+GAPLLPLLFV+VNMG
Sbjct  303  YQALFMCLLLPFLSKLWGVPFRVLPTYIKDGAACFLNMGSISGCEGAPLLPLLFVLVNMG  362

Query  500  FNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGM  321
            FNISLLHLLKISSAV+S LASTFSVP+S++ FTLPLPY+GVASSLPPGF+ GAA+L  G+
Sbjct  363  FNISLLHLLKISSAVISSLASTFSVPLSIYAFTLPLPYIGVASSLPPGFVAGAAVLTAGL  422

Query  320  LIYAWTPSLH  291
            L+Y+   + H
Sbjct  423  LLYSLPQARH  432



>gb|EMS46347.1| hypothetical protein TRIUR3_26464 [Triticum urartu]
Length=339

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +F+ LLLPFLSKLWGIPF  LPTY++DGAACFLN+G++  GC+GAPLLPLLFV+VNM
Sbjct  203  YQAIFMCLLLPFLSKLWGIPFHLLPTYIRDGAACFLNMGSLSAGCEGAPLLPLLFVLVNM  262

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            GFNISLLHLLKISSAV SCLASTFSVP+S++ FTLPLPY+GVAS+LPPGF+ GAA+L+ G
Sbjct  263  GFNISLLHLLKISSAVASCLASTFSVPLSIYAFTLPLPYIGVASTLPPGFVAGAAVLIAG  322

Query  323  MLIYA  309
            +L+++
Sbjct  323  LLMHS  327



>ref|XP_008656855.1| PREDICTED: crt homolog 1-like isoform X1 [Zea mays]
Length=557

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMG  501
            Y  +F+ LLLPFLSKLWG+PF  LPTY+KDGAACFLN+G+I GC+GAPLLPLLFV+VNMG
Sbjct  419  YQALFMCLLLPFLSKLWGVPFRVLPTYIKDGAACFLNMGSISGCEGAPLLPLLFVLVNMG  478

Query  500  FNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGM  321
            FNISLLHLLKISSAV+S LASTFSVP+S++ FTLPLPY+GVASSLPPGF+ GAA+L  G+
Sbjct  479  FNISLLHLLKISSAVISSLASTFSVPLSIYAFTLPLPYIGVASSLPPGFVAGAAVLTAGL  538

Query  320  LIYAWTPSLH  291
            L+Y+   + H
Sbjct  539  LLYSLPQARH  548



>ref|XP_006856983.1| hypothetical protein AMTR_s00190p00035510 [Amborella trichopoda]
 gb|ERN18450.1| hypothetical protein AMTR_s00190p00035510 [Amborella trichopoda]
Length=437

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 1/127 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFN  495
            +F+ L  PFLS LWG+PF QL +Y++DGAACF+N+G+   GC+GAPLLP+LFVI NMGFN
Sbjct  304  LFLCLSFPFLSNLWGVPFHQLMSYLRDGAACFINIGSSATGCEGAPLLPVLFVITNMGFN  363

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            IS+LHLLK+SSAVVSCLA+TF+VP+S++ FTLPLPY+G  S+LPPGFI+GA +LV G+L+
Sbjct  364  ISMLHLLKLSSAVVSCLAATFAVPLSIYAFTLPLPYIGAPSTLPPGFILGATVLVAGLLV  423

Query  314  YAWTPSL  294
            Y   PSL
Sbjct  424  YCLPPSL  430



>ref|XP_010492995.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=445

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G+ I GC+GAPLLP++FV++NM +NIS
Sbjct  308  IALLLPFLSKLWGIPFNQLPSYIRDGGACFLNIGSRITGCEGAPLLPVMFVMMNMAYNIS  367

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVS LAST SVPI+VF FTLPLPYLGVAS+LPPGF+ G  +LVLGML+YA
Sbjct  368  LLRLIKISSAVVSSLASTVSVPIAVFCFTLPLPYLGVASTLPPGFVAGTVVLVLGMLLYA  427

Query  308  WTPSLHMAKA  279
            WTPS + + +
Sbjct  428  WTPSTNSSHS  437



>ref|XP_010031716.1| PREDICTED: crt homolog 1 [Eucalyptus grandis]
 gb|KCW51082.1| hypothetical protein EUGRSUZ_J00689 [Eucalyptus grandis]
Length=466

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 106/115 (92%), Gaps = 1/115 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            SKLWG+PF QLP Y++DG ACFLN+G +  GCDGAPLLPLLFV+VNMGFNISLLHLLKIS
Sbjct  345  SKLWGVPFSQLPNYIRDGTACFLNIGQLSSGCDGAPLLPLLFVVVNMGFNISLLHLLKIS  404

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTP  300
            SA+VS LASTFSVPISV++FTLPLPYLGVASSLPPGF+ GA +LVLG+LIYAW+P
Sbjct  405  SALVSSLASTFSVPISVYVFTLPLPYLGVASSLPPGFVAGAIVLVLGLLIYAWSP  459



>ref|XP_003567491.1| PREDICTED: crt homolog 1-like [Brachypodium distachyon]
Length=440

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 113/124 (91%), Gaps = 1/124 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +F+ LLLP LSKLWGIPF  LPTY++DGAACFLN+G++  GC+GAPLLPLLFV+VNM
Sbjct  304  YQALFMFLLLPILSKLWGIPFHLLPTYIRDGAACFLNMGSLSSGCEGAPLLPLLFVLVNM  363

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            GFNISLLHLLKISSAVVSCLASTFSVP+S++ FTLPLPY+GVASSLPPGF+ GAA+L+ G
Sbjct  364  GFNISLLHLLKISSAVVSCLASTFSVPLSIYAFTLPLPYIGVASSLPPGFVAGAAVLIAG  423

Query  323  MLIY  312
            +L+Y
Sbjct  424  LLLY  427



>ref|XP_010420740.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=442

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G+ I GC+GAPLLP++FV++NM +NIS
Sbjct  305  IALLLPFLSKLWGIPFNQLPSYIRDGGACFLNIGSRITGCEGAPLLPVMFVMMNMAYNIS  364

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVS LAST SVPI+VF FTLPLPYLGVAS+LP GF+ G  +LVLGML+YA
Sbjct  365  LLRLIKISSAVVSSLASTVSVPIAVFCFTLPLPYLGVASTLPRGFVAGTVVLVLGMLLYA  424

Query  308  WTPSLHMAKA  279
            WTPS + + +
Sbjct  425  WTPSTNTSHS  434



>ref|NP_001140411.1| hypothetical protein [Zea mays]
 gb|ACF83778.1| unknown [Zea mays]
 tpg|DAA55771.1| TPA: hypothetical protein ZEAMMB73_240854 [Zea mays]
Length=436

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMG  501
            Y  +F+ +LLPFLSKLWG+PF  LPTY+KDGAACFLN+G+I GC+GAPLLPLLFV+VNMG
Sbjct  296  YQALFMCILLPFLSKLWGVPFHVLPTYIKDGAACFLNMGSISGCEGAPLLPLLFVLVNMG  355

Query  500  FNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGM  321
            FNISLL+LLKISSAV+S LASTFSVP+S++ FTLPLPY+G ASSLPPGF+ GAA+L  G+
Sbjct  356  FNISLLNLLKISSAVISSLASTFSVPLSIYAFTLPLPYIGAASSLPPGFVAGAAVLTTGL  415

Query  320  LIYAWTPSLHMAKA  279
            L+Y+   + H   +
Sbjct  416  LLYSLPQAQHYGNS  429



>ref|XP_002873945.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50204.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G+ I GC+GAPLLP++FV++NM +NIS
Sbjct  300  IALLLPFLSKLWGIPFNQLPSYIRDGGACFLNIGSRITGCEGAPLLPVMFVMMNMAYNIS  359

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVS LAST SVPI+V+ FTLPLPYLGVAS+LP GF+ G  ILVLGML+YA
Sbjct  360  LLRLIKISSAVVSSLASTVSVPIAVYCFTLPLPYLGVASTLPRGFVAGTVILVLGMLLYA  419

Query  308  WTPSLHMAKA  279
            WTPS + + +
Sbjct  420  WTPSTNTSDS  429



>ref|XP_006400494.1| hypothetical protein EUTSA_v10015536mg [Eutrema salsugineum]
 gb|ESQ41947.1| hypothetical protein EUTSA_v10015536mg [Eutrema salsugineum]
Length=442

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+GT   GC+GAPLLP++FV++NM +NIS
Sbjct  306  IALLLPFLSKLWGIPFNQLPSYLRDGGACFLNIGTRTIGCEGAPLLPIMFVMMNMAYNIS  365

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAV+S LAST SVPI+V++FTLPLPYLGVASSLP GF+ G  ILVLGML+YA
Sbjct  366  LLRLIKISSAVLSSLASTVSVPIAVYLFTLPLPYLGVASSLPTGFVAGTVILVLGMLLYA  425

Query  308  WTPS  297
            WTPS
Sbjct  426  WTPS  429



>ref|XP_010454210.1| PREDICTED: crt homolog 1-like [Camelina sativa]
Length=445

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G+ I GC+GAPLLP++FV++NM +NIS
Sbjct  308  IALLLPFLSKLWGIPFNQLPSYIRDGGACFLNIGSRITGCEGAPLLPVMFVMMNMAYNIS  367

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVS LAST SVPI+VF FTLPLPYLGVAS+LP GF+ G  +LVLGML+YA
Sbjct  368  LLRLIKISSAVVSSLASTVSVPIAVFCFTLPLPYLGVASTLPRGFVAGTVVLVLGMLLYA  427

Query  308  WTPSLHMAK  282
            WTPS + + 
Sbjct  428  WTPSTNTSH  436



>emb|CDY44914.1| BnaA02g04190D [Brassica napus]
Length=448

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF+QLP+Y+KDG ACFLN+G    GC+GAPLLP++FV++NM +NIS
Sbjct  311  IALLLPFLSKLWGIPFYQLPSYLKDGGACFLNIGAKTTGCEGAPLLPIMFVMMNMAYNIS  370

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVS LAST SVPI+V+ FTLPLPYLGVAS+LP GF+ G  ILVLGML+YA
Sbjct  371  LLRLIKISSAVVSSLASTVSVPIAVYFFTLPLPYLGVASALPTGFVAGTVILVLGMLLYA  430

Query  308  WTPS  297
            WTPS
Sbjct  431  WTPS  434



>ref|XP_006287751.1| hypothetical protein CARUB_v10000962mg [Capsella rubella]
 gb|EOA20649.1| hypothetical protein CARUB_v10000962mg [Capsella rubella]
Length=444

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G+ + GC+GAPLLP++FV++NM +NIS
Sbjct  307  IALLLPFLSKLWGIPFNQLPSYIRDGGACFLNIGSRVTGCEGAPLLPVMFVMMNMAYNIS  366

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVS LAST SVPI+V+ FTLPLPYLGVAS+LP GF+ G  ILVLGML+YA
Sbjct  367  LLRLIKISSAVVSSLASTVSVPIAVYCFTLPLPYLGVASTLPTGFVAGTVILVLGMLLYA  426

Query  308  WTPSLHMA  285
            WTPS + +
Sbjct  427  WTPSTNTS  434



>gb|AAM62809.1| unknown [Arabidopsis thaliana]
Length=447

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = -3

Query  683  IYFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVN  507
            I+  + I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G+ I GC+GAPLLP++FV++N
Sbjct  304  IFQVICIALLLPFLSKLWGIPFNQLPSYIRDGGACFLNIGSXITGCEGAPLLPVMFVMMN  363

Query  506  MGFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVL  327
            M +NISLL L+KISSAVVS LAST SVPI+V+ FTLPLPYLGVAS+LP GF+ G  ILV+
Sbjct  364  MAYNISLLRLIKISSAVVSSLASTVSVPIAVYCFTLPLPYLGVASTLPRGFVAGTIILVV  423

Query  326  GMLIYAWTPSLHMAKA  279
            GML+YAWTPS + + +
Sbjct  424  GMLLYAWTPSTNTSDS  439



>ref|NP_568373.1| CRT (chloroquine-resistance transporter)-like transporter 1 [Arabidopsis 
thaliana]
 gb|ABJ17107.1| At5g19380 [Arabidopsis thaliana]
 gb|AED92693.1| CRT (chloroquine-resistance transporter)-like transporter 1 [Arabidopsis 
thaliana]
Length=447

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = -3

Query  683  IYFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVN  507
            I+  + I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G+ I GC+GAPLLP++FV++N
Sbjct  304  IFQVICIALLLPFLSKLWGIPFNQLPSYIRDGGACFLNIGSRITGCEGAPLLPVMFVMMN  363

Query  506  MGFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVL  327
            M +NISLL L+KISSAVVS LAST SVPI+V+ FTLPLPYLGVAS+LP GF+ G  ILV+
Sbjct  364  MAYNISLLRLIKISSAVVSSLASTVSVPIAVYCFTLPLPYLGVASTLPRGFVAGTIILVV  423

Query  326  GMLIYAWTPSLHMAKA  279
            GML+YAWTPS + + +
Sbjct  424  GMLLYAWTPSTNTSDS  439



>ref|XP_009126357.1| PREDICTED: crt homolog 1 [Brassica rapa]
Length=449

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF+QLP+Y+KDG ACFLN+G    GC+GAPLLP++FV++NM +NIS
Sbjct  312  IALLLPFLSKLWGIPFYQLPSYLKDGGACFLNIGAKTTGCEGAPLLPIMFVMMNMAYNIS  371

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVS LAST SVPI+V+ FTLPLPYLGVAS+LP GF+ G  ILVLGML+YA
Sbjct  372  LLRLIKISSAVVSSLASTVSVPIAVYFFTLPLPYLGVASALPTGFVAGTVILVLGMLLYA  431

Query  308  WTPS  297
            WTPS
Sbjct  432  WTPS  435



>ref|XP_007141505.1| hypothetical protein PHAVU_008G201700g [Phaseolus vulgaris]
 gb|ESW13499.1| hypothetical protein PHAVU_008G201700g [Phaseolus vulgaris]
Length=438

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 120/133 (90%), Gaps = 1/133 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+GT+  GCDGAPLLPL+F+IVN+GFN
Sbjct  301  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNVGTLSSGCDGAPLLPLVFIIVNIGFN  360

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ++LLHLLKISSAVVS LASTFSVPIS+++FT+PLPYLGVASSLP GF+ GA IL+LG+LI
Sbjct  361  VALLHLLKISSAVVSSLASTFSVPISIYVFTMPLPYLGVASSLPTGFMAGAIILILGLLI  420

Query  314  YAWTPSLHMAKAS  276
            YAWTPS   + AS
Sbjct  421  YAWTPSNGSSDAS  433



>ref|XP_006646693.1| PREDICTED: crt homolog 1-like [Oryza brachyantha]
Length=374

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +F+ LLLPFLSKLWG+PF QLPTY++DG ACFLN+G++  GC+GAPLLPLLFV+VNM
Sbjct  232  YQALFMCLLLPFLSKLWGVPFQQLPTYIRDGTACFLNMGSLSSGCEGAPLLPLLFVLVNM  291

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            GFNISLLHLLKISS VVS LASTFSVP+S++ FTLPLPY+GVAS+LPPGF+ GAA+L  G
Sbjct  292  GFNISLLHLLKISSGVVSSLASTFSVPLSIYAFTLPLPYIGVASTLPPGFVAGAAVLTAG  351

Query  323  MLIYAW  306
            +L+Y++
Sbjct  352  LLLYSF  357



>ref|NP_001154721.1| CRT (chloroquine-resistance transporter)-like transporter 1 [Arabidopsis 
thaliana]
 gb|AED92694.1| CRT (chloroquine-resistance transporter)-like transporter 1 [Arabidopsis 
thaliana]
Length=507

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = -3

Query  683  IYFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVN  507
            I+  + I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G+ I GC+GAPLLP++FV++N
Sbjct  364  IFQVICIALLLPFLSKLWGIPFNQLPSYIRDGGACFLNIGSRITGCEGAPLLPVMFVMMN  423

Query  506  MGFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVL  327
            M +NISLL L+KISSAVVS LAST SVPI+V+ FTLPLPYLGVAS+LP GF+ G  ILV+
Sbjct  424  MAYNISLLRLIKISSAVVSSLASTVSVPIAVYCFTLPLPYLGVASTLPRGFVAGTIILVV  483

Query  326  GMLIYAWTPSLHMAKA  279
            GML+YAWTPS + + +
Sbjct  484  GMLLYAWTPSTNTSDS  499



>emb|CDY62039.1| BnaCnng39070D [Brassica napus]
Length=449

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = -3

Query  683  IYFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVN  507
            I+  + I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G    GC+GAPLLP++FV++N
Sbjct  306  IFQVICIALLLPFLSKLWGIPFNQLPSYLRDGGACFLNIGAKTTGCEGAPLLPIMFVMMN  365

Query  506  MGFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVL  327
            M +NISLL L+KISSAVVS LAST SVPI+V+ FTLPLPYLGVASSLP GF+ G  ILVL
Sbjct  366  MAYNISLLRLIKISSAVVSSLASTVSVPIAVYFFTLPLPYLGVASSLPTGFVAGTVILVL  425

Query  326  GMLIYAWTPS  297
            GML+YAWTPS
Sbjct  426  GMLLYAWTPS  435



>emb|CDX91169.1| BnaC02g04280D [Brassica napus]
Length=457

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y+KDGAACFLN+GT+ +GC+GAPLLPLLFVI N+G+NI+
Sbjct  317  IALLLPFLSKLWGIPFNQLGSYLKDGAACFLNIGTMTKGCEGAPLLPLLFVIANIGYNIA  376

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLKISSAVVS LAST SVPI+VF+FTLPLPYLGVASSLP GF+ G  ILVLGML+Y+
Sbjct  377  LLRLLKISSAVVSSLASTVSVPIAVFLFTLPLPYLGVASSLPNGFMGGTIILVLGMLVYS  436

Query  308  WTPS  297
            W P 
Sbjct  437  WAPQ  440



>gb|KFK26200.1| hypothetical protein AALP_AA8G215600 [Arabis alpina]
Length=445

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNIS  489
            ++LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G    GC+GAPLLP++FV++NM +NIS
Sbjct  309  VALLLPFLSKLWGIPFNQLPSYLRDGGACFLNIGAKTIGCEGAPLLPVMFVMMNMAYNIS  368

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVS LAST SVPI+VF FTLPLPYLGVASSLP GF+ G  ILVLGML+YA
Sbjct  369  LLRLIKISSAVVSSLASTVSVPIAVFCFTLPLPYLGVASSLPTGFVAGTVILVLGMLLYA  428

Query  308  WTPS  297
            WTPS
Sbjct  429  WTPS  432



>emb|CDX85698.1| BnaA02g01150D [Brassica napus]
Length=456

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y+KDGAACFLN+GT+ +GC+GAPLLPLLFVI N+G+NI+
Sbjct  316  IALLLPFLSKLWGIPFNQLGSYLKDGAACFLNIGTMTKGCEGAPLLPLLFVIANIGYNIA  375

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLKISSAVVS LAST SVPI+VF+FTLPLPYLGVASSLP GF+ G  ILVLGML+Y+
Sbjct  376  LLRLLKISSAVVSSLASTVSVPIAVFLFTLPLPYLGVASSLPNGFMGGTIILVLGMLVYS  435

Query  308  WTPS  297
            W P 
Sbjct  436  WAPQ  439



>ref|XP_009125851.1| PREDICTED: LOW QUALITY PROTEIN: crt homolog 1 [Brassica rapa]
Length=457

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QL +Y+KDGAACFLN+GT+ +GC+GAPLLPLLFVI N+G+NI+
Sbjct  317  IALLLPFLSKLWGIPFNQLGSYLKDGAACFLNIGTMTKGCEGAPLLPLLFVIANIGYNIA  376

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL LLKISSAVVS LAST SVPI+VF+FTLPLPYLGVASSLP GF+ G  ILVLGML+Y+
Sbjct  377  LLRLLKISSAVVSSLASTVSVPIAVFLFTLPLPYLGVASSLPNGFMGGTIILVLGMLVYS  436

Query  308  WTPS  297
            W P 
Sbjct  437  WAPQ  440



>emb|CDY02751.1| BnaC02g11380D [Brassica napus]
Length=509

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNIS  489
            I+LLLPFLSKLWGIPF QLP+Y++DG ACFLN+G    GC+GAPLLP++FV++NM +NIS
Sbjct  372  IALLLPFLSKLWGIPFNQLPSYLRDGGACFLNIGAKTTGCEGAPLLPIMFVMMNMAYNIS  431

Query  488  LLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            LL L+KISSAVVS LAST SVPI+V+ FTLPLPYLGVASSLP GF+ G  ILVLGML+YA
Sbjct  432  LLRLIKISSAVVSSLASTVSVPIAVYFFTLPLPYLGVASSLPTGFVAGTVILVLGMLLYA  491

Query  308  WTPS  297
            WTPS
Sbjct  492  WTPS  495



>ref|XP_007015262.1| CRT-like transporter 3 isoform 1 [Theobroma cacao]
 gb|EOY32881.1| CRT-like transporter 3 isoform 1 [Theobroma cacao]
Length=447

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 2/127 (2%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNL-GTIQ-GCDGAPLLPLLFVIVNMGF  498
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+ GTI  GCDGAPLLPLLFVIVNMGF
Sbjct  314  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNISGTISSGCDGAPLLPLLFVIVNMGF  373

Query  497  NISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGML  318
            NISLLHLLKISSAVVS LASTFSVPISV++FTLPLPYLGVASSLP GF+ GA +LVLG+L
Sbjct  374  NISLLHLLKISSAVVSSLASTFSVPISVYVFTLPLPYLGVASSLPTGFVAGAVVLVLGLL  433

Query  317  IYAWTPS  297
            +YAW+PS
Sbjct  434  VYAWSPS  440



>gb|KDP43205.1| hypothetical protein JCGZ_22757 [Jatropha curcas]
Length=470

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQG-CDGAPLLPLLFVIVNMGFN  495
            +FI LLLPF+SKLWGIPF QLP+Y++DGA CFLN+G++ G CDGAPLLPLLFV+VNMGFN
Sbjct  332  LFICLLLPFMSKLWGIPFSQLPSYLRDGAVCFLNIGSLSGGCDGAPLLPLLFVLVNMGFN  391

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLLHLLKISSAVVS LASTFSVPISV++FTLPLPYLGVASSLP GF+ GA ILV+G+ I
Sbjct  392  ISLLHLLKISSAVVSSLASTFSVPISVYVFTLPLPYLGVASSLPTGFVTGAIILVMGLFI  451

Query  314  YAWTP  300
            YAWTP
Sbjct  452  YAWTP  456



>gb|KJB35701.1| hypothetical protein B456_006G124500 [Gossypium raimondii]
Length=424

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 97/109 (89%), Gaps = 2/109 (2%)
 Frame = -3

Query  617  FQLPTYVKDGAACFLNLGTI--QGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVSCL  444
            FQLP Y+KDGAACFLN+G      CDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVS L
Sbjct  305  FQLPNYLKDGAACFLNIGGTLSSRCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVSSL  364

Query  443  ASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPS  297
            ASTFSVPISV++FTLPLPYLGVASSLP GF+ GA ILV G+LIYAWTPS
Sbjct  365  ASTFSVPISVYVFTLPLPYLGVASSLPTGFVAGAIILVTGLLIYAWTPS  413



>gb|KJB83545.1| hypothetical protein B456_013G253300 [Gossypium raimondii]
Length=426

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = -3

Query  617  FQLPTYVKDGAACFLNLGTI--QGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVSCL  444
            FQLP Y+KDGAACFLN+G     GCDGAPLLPLLF+IVNMGFNI+LLHLLKISSAVVS L
Sbjct  307  FQLPNYLKDGAACFLNMGGTLSSGCDGAPLLPLLFIIVNMGFNIALLHLLKISSAVVSSL  366

Query  443  ASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAW  306
            ASTFSVPISV+IFTLPLPYLGVASSLP GF+ GA ILV+G+LIYAW
Sbjct  367  ASTFSVPISVYIFTLPLPYLGVASSLPAGFVAGAIILVMGLLIYAW  412



>gb|EEE56025.1| hypothetical protein OsJ_04807 [Oryza sativa Japonica Group]
Length=378

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +F+ LLLPFLSKLWG+PF QLPTY++DG ACFLN+G++  GC+GAPLLPLLFV+VNM
Sbjct  236  YQALFMCLLLPFLSKLWGVPFHQLPTYIRDGTACFLNMGSLSSGCEGAPLLPLLFVLVNM  295

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            GFNISLLHLLKISSAVVS LASTFSVP+S++ FTLPLPY+GVAS+LPPGF+ GA +L  G
Sbjct  296  GFNISLLHLLKISSAVVSSLASTFSVPLSIYAFTLPLPYIGVASTLPPGFVAGAMVLTAG  355

Query  323  MLIYAW  306
            +L+Y++
Sbjct  356  LLLYSF  361



>ref|XP_004971309.1| PREDICTED: crt homolog 1-like [Setaria italica]
Length=444

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMG  501
            Y  +F+ LLLPFLSKLWG+PF  LP Y+KDGAACFLN G+I GC+GAPLLPLLFV+VNMG
Sbjct  305  YQALFMCLLLPFLSKLWGVPFHLLPAYIKDGAACFLNTGSISGCEGAPLLPLLFVLVNMG  364

Query  500  FNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGM  321
            +NISLLHL+KISSAVVS LASTFSVP+S++ FTLPLPY+GVAS+LPPGF+ GAA+L  G+
Sbjct  365  YNISLLHLIKISSAVVSSLASTFSVPLSIYAFTLPLPYIGVASTLPPGFVAGAAVLTAGL  424

Query  320  LIYAWTPSLHMAKA  279
            L+Y+   + H   +
Sbjct  425  LLYSLPQAQHSGNS  438



>gb|EMT33351.1| hypothetical protein F775_26728 [Aegilops tauschii]
Length=359

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 113/166 (68%), Gaps = 42/166 (25%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +F+ LLLPFLSKLWGIPF  LPTY++DGAACFLN+G++  GC+GAPLLPLLFV+VNM
Sbjct  182  YQAIFMCLLLPFLSKLWGIPFHLLPTYIRDGAACFLNMGSLSAGCEGAPLLPLLFVLVNM  241

Query  503  GFNISLLHLLKISSAVVSCLASTFS-----------------------------------  429
            GFNISLLHLLKISSAV SCLASTFS                                   
Sbjct  242  GFNISLLHLLKISSAVASCLASTFSEEVYWRESCDDFTRRVIFTDFCLMTVLSWSSLSVR  301

Query  428  ------VPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
                  +P+S++ FTLPLPY+GVAS+LPPGF+ GAA+L+ G+L++ 
Sbjct  302  SREDDNIPLSIYAFTLPLPYIGVASTLPPGFVAGAAVLIAGLLMHG  347



>ref|XP_010099798.1| hypothetical protein L484_004373 [Morus notabilis]
 gb|EXB80466.1| hypothetical protein L484_004373 [Morus notabilis]
Length=302

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = -3

Query  551  CDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVAS  372
            CDGAPLLPLLFVIVNMGFNISLLHLLKISS VVSCLASTFSVPISV++FTLPLPYLGVAS
Sbjct  203  CDGAPLLPLLFVIVNMGFNISLLHLLKISSGVVSCLASTFSVPISVYLFTLPLPYLGVAS  262

Query  371  SLPPGFIVGAAILVLGMLIYAWTPS  297
            SLP GF+ G  +LV+G+LIYAWT S
Sbjct  263  SLPRGFVAGTIVLVMGLLIYAWTSS  287



>dbj|BAD88271.1| hypothetical protein [Oryza sativa Japonica Group]
Length=495

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +F+ LLLPFLSKLWG+PF QLPTY++DG ACFLN+G++  GC+GAPLLPLLFV+VNM
Sbjct  265  YQALFMCLLLPFLSKLWGVPFHQLPTYIRDGTACFLNMGSLSSGCEGAPLLPLLFVLVNM  324

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAIL  333
            GFNISLLHLLKISSAVVS LASTFSVP+S++ FTLPLPY+GVAS+LPPGF+ GA  L
Sbjct  325  GFNISLLHLLKISSAVVSSLASTFSVPLSIYAFTLPLPYIGVASTLPPGFVAGAMFL  381



>gb|EAY77278.1| hypothetical protein OsI_05253 [Oryza sativa Indica Group]
Length=531

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = -3

Query  680  YFPVFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNM  504
            Y  +F+ LLLPFLSKLWG+PF QLPTY++DG ACFLN+G++  GC+GAPLLPLLFV+VNM
Sbjct  297  YQALFMCLLLPFLSKLWGVPFHQLPTYIRDGTACFLNMGSLSSGCEGAPLLPLLFVLVNM  356

Query  503  GFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGA  342
            GFNISLLHLLKISSAVVS LASTFSVP+S++ FTLPLPY+GVAS+LPPGF+ GA
Sbjct  357  GFNISLLHLLKISSAVVSSLASTFSVPLSIYAFTLPLPYIGVASTLPPGFVAGA  410



>gb|ABK23422.1| unknown [Picea sitchensis]
Length=466

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVS  450
            GIP  QLP+Y +DGAACF+N+G+I  C GAPLLPLLF+I+NM FNISLL L+K+SSAVV+
Sbjct  325  GIPLNQLPSYFRDGAACFINMGSISDCAGAPLLPLLFIIMNMCFNISLLRLVKMSSAVVA  384

Query  449  CLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMAKAST  273
             L+ T SVP+S+F+FTLPLPYL   S L P FI+GA ILVLG+++Y +  +   A   T
Sbjct  385  SLSITLSVPLSIFMFTLPLPYLAAESRLTPTFILGATILVLGLVMYNFPKNAKDALKKT  443



>ref|XP_006283786.1| hypothetical protein CARUB_v10004876mg [Capsella rubella]
 gb|EOA16684.1| hypothetical protein CARUB_v10004876mg [Capsella rubella]
Length=425

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFN  495
            +F+ LL+PFLS L GIPF  L +Y+KDGA CF N G  I GCDGAP+LPLL++  N+ FN
Sbjct  291  LFVFLLMPFLSNLKGIPFGSLLSYLKDGAGCFFNTGANISGCDGAPILPLLYIATNLAFN  350

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            IS+LHL+KISSA+VS L    SVP+SV+I + PLPYL   SSL    ++G+ +LVLG+L+
Sbjct  351  ISVLHLVKISSAIVSSLTVMLSVPLSVYIMSKPLPYLPGGSSLSSNLMMGSIVLVLGLLL  410

Query  314  YA--WTPSLHMAKAS  276
            Y    TP+    K S
Sbjct  411  YNIPTTPTKQHTKTS  425



>ref|XP_009414763.1| PREDICTED: crt homolog 3 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTI-QGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S + GIPF +LP Y++ GAACFLN+G++ +GC+GAPLLPLLF+ +NM FNISLL+L+K+S
Sbjct  308  SNIRGIPFAELPAYLRSGAACFLNVGSLTKGCEGAPLLPLLFIAMNMAFNISLLNLVKMS  367

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SA+VS LA T +VP+S++I +LPLPY+   +SL   F+VGAAILVLG++IY
Sbjct  368  SALVSSLAITLAVPLSIYILSLPLPYIPEGASLNVHFVVGAAILVLGLIIY  418



>gb|KHN08975.1| Crt like 1 [Glycine soja]
Length=408

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ L LP LS L GIPF QLP+Y K GA CFLNLG     CDGAPLLPLL+VI+N+ FN
Sbjct  275  LFVLLSLPILSNLRGIPFAQLPSYFKSGAGCFLNLGADNPNCDGAPLLPLLYVIINLAFN  334

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLL+ +K SSAVV+ L    SVPISV+I +LPLPYL   +SL P F++G AIL+ G+ +
Sbjct  335  ISLLNAVKTSSAVVASLLVMLSVPISVYILSLPLPYLPEGTSLSPFFLLGCAILLCGLFL  394

Query  314  YAWT  303
            Y  T
Sbjct  395  YNTT  398



>ref|NP_001242115.1| uncharacterized protein LOC100787260 [Glycine max]
 gb|ACU17997.1| unknown [Glycine max]
Length=408

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ L LP LS L GIPF QLP+Y K GA CFLNLG     CDGAPLLPLL+VI+N+ FN
Sbjct  275  LFVLLSLPILSNLRGIPFAQLPSYFKSGAGCFLNLGADNPNCDGAPLLPLLYVIINLAFN  334

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLL+ +K SSAVV+ L    SVPISV+I +LPLPYL   +SL P F++G AIL+ G+ +
Sbjct  335  ISLLNAVKTSSAVVASLLVMLSVPISVYILSLPLPYLPEGTSLSPFFLLGCAILLCGLFL  394

Query  314  YAWT  303
            Y  T
Sbjct  395  YNTT  398



>ref|XP_007136303.1| hypothetical protein PHAVU_009G035000g [Phaseolus vulgaris]
 gb|ESW08297.1| hypothetical protein PHAVU_009G035000g [Phaseolus vulgaris]
Length=408

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 1/121 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ L LP LSKL GIPF +LP+Y K GA CFLNLG  +  CDGAPLLPLL++I+N+ FN
Sbjct  275  LFVFLSLPLLSKLRGIPFAELPSYFKSGAGCFLNLGAGKPSCDGAPLLPLLYIIINLAFN  334

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLL+ +K SSAVV+ L    SVPISV+I +LPLPYL   +SL P F++G AIL+ G+L+
Sbjct  335  ISLLNAVKTSSAVVASLLVMLSVPISVYILSLPLPYLPEGTSLSPFFLLGCAILLCGLLL  394

Query  314  Y  312
            Y
Sbjct  395  Y  395



>ref|XP_002869717.1| hypothetical protein ARALYDRAFT_492400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45976.1| hypothetical protein ARALYDRAFT_492400 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF  LP+Y+KDGA CF N G  I GCDGAP+LPLL++  N+ FNISLLHL+KIS
Sbjct  302  SNLKGIPFASLPSYLKDGAGCFFNTGAKISGCDGAPILPLLYIATNLAFNISLLHLVKIS  361

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA--WTPSLH  291
            SA+VS LA   SVP+SV++ + PLPYL   SSL   F +G  +LVLG+L+Y    TP+  
Sbjct  362  SAIVSSLAVMLSVPLSVYVMSKPLPYLPGGSSLSSNFTMGCIVLVLGLLLYNIPTTPTKQ  421

Query  290  MAKAS  276
              K S
Sbjct  422  HTKTS  426



>ref|XP_001754536.1| predicted protein [Physcomitrella patens]
 gb|EDQ80506.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFN  495
            +F+S++LP +    GIPF Q+P  +K+G  CF NLG+ + GC+GAPL+PLL+V+VNM FN
Sbjct  186  IFVSIILPVVFNARGIPFHQIPQSLKEGYMCFFNLGSGVSGCEGAPLVPLLYVVVNMAFN  245

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            IS L LLK  SA+VS L  T S+P++++ FTLP PYLGV  +LP GF +GAAILV G+  
Sbjct  246  ISSLSLLKHYSAIVSSLCVTLSIPLAIWAFTLPWPYLGVPPTLPSGFFLGAAILVTGLAT  305

Query  314  YA  309
            Y+
Sbjct  306  YS  307



>ref|XP_008775799.1| PREDICTED: crt homolog 3-like [Phoenix dactylifera]
Length=426

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S + GIPF +LP+Y+K GAACFLNLG  + GC GAPLLPLLF+ +NM FNISLL L+KIS
Sbjct  303  SNMRGIPFPELPSYIKSGAACFLNLGGNMTGCAGAPLLPLLFITMNMAFNISLLGLVKIS  362

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SA+V+ LA+T +VPIS++I +LPLPY+   +SL   FI+GAAI+VLG+++Y
Sbjct  363  SALVASLAATLAVPISIYILSLPLPYIPQGTSLNTYFIIGAAIVVLGLILY  413



>ref|XP_003602864.1| hypothetical protein MTR_3g099780 [Medicago truncatula]
Length=192

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 93/125 (74%), Gaps = 2/125 (2%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ L LP +S L GIPF QLP+Y+K GA CFLN+G  + GC+GAPLLPLL+V+ N+ FN
Sbjct  58   LFVLLFLPLISNLKGIPFVQLPSYLKSGAGCFLNIGAGKTGCEGAPLLPLLYVVTNLAFN  117

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYL-GVASSLPPGFIVGAAILVLGML  318
            ISLL++LK SSAVV+ L    SVPISV++ +LPLPYL    ++L P F++G AILV G+ 
Sbjct  118  ISLLNVLKSSSAVVASLMLMLSVPISVYVLSLPLPYLPEGGTTLSPFFLLGCAILVCGLY  177

Query  317  IYAWT  303
             Y  T
Sbjct  178  TYNTT  182



>ref|XP_004288863.2| PREDICTED: crt homolog 1-like [Fragaria vesca subsp. vesca]
Length=426

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFN  495
            +F+ + LPFLS + GIPF QLPTY+KDGA CFLN+G    GC+GAPLLPLL+++ N+ FN
Sbjct  293  LFVLIFLPFLSNMRGIPFTQLPTYLKDGAGCFLNMGGAASGCNGAPLLPLLYIVGNLLFN  352

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            I LL+++K SSAVV+ L    SVPIS+++ +LPLPYL   ++L P F+ G+AILV G+++
Sbjct  353  IFLLNVVKTSSAVVASLIVMLSVPISIYVLSLPLPYLQEGATLSPFFLFGSAILVSGLIL  412

Query  314  YA  309
            Y+
Sbjct  413  YS  414



>ref|XP_010943152.1| PREDICTED: crt homolog 3 [Elaeis guineensis]
Length=416

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S + GIPF +LP+Y+K GA CFLNLG  + GC+GAPLLPLLF+++NM FNISLL L+KIS
Sbjct  293  SNVKGIPFPELPSYIKSGATCFLNLGGNMTGCEGAPLLPLLFIMMNMAFNISLLGLVKIS  352

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMA  285
            SA+V+ LA+T +VPIS++I +LPLPY+   + L   FI+GAAI+VLG+++Y    S + +
Sbjct  353  SALVASLAATLAVPISIYILSLPLPYIPQGTCLNAYFIIGAAIVVLGLILYNLPQSANWS  412

Query  284  KAST  273
              S 
Sbjct  413  HKSD  416



>ref|XP_010061564.1| PREDICTED: crt homolog 1 [Eucalyptus grandis]
 gb|KCW68527.1| hypothetical protein EUGRSUZ_F02159 [Eucalyptus grandis]
Length=432

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 2/123 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF QLP Y+K+GA CFLN+G    GCDGAP LPL+FV  N+ FNISLL+L+KIS
Sbjct  311  SNLRGIPFAQLPQYLKEGAGCFLNIGANTTGCDGAPWLPLIFVTTNIMFNISLLNLVKIS  370

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMA  285
            SAVV+ L    SVPIS+++ + PLPYL   +SL P F++G  ILVLG+++Y   P   +A
Sbjct  371  SAVVASLTVMLSVPISIYVLSRPLPYLPEGASLSPFFVIGGIILVLGLVLYN-VPQRQVA  429

Query  284  KAS  276
            K+ 
Sbjct  430  KSD  432



>ref|NP_194177.2| CRT (chloroquine-resistance transporter)-like transporter 2 [Arabidopsis 
thaliana]
 ref|NP_001190820.1| CRT (chloroquine-resistance transporter)-like transporter 2 [Arabidopsis 
thaliana]
 gb|ABM06027.1| At4g24460 [Arabidopsis thaliana]
 gb|AEE84907.1| CRT (chloroquine-resistance transporter)-like transporter 2 [Arabidopsis 
thaliana]
 gb|AEE84908.1| CRT (chloroquine-resistance transporter)-like transporter 2 [Arabidopsis 
thaliana]
Length=431

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF  LP+Y+KDGA CF N G  I GCDGAP+LPLL++  N+ FNISLLHL+KIS
Sbjct  307  SNLKGIPFASLPSYLKDGAGCFFNTGAKISGCDGAPILPLLYISTNLAFNISLLHLVKIS  366

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA--WTPSLH  291
            SA+VS L    SVP++V+I + PLPYL   SSL   F +G  +LVLG+L+Y    TP+  
Sbjct  367  SAIVSSLTMMLSVPLAVYIMSKPLPYLPGGSSLSSNFTMGCIVLVLGLLLYNIPTTPTKQ  426

Query  290  MAKAS  276
              K S
Sbjct  427  HTKTS  431



>ref|XP_002527366.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35038.1| conserved hypothetical protein [Ricinus communis]
Length=429

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF QLP+Y+K GA C +N+G  + GCDGAP+LPLL++++NM FNIS+L+L+K+SSAVV
Sbjct  312  GIPFAQLPSYLKSGAGCLVNIGRNVPGCDGAPMLPLLYIMINMAFNISVLNLVKLSSAVV  371

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            S LA T SVPIS+++ +LPLPYL   S L P F++G+ ILVLG+++Y
Sbjct  372  SSLAVTLSVPISIYVLSLPLPYLPEGSGLSPFFLLGSMILVLGLVLY  418



>ref|XP_003522773.1| PREDICTED: crt homolog 1-like isoform X1 [Glycine max]
Length=406

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ L LP LS L GIPF QLP+Y K GA CFLNLG     C GAPLLPLL+VI+N+ FN
Sbjct  273  LFVLLSLPILSNLRGIPFDQLPSYFKSGAGCFLNLGADNPNCYGAPLLPLLYVIINLAFN  332

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            ISLL+ +K SSAVV+ L    SVPISV+I +LPLPYL   +SL P F+ G AIL+ G+ +
Sbjct  333  ISLLNAVKTSSAVVASLLVMLSVPISVYILSLPLPYLPEGTSLSPFFLFGGAILLCGLFL  392

Query  314  YAWT  303
            Y  T
Sbjct  393  YNTT  396



>ref|XP_008647667.1| PREDICTED: uncharacterized protein LOC100277036 isoform X1 [Zea 
mays]
 gb|ACN27362.1| unknown [Zea mays]
 gb|AFW74652.1| hypothetical protein ZEAMMB73_664224 [Zea mays]
Length=344

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            VF+ LLLPFLS L GI F +LP Y+  GA CFLN+      C GAP LPLLF++VNM FN
Sbjct  211  VFVFLLLPFLSNLRGIKFAELPAYLNGGAECFLNVAESPIDCGGAPFLPLLFIVVNMAFN  270

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            +SLL+L+K+SSA+V+ L +T +VPIS++I +LPLPY+   + L   FI+GA IL++G+++
Sbjct  271  VSLLNLVKMSSAIVASLTATSAVPISIYILSLPLPYIPHGTELSTSFIIGAVILLMGLIL  330

Query  314  YAW-TPSLHMAKAS  276
            Y     SL   KA 
Sbjct  331  YNLPQSSLKQLKAD  344



>ref|XP_008365244.1| PREDICTED: uncharacterized protein LOC103428888 [Malus domestica]
Length=446

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF QLP+Y+KDGA CFLN+G    GC+GAPLLPLL++  N+ FNISLL+++KIS
Sbjct  326  SNLRGIPFAQLPSYLKDGACCFLNIGAYTTGCNGAPLLPLLYIATNLFFNISLLNVVKIS  385

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            SAVV+ L    SVPIS+++ +LPLPY+   S+L P F+ G+A+LVLG+++Y+
Sbjct  386  SAVVASLIVMLSVPISIYVLSLPLPYMEGGSTLSPFFLFGSAVLVLGLILYS  437



>emb|CDY61009.1| BnaA01g35140D [Brassica napus]
Length=430

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF  L +Y+KDGA CF N G  I GCDGAPLLPLL++  N+ FNIS+LHL+KISSA+V
Sbjct  310  GIPFGSLLSYIKDGAGCFFNTGAKISGCDGAPLLPLLYIATNLAFNISVLHLVKISSAIV  369

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA--WTPSLHMAKA  279
            S LA   SVP+SV+I + PLPYL   +SL   F+VG+ +LVLG+L+Y    TP+    K 
Sbjct  370  SSLAVVLSVPLSVYIMSKPLPYLPGGTSLSSNFMVGSIVLVLGLLLYNIPTTPTKQDTKT  429

Query  278  S  276
            S
Sbjct  430  S  430



>ref|NP_001144179.1| uncharacterized protein LOC100277036 [Zea mays]
 gb|ACG38497.1| hypothetical protein [Zea mays]
Length=344

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            VF+ LLLPFLS L GI F +LP Y+  GA CFLN+      C GAP LPLLF++VNM FN
Sbjct  211  VFVFLLLPFLSNLRGIKFAELPAYLNGGAECFLNVAESPIDCGGAPFLPLLFIMVNMAFN  270

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            +SLL+L+K+SSA+V+ L +T +VPIS++I +LPLPY+   + L   FI+GA IL++G+++
Sbjct  271  VSLLNLVKMSSAIVASLTATSAVPISIYILSLPLPYIPHGTELSTSFIIGAVILLMGLIL  330

Query  314  YAW-TPSLHMAKAS  276
            Y     SL   KA 
Sbjct  331  YNLPQSSLKQLKAD  344



>ref|XP_008219232.1| PREDICTED: crt homolog 1 [Prunus mume]
Length=442

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            SKL GIPF QLP+Y+KDGA CFLN+G    GC+GAPLLPLL+V  N+ FNISLL ++KIS
Sbjct  319  SKLRGIPFAQLPSYLKDGAGCFLNIGADTSGCNGAPLLPLLYVGTNLFFNISLLSVVKIS  378

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            SAVV+ L    SVPIS++I +LPLPYL   ++L P F+ G+ +L+LG+++Y+
Sbjct  379  SAVVASLIVMLSVPISIYILSLPLPYLEAGATLSPFFLFGSTVLLLGLILYS  430



>ref|XP_002986821.1| hypothetical protein SELMODRAFT_182638 [Selaginella moellendorffii]
 gb|EFJ12151.1| hypothetical protein SELMODRAFT_182638 [Selaginella moellendorffii]
Length=442

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISS  462
            S + GIPF QLP Y+ DG+ACF N+G   GC GAPL+PLL+V VN+ FNIS L+LLK+SS
Sbjct  322  SNMRGIPFSQLPQYLLDGSACFFNIGG-SGCHGAPLIPLLYVAVNLAFNISALNLLKLSS  380

Query  461  AVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            AVVS L +T +VP S+++FTLPLP LG  +S+ PG   GA  LVLG+++Y
Sbjct  381  AVVSSLCTTLAVPASIWMFTLPLPLLGHPASITPGLYRGATTLVLGLVVY  430



>gb|AES73115.2| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=422

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 93/125 (74%), Gaps = 2/125 (2%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFN  495
            +F+ L LP +S L GIPF QLP+Y+K GA CFLN+G  + GC+GAPLLPLL+V+ N+ FN
Sbjct  288  LFVLLFLPLISNLKGIPFVQLPSYLKSGAGCFLNIGAGKTGCEGAPLLPLLYVVTNLAFN  347

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYL-GVASSLPPGFIVGAAILVLGML  318
            ISLL++LK SSAVV+ L    SVPISV++ +LPLPYL    ++L P F++G AILV G+ 
Sbjct  348  ISLLNVLKSSSAVVASLMLMLSVPISVYVLSLPLPYLPEGGTTLSPFFLLGCAILVCGLY  407

Query  317  IYAWT  303
             Y  T
Sbjct  408  TYNTT  412



>emb|CDP00923.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF QLP+Y+K GA C LN G T  GC+GAPLLPLL+V VN+ FNIS+LHL+KIS
Sbjct  327  SNLKGIPFSQLPSYLKSGAGCLLNAGSTGSGCEGAPLLPLLYVFVNICFNISVLHLVKIS  386

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SAVVS LA+  SVPIS+ I +LPLPYL    SL P F VG+ ILV+G+++Y
Sbjct  387  SAVVSSLAAMSSVPISICILSLPLPYLPEGVSLSPFFHVGSIILVMGLILY  437



>emb|CDY56575.1| BnaC01g41530D [Brassica napus]
Length=429

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF  L  Y++DGA CF N+G  I GC+GAP+LPLL++  N+ FNISLLHL+KIS
Sbjct  305  SNLKGIPFGSLLPYLRDGAGCFFNIGAKISGCEGAPILPLLYIATNLAFNISLLHLVKIS  364

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA--WTPSLH  291
            SA+VS L    SVPISV+I + PLPYL   +SL   F++G+ +LVLG+L+Y    TP+  
Sbjct  365  SAIVSSLTVMLSVPISVYIMSKPLPYLPGGTSLSSNFMIGSIVLVLGLLLYNIPTTPTKQ  424

Query  290  MAKAS  276
              K S
Sbjct  425  DTKTS  429



>gb|EYU36442.1| hypothetical protein MIMGU_mgv1a010446mg [Erythranthe guttata]
Length=312

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIP  + P+Y+K GAACF N+G    GCDG+P LPLL++I N+ FNIS+L+LLK S
Sbjct  189  SNLKGIPLSEFPSYLKSGAACFFNIGANTTGCDGSPTLPLLYIITNIAFNISVLNLLKYS  248

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWT  303
            SAVVS LA   SVPIS++I +LPLPYL   ++L P F++G+A+L++G+++Y ++
Sbjct  249  SAVVSSLAVMSSVPISIYILSLPLPYLSEGANLSPFFVLGSAVLMVGLIVYNFS  302



>ref|XP_007018275.1| CRT-like transporter 2 [Theobroma cacao]
 gb|EOY15500.1| CRT-like transporter 2 [Theobroma cacao]
Length=425

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF +LP+Y+K GAACFL  G    GC+GAPLLPLL+++ NM FNIS+L+LLKISSAVV
Sbjct  306  GIPFSELPSYLKSGAACFLKTGAGTSGCEGAPLLPLLYIVTNMVFNISVLNLLKISSAVV  365

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            S LA T SVPIS++I +LPLPYL   +SL P F+ G  ILV G+++Y
Sbjct  366  SSLAVTLSVPISIYILSLPLPYLPEGASLSPFFLFGTLILVSGLVLY  412



>gb|KDP41501.1| hypothetical protein JCGZ_15908 [Jatropha curcas]
Length=430

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF QLP Y+K GA CF+N G    GCDGAP LPLL++  NM FNISLL+L+KIS
Sbjct  309  SNLKGIPFAQLPLYLKSGAGCFVNTGGNTPGCDGAPWLPLLYIATNMAFNISLLNLVKIS  368

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SAVVS LA   SVPIS+++ +LPLPYL   +SL P F++G+ ILV G+++Y
Sbjct  369  SAVVSSLAVMLSVPISIYVLSLPLPYLPEGTSLSPLFMLGSVILVSGLVLY  419



>ref|XP_007222981.1| hypothetical protein PRUPE_ppa008968mg [Prunus persica]
 gb|EMJ24180.1| hypothetical protein PRUPE_ppa008968mg [Prunus persica]
Length=312

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF QLP+Y+KDGA CFLN+G    GC+GAPLLPLL++  N+ FNISLL ++KIS
Sbjct  189  SNLRGIPFAQLPSYLKDGAGCFLNIGADTSGCNGAPLLPLLYIGTNLFFNISLLSVVKIS  248

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            SAVV+ L    SVPIS++I +LPLPYL   ++L P F+ G+ +L+LG+++Y+
Sbjct  249  SAVVASLIVMLSVPISIYILSLPLPYLEAGATLSPFFLFGSTVLLLGLILYS  300



>gb|KJB58831.1| hypothetical protein B456_009G228500 [Gossypium raimondii]
Length=469

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF +LP+Y+K GAACFLNLG    GC+GAPLLPLL+++ NM FNIS+L+LLK+SSA+V
Sbjct  352  GIPFLELPSYLKGGAACFLNLGGETSGCEGAPLLPLLYIVTNMAFNISVLNLLKVSSAIV  411

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            + L  T SVP+S++I +LPLPYL   +SL P F+ G+ IL+ G+++Y
Sbjct  412  ASLTVTLSVPLSIYILSLPLPYLPNGASLSPFFLFGSLILMSGLVLY  458



>ref|XP_001763845.1| predicted protein [Physcomitrella patens]
 gb|EDQ71249.1| predicted protein [Physcomitrella patens]
Length=312

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNI  492
            F+S++LP +  + G+PF Q+   + +G  CF+N G+ I GC+GAPL+PLL+V+VNM FNI
Sbjct  187  FVSMILPVVFNVRGVPFHQVGQSLSEGYMCFVNYGSKISGCEGAPLVPLLYVVVNMSFNI  246

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
              L LLK  SA+VS L ST S+P+++++FT P PYLGV  SLP GF +GA ILV+G+ IY
Sbjct  247  CSLSLLKHYSAIVSSLCSTLSIPLAIWVFTFPWPYLGVPPSLPSGFFLGAGILVVGLAIY  306

Query  311  A  309
            +
Sbjct  307  S  307



>gb|KJB58832.1| hypothetical protein B456_009G228500 [Gossypium raimondii]
Length=445

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF +LP+Y+K GAACFLNLG    GC+GAPLLPLL+++ NM FNIS+L+LLK+SSA+V
Sbjct  328  GIPFLELPSYLKGGAACFLNLGGETSGCEGAPLLPLLYIVTNMAFNISVLNLLKVSSAIV  387

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            + L  T SVP+S++I +LPLPYL   +SL P F+ G+ IL+ G+++Y
Sbjct  388  ASLTVTLSVPLSIYILSLPLPYLPNGASLSPFFLFGSLILMSGLVLY  434



>ref|XP_009138072.1| PREDICTED: crt homolog 1 [Brassica rapa]
Length=430

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF  L  Y++DGA CF N G  I GC+GAP+LPLL++  N+ FNISLLHL+KIS
Sbjct  306  SNLKGIPFGSLLPYLRDGAGCFFNTGAKISGCEGAPILPLLYIATNLAFNISLLHLVKIS  365

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA--WTPSLH  291
            SA+VS L    SVP+SV+I + PLPYL   +SL   F++G+ +LVLG+L+Y    TP+  
Sbjct  366  SAIVSSLTVMLSVPLSVYIMSKPLPYLPGGTSLSSNFMIGSIVLVLGLLLYNIPTTPTKQ  425

Query  290  MAKAS  276
             AK S
Sbjct  426  DAKTS  430



>ref|XP_002969295.1| hypothetical protein SELMODRAFT_170659 [Selaginella moellendorffii]
 gb|EFJ29383.1| hypothetical protein SELMODRAFT_170659 [Selaginella moellendorffii]
Length=346

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISS  462
            S + GIPF QLP Y+ DG+ACF N+G   GC GAPL+PLL+V VN+ FNIS L+LLK+SS
Sbjct  226  SNMRGIPFSQLPQYLLDGSACFFNIGG-SGCHGAPLIPLLYVAVNLAFNISALNLLKLSS  284

Query  461  AVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            AVVS L +T +VP S+++FTLPLP LG   S+ PG   GA  LVLG+++Y
Sbjct  285  AVVSSLCTTLAVPASIWMFTLPLPLLGHPVSITPGLYRGATTLVLGLVVY  334



>ref|XP_011074278.1| PREDICTED: crt homolog 1-like [Sesamum indicum]
Length=431

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 88/111 (79%), Gaps = 3/111 (3%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF +LP+Y++ GAACFLN+G    GCDGAP+LP+L++I N+ FNIS+L+LLK SSAVV
Sbjct  312  GIPFSELPSYLRSGAACFLNIGANTTGCDGAPMLPILYIITNIAFNISVLNLLKYSSAVV  371

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY--AW  306
            S LA   SVPIS++I +LPLPYL    SL P F++G+ +L++G+++Y  +W
Sbjct  372  SSLAVMSSVPISIYILSLPLPYLPEGVSLSPFFVLGSVVLMVGLIVYNLSW  422



>gb|KHG30118.1| Crt [Gossypium arboreum]
Length=391

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVS  450
            GIPF +LP+Y+K GAACFLNLG   GC+GAPLLPLL++  NM FNIS+L+LLK+SSA+V+
Sbjct  278  GIPFLELPSYLKSGAACFLNLG---GCEGAPLLPLLYIATNMAFNISVLNLLKVSSAIVA  334

Query  449  CLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
             L  T SVP+S++I +LPLPYL   +SL P F+ G  IL+ G+++Y
Sbjct  335  SLTVTLSVPLSIYILSLPLPYLPNGASLSPFFLFGTLILMSGLVLY  380



>ref|XP_010448563.1| PREDICTED: crt homolog 2 [Camelina sativa]
Length=437

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF  L +Y+KDGA CF N G  I GCDGAP+LPLL++  N+ FN+S LHL+KIS
Sbjct  312  SNLKGIPFGSLLSYLKDGAGCFFNTGAKISGCDGAPILPLLYIATNLAFNMSYLHLVKIS  371

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMA  285
            SA+VS L    SVP+SV+I + PLPYL   SSL   F++G+ +LVLG+L+Y   P+  + 
Sbjct  372  SAIVSSLTVMLSVPLSVYIMSKPLPYLPGGSSLSSNFMIGSIVLVLGLLLYN-IPTTFLT  430

Query  284  KAST  273
            K  T
Sbjct  431  KQHT  434



>gb|EYU36446.1| hypothetical protein MIMGU_mgv1a023373mg [Erythranthe guttata]
Length=447

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIP  + P+Y+K GAACF N+G    GCDG+P LPLL++I N+ FNIS+L+LLK S
Sbjct  324  SNLKGIPLSEFPSYLKSGAACFFNIGANTTGCDGSPTLPLLYIITNIAFNISVLNLLKYS  383

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWT  303
            SAVVS LA   SVPIS++I +LPLPYL   ++L P F++G+A+L++G+++Y ++
Sbjct  384  SAVVSSLAVMSSVPISIYILSLPLPYLPEGANLSPFFVLGSAVLMVGLIVYNFS  437



>ref|XP_006413428.1| hypothetical protein EUTSA_v10025263mg [Eutrema salsugineum]
 gb|ESQ54881.1| hypothetical protein EUTSA_v10025263mg [Eutrema salsugineum]
Length=430

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF  L +Y+KDGA CF N G  I GCDGAP+LPLL++  N+ FNISLLHL+KIS
Sbjct  307  SNLKGIPFASLLSYLKDGAGCFFNTGAKISGCDGAPILPLLYIATNLAFNISLLHLVKIS  366

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA--WTPSLH  291
            SA+VS L    +VP+SV+I + PLPYL   +SL   F++G  +LVLG+L+Y    TP+  
Sbjct  367  SAIVSSLTMMLAVPLSVYIMSKPLPYLPGGTSLSSNFVMGCIVLVLGLLLYNIPTTPTKQ  426

Query  290  MAK  282
              K
Sbjct  427  DTK  429



>ref|XP_004238016.1| PREDICTED: crt homolog 1 isoform X1 [Solanum lycopersicum]
Length=430

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP+++K GA CF N+G  + GCDGAPLLPLL++  N+ FNIS L+L+KIS
Sbjct  308  SNLKGIPFSELPSFLKSGAGCFFNIGNNVSGCDGAPLLPLLYIFTNIAFNISALNLMKIS  367

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SAV+S L    SVP+S+++ ++PLPYL   SSL P F++G+A+L++G+++Y
Sbjct  368  SAVISSLVVMSSVPLSMYLLSMPLPYLPQGSSLSPFFLLGSAVLLIGLILY  418



>ref|XP_010320227.1| PREDICTED: crt homolog 1 isoform X2 [Solanum lycopersicum]
Length=418

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP+++K GA CF N+G  + GCDGAPLLPLL++  N+ FNIS L+L+KIS
Sbjct  296  SNLKGIPFSELPSFLKSGAGCFFNIGNNVSGCDGAPLLPLLYIFTNIAFNISALNLMKIS  355

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SAV+S L    SVP+S+++ ++PLPYL   SSL P F++G+A+L++G+++Y
Sbjct  356  SAVISSLVVMSSVPLSMYLLSMPLPYLPQGSSLSPFFLLGSAVLLIGLILY  406



>ref|XP_008347822.1| PREDICTED: uncharacterized protein LOC103410954 [Malus domestica]
Length=539

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF QLP+Y+KDGA CFLN+G    GC+GAPLLPLL++  N+ FNISLL+++KIS
Sbjct  428  SNLRGIPFAQLPSYLKDGACCFLNIGAYTTGCNGAPLLPLLYIATNLFFNISLLNVVKIS  487

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLG  324
            SAVV+ L    SVPIS+++ +LPLPY+   S+L P F+ G+A+LVLG
Sbjct  488  SAVVASLIVMLSVPISIYVLSLPLPYMEGGSTLSPFFLFGSAVLVLG  534



>ref|XP_006651138.1| PREDICTED: crt homolog 1-like [Oryza brachyantha]
Length=425

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIP  +LP Y+  GAACFLN+G  ++ C GAPLLPLLF+ VNM FNIS+L+L+K+S
Sbjct  302  SNLKGIPLTELPAYINRGAACFLNIGGNLKDCHGAPLLPLLFIAVNMAFNISVLNLVKMS  361

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            +A+V+ L +T +VP+S+++ +LPLPY+   ++L   F+ GA+ILV+G+LIY
Sbjct  362  TALVASLTATLAVPLSIYVLSLPLPYIPGGTNLSTSFLAGASILVVGLLIY  412



>ref|XP_010439030.1| PREDICTED: LOW QUALITY PROTEIN: crt homolog 2-like [Camelina 
sativa]
Length=434

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF  L +Y+KDGA CF N G  I GC+GA +LPLL++  N+ FNIS+LHL+KIS
Sbjct  309  SNLKGIPFGSLLSYLKDGAGCFFNTGAKISGCEGAHILPLLYIATNLAFNISILHLVKIS  368

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMA  285
            SA+VS L    SVP+SV+I + PLPYL   SSL   F++G+ +LVLG+L+Y   P+  + 
Sbjct  369  SAIVSSLTVMLSVPLSVYIMSKPLPYLPGGSSLSSNFMMGSIVLVLGLLLYN-IPTTSLT  427

Query  284  KAST  273
            K  T
Sbjct  428  KQHT  431



>gb|EYU36445.1| hypothetical protein MIMGU_mgv1a020365mg [Erythranthe guttata]
Length=439

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 93/121 (77%), Gaps = 2/121 (2%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQ--GCDGAPLLPLLFVIVNMGFN  495
            FI LLLP ++ + G+    LP+Y   GAACFLN+GT    GCDGAPLLPLL++I N+ FN
Sbjct  306  FIFLLLPVMANMKGMLLSDLPSYFTSGAACFLNIGTSTTIGCDGAPLLPLLYLISNILFN  365

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLI  315
            IS+L+LLK+S+A+V+ LA+  +VPIS+++ +LPLPYL    SL P F +G+AILV+G+++
Sbjct  366  ISVLNLLKVSNAIVASLAARAAVPISIYVLSLPLPYLPKGVSLSPFFHLGSAILVVGLIL  425

Query  314  Y  312
            Y
Sbjct  426  Y  426



>ref|XP_009795852.1| PREDICTED: crt homolog 1 isoform X1 [Nicotiana sylvestris]
Length=424

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP+++K GA CF N+G  I GCDGAPLLPLL++  N+ FNIS+L+L+KIS
Sbjct  302  SNLKGIPFSELPSFLKSGAGCFFNIGNNISGCDGAPLLPLLYIFTNIAFNISILNLVKIS  361

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            +AV+S L    SVP+S+++ ++PLPYL   S L P F++G+A+L++G+++Y
Sbjct  362  TAVISSLVVMSSVPLSMYLLSIPLPYLPEGSVLSPYFLLGSAVLLIGLILY  412



>ref|XP_009605243.1| PREDICTED: crt homolog 1-like [Nicotiana tomentosiformis]
Length=428

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP+++K GA CF N+G  I GCDGAPLLPLL++  N+ FNIS+L+L+KIS
Sbjct  306  SNLKGIPFSELPSFLKSGAGCFFNIGNNISGCDGAPLLPLLYIFTNIAFNISILNLVKIS  365

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            +AV+S L    SVP+S+++ ++PLPYL   S L P F++G+A+L++G+++Y
Sbjct  366  TAVISSLVVMSSVPLSMYLLSVPLPYLPEGSVLSPYFLLGSAVLLIGLIMY  416



>ref|XP_006338029.1| PREDICTED: crt homolog 3-like isoform X1 [Solanum tuberosum]
Length=430

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -3

Query  626  IPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVS  450
            IPF +LP+++K GA CF N+G  + GCDGAPLLPLL++  N+ FNIS+L+L+KISSAV+S
Sbjct  313  IPFSELPSFLKSGAGCFFNIGNNVSGCDGAPLLPLLYIFTNIAFNISVLNLMKISSAVIS  372

Query  449  CLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
             L    SVP+SV++ ++PLPYL   SSL P F++G+A+L++G+++Y
Sbjct  373  SLVVMSSVPLSVYLLSMPLPYLPQGSSLSPFFLLGSAVLLIGLILY  418



>ref|XP_010671420.1| PREDICTED: crt homolog 2 [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF QLP Y   G ACFLN+G    GC+GAPLLPLL+V  N+ FNI++L+LLKISSAVV
Sbjct  323  GIPFDQLPQYFASGGACFLNIGVNSAGCEGAPLLPLLYVASNIAFNIAVLNLLKISSAVV  382

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            S L +  SVPIS++I +LPLPYL  +SSL   F++G+ IL+LG+L+Y
Sbjct  383  SSLVTMVSVPISIYILSLPLPYLPESSSLGLYFVLGSVILMLGLLLY  429



>ref|XP_004501667.1| PREDICTED: crt homolog 2-like isoform X1 [Cicer arietinum]
Length=424

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 2/111 (2%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF QLP+Y+K GA CFLN+G  + GCDGAPLLPLL+V+ N+ FNISLL++LK SSAVV
Sbjct  304  GIPFVQLPSYLKSGAGCFLNIGAGKAGCDGAPLLPLLYVVTNLVFNISLLNVLKSSSAVV  363

Query  452  SCLASTFSVPISVFIFTLPLPYL-GVASSLPPGFIVGAAILVLGMLIYAWT  303
            + L    SVPISV+I +LPLPYL    ++L P F++G AILV G+ +Y  T
Sbjct  364  ASLMLMLSVPISVYILSLPLPYLPEGGTTLSPFFLLGCAILVCGLYLYNTT  414



>ref|XP_004501668.1| PREDICTED: crt homolog 2-like isoform X2 [Cicer arietinum]
Length=423

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 2/111 (2%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF QLP+Y+K GA CFLN+G  + GCDGAPLLPLL+V+ N+ FNISLL++LK SSAVV
Sbjct  303  GIPFVQLPSYLKSGAGCFLNIGAGKAGCDGAPLLPLLYVVTNLVFNISLLNVLKSSSAVV  362

Query  452  SCLASTFSVPISVFIFTLPLPYL-GVASSLPPGFIVGAAILVLGMLIYAWT  303
            + L    SVPISV+I +LPLPYL    ++L P F++G AILV G+ +Y  T
Sbjct  363  ASLMLMLSVPISVYILSLPLPYLPEGGTTLSPFFLLGCAILVCGLYLYNTT  413



>ref|XP_011458905.1| PREDICTED: LOW QUALITY PROTEIN: crt homolog 1-like [Fragaria 
vesca subsp. vesca]
Length=436

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S + GIPF QLPTY+KDGA CFLN+G    GC+GAPLLPLL+V  N+ FNISL++++KIS
Sbjct  313  SNMRGIPFAQLPTYLKDGAGCFLNIGAGASGCNGAPLLPLLYVATNLLFNISLMNVVKIS  372

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYA  309
            SAVVS L    SVPIS+++ +LPLPYL   ++L P F+ G+AILVLG+++Y+
Sbjct  373  SAVVSSLVVMLSVPISIYVLSLPLPYLEAGATLSPFFLFGSAILVLGLILYS  424



>ref|NP_001049282.1| Os03g0199000 [Oryza sativa Japonica Group]
 dbj|BAF11196.1| Os03g0199000, partial [Oryza sativa Japonica Group]
Length=156

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIP  +LP Y+  GAACFLN+G  ++ C GAPLLPLLF+ +NM FNIS+L+L+K+S
Sbjct  33   SNLKGIPLAELPAYINRGAACFLNIGGNLKDCHGAPLLPLLFIAMNMAFNISVLNLVKMS  92

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAI  336
            +A+V+ L +T +VP+S+++ +LPLPY+   ++L   F+VGAAI
Sbjct  93   TALVASLTATLAVPLSIYVLSLPLPYIPGGTNLSTSFLVGAAI  135



>gb|KFK29005.1| hypothetical protein AALP_AA7G076900 [Arabis alpina]
Length=426

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF  L  Y+K GA CF N+G  I GC+GAP+LPLL++  N+ FNISLLHL+KISSA+V
Sbjct  306  GIPFGSLLPYLKSGAGCFFNIGAKISGCEGAPILPLLYIATNLAFNISLLHLVKISSAIV  365

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            + LA   SVP+SV+I + PLPYL   +SL   F+ G  +LVLG+L+Y
Sbjct  366  ASLAVMLSVPLSVYIMSKPLPYLPGGTSLSSNFMTGNIVLVLGLLLY  412



>ref|XP_004962898.1| PREDICTED: crt homolog 1-like [Setaria italica]
Length=344

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GI F +LP Y+  GA CFLN+G     C GAP LPLLF++VNM FNI+LL+L+K+S
Sbjct  221  SNLRGIKFAELPGYLNGGAECFLNVGESPIDCGGAPFLPLLFIVVNMAFNIALLNLVKLS  280

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTP-SLHM  288
            SA+V+ L ST +VPIS++I +LPLPY+   + L   FI+GA +L++G+++Y     SL  
Sbjct  281  SALVASLTSTSAVPISIYILSLPLPYIPHGAELSTPFIIGAVVLLMGLILYNLPQLSLKQ  340

Query  287  AKAS  276
            +KA 
Sbjct  341  SKAD  344



>ref|XP_006852886.1| hypothetical protein AMTR_s00033p00216940 [Amborella trichopoda]
 gb|ERN14353.1| hypothetical protein AMTR_s00033p00216940 [Amborella trichopoda]
Length=408

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S   GI F +LPTY++ G ACF+N+G+ I GC+GAPLLPLL++  NM FN S+L+L+K S
Sbjct  285  SSFKGISFLELPTYLRSGVACFINVGSRISGCEGAPLLPLLYIAANMAFNTSVLNLVKNS  344

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SAVV+ L  T SVP+S++I + PLP +  A+ L   F+VG  +LVLG+++Y
Sbjct  345  SAVVASLTVTLSVPLSIYILSFPLPCIPQAARLTSSFVVGTIVLVLGLILY  395



>ref|XP_002468330.1| hypothetical protein SORBIDRAFT_01g043890 [Sorghum bicolor]
 gb|EER95328.1| hypothetical protein SORBIDRAFT_01g043890 [Sorghum bicolor]
Length=422

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF QLP Y+  GAACFLN+G  ++ C GAPLLPLL++ +NM FNIS+L+L+K+S
Sbjct  299  SNLKGIPFAQLPAYLNRGAACFLNVGGNLKDCHGAPLLPLLYITLNMAFNISILNLVKMS  358

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAA  339
            +AVV+ L ST +VP+S++I +LPLPYL   + L   F++G A
Sbjct  359  TAVVASLTSTLAVPLSIYILSLPLPYLPEGTDLSTSFLIGVA  400



>ref|XP_008444904.1| PREDICTED: uncharacterized protein LOC103488113 isoform X3 [Cucumis 
melo]
 ref|XP_008444905.1| PREDICTED: uncharacterized protein LOC103488113 isoform X3 [Cucumis 
melo]
Length=290

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIP  QLP+Y+  GA CFLN+G  + GC+GAPLLPLL+VI N+ FNI++L+++K  
Sbjct  167  SNLKGIPIAQLPSYLMHGAGCFLNVGARRPGCEGAPLLPLLYVITNLSFNITVLNVVKKF  226

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SAVV+ L    SVP+S++I +LPLP+L   +SL P F+ G+++LVLG+  Y
Sbjct  227  SAVVASLVVMLSVPVSIYILSLPLPFLPEGASLSPLFLTGSSMLVLGLAFY  277



>gb|AFW89349.1| hypothetical protein ZEAMMB73_630257 [Zea mays]
Length=468

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP Y+  GAACFLN+G  ++ C GAPLLPLL++ +NM FNIS+L+L+K+S
Sbjct  345  SNLKGIPFAELPAYLTRGAACFLNVGGNLKDCHGAPLLPLLYITLNMAFNISVLNLVKMS  404

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAA  339
            +AVV+ L ST +VP+S++I +LPLPYL   ++L   F++G A
Sbjct  405  TAVVASLTSTLAVPLSIYILSLPLPYLPEGTNLSASFLIGVA  446



>ref|XP_010254583.1| PREDICTED: crt homolog 2 [Nelumbo nucifera]
Length=434

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GI F +LP+Y+K GAACFLN+G    GC+GAPLLPLLF+ +NM FNIS+L L+KISSAVV
Sbjct  315  GISFAELPSYLKSGAACFLNIGANTTGCEGAPLLPLLFISINMAFNISVLSLVKISSAVV  374

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGF  354
            S LA+T +VP+S++I +L LPY+  +SSL P F
Sbjct  375  SSLATTLAVPLSIYILSLKLPYIPESSSLSPFF  407



>ref|XP_006664586.1| PREDICTED: crt homolog 1-like [Oryza brachyantha]
Length=347

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 82/107 (77%), Gaps = 1/107 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GI F +LP Y+  GA CFLN+  ++  C GAP LPLLF++VNM FNI+LL+L+K+SSA+V
Sbjct  228  GIKFAELPAYLNGGAECFLNVDDSLIDCGGAPFLPLLFILVNMAFNIALLNLVKMSSALV  287

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            + L +T +VPIS++I +LPLPY+   S L   FI+GA +L++G++IY
Sbjct  288  ASLTATSAVPISIYILSLPLPYIPHGSELSSSFILGAVVLLMGLIIY  334



>ref|NP_001144440.1| uncharacterized protein LOC100277401 [Zea mays]
 gb|ACG40571.1| hypothetical protein [Zea mays]
Length=426

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP Y+  GAACFLN+G  ++ C GAPLLPLL++ +NM FNIS+L+L+K+S
Sbjct  303  SNLKGIPFAELPAYLTRGAACFLNVGGNLKDCHGAPLLPLLYITLNMAFNISVLNLVKMS  362

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAA  339
            +AVV+ L ST +VP+S++I +LPLPYL   ++L   F++G A
Sbjct  363  TAVVASLTSTLAVPLSIYILSLPLPYLPEGTNLSASFLIGVA  404



>ref|XP_008444902.1| PREDICTED: crt homolog 1 isoform X1 [Cucumis melo]
Length=449

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 2/124 (2%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIP  QLP+Y+  GA CFLN+G  + GC+GAPLLPLL+VI N+ FNI++L+++K  
Sbjct  326  SNLKGIPIAQLPSYLMHGAGCFLNVGARRPGCEGAPLLPLLYVITNLSFNITVLNVVKKF  385

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWT-PSLHM  288
            SAVV+ L    SVP+S++I +LPLP+L   +SL P F+ G+++LVLG+  Y    PS   
Sbjct  386  SAVVASLVVMLSVPVSIYILSLPLPFLPEGASLSPLFLTGSSMLVLGLAFYYIPLPSKRE  445

Query  287  AKAS  276
            AK  
Sbjct  446  AKTD  449



>gb|EEC74695.1| hypothetical protein OsI_10400 [Oryza sativa Indica Group]
Length=423

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIP  +LP Y+  GAACFLN+G  ++ C GAPLLPLLF+ +NM FNIS+L+L+K+S
Sbjct  300  SNLKGIPLAELPAYINRGAACFLNIGGNLKDCHGAPLLPLLFIAMNMAFNISVLNLVKMS  359

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAI  336
            +A+V+ L +T +VP+S+++ +LPLPY+   ++L   F+VGAAI
Sbjct  360  TALVASLTATLAVPLSIYVLSLPLPYIPGGTNLSTSFLVGAAI  402



>ref|XP_011074279.1| PREDICTED: uncharacterized protein LOC105159044 [Sesamum indicum]
Length=460

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNI  492
            F+ L LP LS L GIP  +LPT +K GAACFLN+GT   GCDGAPLLPLL+VI N+ FNI
Sbjct  327  FVLLFLPILSNLKGIPLSELPTILKSGAACFLNIGTNTTGCDGAPLLPLLYVISNLLFNI  386

Query  491  SLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            S+L+LLK+S A+V+ LA+  +VPI++++ +LPLPYL     L P F +G+AILVLG+++Y
Sbjct  387  SILNLLKVSDAIVASLAARSAVPIAMYLLSLPLPYLPQGVRLSPFFHLGSAILVLGLILY  446

Query  311  --AWTPSLHMAK  282
              +W      ++
Sbjct  447  NMSWPSKDRHSR  458



>ref|XP_004985325.1| PREDICTED: crt homolog 1-like isoform X2 [Setaria italica]
Length=420

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP Y+  GAACFLN+G  ++ C GAPLLPLL++ +NM FNIS L+L+K+S
Sbjct  297  SNLKGIPFAELPAYLNRGAACFLNIGGNLKECHGAPLLPLLYITLNMAFNISALNLVKMS  356

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAA  339
            +AVV+ L ST +VP+++++ +LPLP+L   ++L   F++GAA
Sbjct  357  TAVVASLTSTLAVPLTIYVLSLPLPFLPEGTNLSTPFVIGAA  398



>ref|XP_004985324.1| PREDICTED: crt homolog 1-like isoform X1 [Setaria italica]
Length=421

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP Y+  GAACFLN+G  ++ C GAPLLPLL++ +NM FNIS L+L+K+S
Sbjct  298  SNLKGIPFAELPAYLNRGAACFLNIGGNLKECHGAPLLPLLYITLNMAFNISALNLVKMS  357

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAA  339
            +AVV+ L ST +VP+++++ +LPLP+L   ++L   F++GAA
Sbjct  358  TAVVASLTSTLAVPLTIYVLSLPLPFLPEGTNLSTPFVIGAA  399



>ref|NP_001066868.1| Os12g0511300 [Oryza sativa Japonica Group]
 gb|ABA99044.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29887.1| Os12g0511300 [Oryza sativa Japonica Group]
 dbj|BAG98949.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53296.1| hypothetical protein OsJ_36259 [Oryza sativa Japonica Group]
Length=343

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GI F +LP Y+  GA CFLN+  ++  C GAP LPLLF++VNM FNI+LL+L+K+SSA+V
Sbjct  224  GIKFAELPAYLNGGAECFLNVDDSLIDCGGAPFLPLLFILVNMAFNIALLNLVKLSSALV  283

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            + L +T +VPIS++I +LPLPY+   + L   FI+G  +L++G++IY
Sbjct  284  ASLTATSAVPISIYILSLPLPYIPHGAELSSSFILGGVVLLMGLIIY  330



>gb|EEC69365.1| hypothetical protein OsI_38489 [Oryza sativa Indica Group]
Length=343

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GI F +LP Y+  GA CFLN+  ++  C GAP LPLLF++VNM FNI+LL+L+K+SSA+V
Sbjct  224  GIKFAELPAYLNGGAECFLNVDDSLIDCGGAPFLPLLFILVNMAFNIALLNLVKMSSALV  283

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            + L +T +VPIS++I +LPLPY+   + L   FI+G  +L++G++IY
Sbjct  284  ASLTATSAVPISIYILSLPLPYIPHGAELSSSFILGGVVLLMGLIIY  330



>ref|XP_004152605.1| PREDICTED: crt homolog 1-like [Cucumis sativus]
 ref|XP_004165132.1| PREDICTED: crt homolog 1-like [Cucumis sativus]
 gb|KGN62740.1| hypothetical protein Csa_2G370400 [Cucumis sativus]
Length=449

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIP  +LP+Y+  GA CFLN+G  + GC+GAPLLPLL+VI+N+ FNI++L+++K  
Sbjct  326  SNLKGIPIAKLPSYLMHGAGCFLNVGARRSGCEGAPLLPLLYVIINLAFNITVLNVVKKF  385

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            SAVV+ L    SVP+S++I +LPLP+L   + L P F++G+ +LVLG+  Y
Sbjct  386  SAVVASLVVMLSVPVSIYILSLPLPFLPEGARLSPLFMIGSLMLVLGLAFY  436



>dbj|BAJ93958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIP  +LP YVK GAACFLN+G  +  C GAPLLPLLF+ +NM FNIS+L+L+K+S+A+V
Sbjct  40   GIPLTELPAYVKSGAACFLNVGGNLNDCPGAPLLPLLFITMNMAFNISVLNLVKMSTALV  99

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGF  354
            + L +T +VP+S+++ +LPLPY+   +SL   F
Sbjct  100  ASLTATLAVPLSIYVLSLPLPYMPGGTSLSTSF  132



>ref|XP_003576016.1| PREDICTED: crt homolog 1-like [Brachypodium distachyon]
Length=342

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GI   +L  Y+  GA CFLN+G ++  C GAP LPLLF++VNM FNISLL+L+K+SSA+V
Sbjct  224  GIKLAELSAYLNGGAECFLNVGESLIDCGGAPFLPLLFILVNMAFNISLLNLVKMSSALV  283

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMAKAS  276
            + L +T +VPIS++I +LPLPY+   + L   FI+G  +L+ G+++Y    S   +K  
Sbjct  284  ASLTATSAVPISIYILSLPLPYIPQGAKLSASFIIGGVVLLSGLILYNLPQSSKESKTD  342



>ref|XP_010542173.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
 ref|XP_010542174.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
 ref|XP_010542175.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
 ref|XP_010542176.1| PREDICTED: crt homolog 1 [Tarenaya hassleriana]
Length=399

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF  LP+Y+K G  CFLN G  I GC+GAPLLPLL++ +N+ FNISLL+L++ISSAVV
Sbjct  278  GIPFMSLPSYLKAGVGCFLNTGANISGCEGAPLLPLLYIAINLAFNISLLNLVRISSAVV  337

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAI  336
            S LA   SVP++V++ + PLPYL   ++L   F++G+ I
Sbjct  338  SSLAVMLSVPLAVYVLSHPLPYLPGGTNLSSYFMLGSFI  376



>gb|EMS60940.1| Crt-like protein 1 [Triticum urartu]
Length=344

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GI   +L  ++  GA CFLN+G     C GAP LPLLF+ VNM FNISLL+L+K+SSAVV
Sbjct  226  GIKLAELSGHLNGGAECFLNVGESPIDCGGAPFLPLLFIFVNMAFNISLLNLVKMSSAVV  285

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMAKAS  276
            + L +T +VPIS++I +LPLPY+   + L   FI+G  +L++G+++Y    S   +K  
Sbjct  286  ASLTATSAVPISIYILSLPLPYIPQGAELSASFILGGIVLLMGLILYNLPQSSKESKTD  344



>ref|XP_003561943.1| PREDICTED: crt homolog 3-like [Brachypodium distachyon]
Length=424

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIP  +LP YV  GAACFLN+G  +  C GAPLLPLLF+ +NM FNIS+L+L+K+S
Sbjct  301  SNLKGIPLAELPAYVNHGAACFLNIGGNLNDCHGAPLLPLLFITLNMAFNISVLNLVKMS  360

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGF  354
            +A+V+ L +T +VP+S+++ +LPLPY+   +SL   F
Sbjct  361  TALVASLTATLAVPLSIYVLSLPLPYMPGGTSLSTSF  397



>ref|XP_010099562.1| hypothetical protein L484_011568 [Morus notabilis]
 gb|EXB79628.1| hypothetical protein L484_011568 [Morus notabilis]
Length=417

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 12/110 (11%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISS  462
            S + GIPF QLP+Y++ G            CDG+PLLPLL++  N+ FNIS+L+L+K SS
Sbjct  311  SSMKGIPFAQLPSYLESG------------CDGSPLLPLLYIATNLMFNISVLNLVKTSS  358

Query  461  AVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIY  312
            AVVS LA   SVPIS++I ++PLPYL   S+L P F+ G+ ILVLG+++Y
Sbjct  359  AVVSSLAVMLSVPISIYILSIPLPYLPEGSTLSPYFLFGSLILVLGLILY  408



>gb|EMT28281.1| hypothetical protein F775_30487 [Aegilops tauschii]
Length=344

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLGTIQ-GCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GI   +L  ++  GA CFLN+G     C GAP LPLLF+ +NM FNISLL+L+K+SSAVV
Sbjct  226  GIKLAELSGHLNGGAECFLNVGESPIDCGGAPFLPLLFIFINMAFNISLLNLVKMSSAVV  285

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMAKAS  276
            + L +T +VPIS++I +LPLPY+   + L   FI+G  +L+ G+++Y    S   +K  
Sbjct  286  ASLTATSAVPISIYILSLPLPYIPQGAELSASFILGGMVLLTGLILYNLPQSSKESKTD  344



>gb|EMS45976.1| Crt-like protein 1 [Triticum urartu]
Length=260

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG--TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAV  456
            GIP  +LP YV  GAACFLN+G   +  C GAPLLPLLF+ +NM FNIS+L+L+K+S+A+
Sbjct  140  GIPLTELPAYVNRGAACFLNVGGGNLNDCPGAPLLPLLFITMNMAFNISVLNLVKMSTAL  199

Query  455  VSCLASTFSVPISVFIFTLPLPYLGVASSLPPGF  354
            V+ L +T +VP+S+++ +LPLPY+   +SL   F
Sbjct  200  VASLTATLAVPLSIYVLSLPLPYMPGGTSLSTSF  233



>gb|KDO81242.1| hypothetical protein CISIN_1g014092mg [Citrus sinensis]
Length=431

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP Y+K GA C LNLG    GC+GAPLLPLL++  NM FNIS+L L+KIS
Sbjct  308  SNLKGIPFAELPLYLKSGAGCLLNLGANTSGCNGAPLLPLLYIATNMAFNISMLRLMKIS  367

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAI  336
            SAVVS L    SVPI++++ +LPLPYL   +SL P F+ G+ I
Sbjct  368  SAVVSSLVVMLSVPIAIYVLSLPLPYLPEGASLSPFFLFGSVI  410



>gb|EMT20926.1| hypothetical protein F775_01320 [Aegilops tauschii]
Length=341

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 71/94 (76%), Gaps = 2/94 (2%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG--TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAV  456
            GIP  +LP YV  GAACFLN+G   +  C GAPLLPLLF+ +NM FNIS+L+L+K+S+A+
Sbjct  221  GIPLTELPAYVNRGAACFLNVGGGNLNDCPGAPLLPLLFITMNMAFNISVLNLVKMSTAL  280

Query  455  VSCLASTFSVPISVFIFTLPLPYLGVASSLPPGF  354
            V+ L +T +VP+S+++ +LPLPY+   +SL   F
Sbjct  281  VASLTATLAVPLSIYVLSLPLPYMPGGTSLSTSF  314



>ref|XP_006433790.1| hypothetical protein CICLE_v10000856mg [Citrus clementina]
 gb|ESR47030.1| hypothetical protein CICLE_v10000856mg [Citrus clementina]
Length=523

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP Y+K GA C LNLG    GC+GAPLLPLL++  NM FNIS+L L+KIS
Sbjct  400  SNLKGIPFAELPLYLKSGAGCLLNLGANTSGCNGAPLLPLLYIATNMAFNISMLRLMKIS  459

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAI  336
            SAVVS L    SVPI++++ +LPLPYL   +SL P F+ G+ I
Sbjct  460  SAVVSSLVVMLSVPIAIYVLSLPLPYLPEGASLSPFFLFGSVI  502



>ref|XP_006472425.1| PREDICTED: crt homolog 1-like isoform X2 [Citrus sinensis]
Length=424

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP Y+K GA C LNLG    GC+GAPLLPLL++  NM FNIS+L L+KIS
Sbjct  301  SNLKGIPFAELPLYLKSGAGCLLNLGANTSGCNGAPLLPLLYIATNMAFNISMLRLMKIS  360

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAI  336
            SAVVS L    SVP+++++ +LPLPYL   +SL P F+ G+ I
Sbjct  361  SAVVSSLVVMLSVPLAIYVLSLPLPYLPEGASLSPFFLFGSVI  403



>ref|XP_006472424.1| PREDICTED: crt homolog 1-like isoform X1 [Citrus sinensis]
Length=431

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP Y+K GA C LNLG    GC+GAPLLPLL++  NM FNIS+L L+KIS
Sbjct  308  SNLKGIPFAELPLYLKSGAGCLLNLGANTSGCNGAPLLPLLYIATNMAFNISMLRLMKIS  367

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAI  336
            SAVVS L    SVP+++++ +LPLPYL   +SL P F+ G+ I
Sbjct  368  SAVVSSLVVMLSVPLAIYVLSLPLPYLPEGASLSPFFLFGSVI  410



>ref|XP_006472426.1| PREDICTED: crt homolog 1-like isoform X3 [Citrus sinensis]
Length=381

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            GIPF +LP Y+K GA C LNLG    GC+GAPLLPLL++  NM FNIS+L L+KISSAVV
Sbjct  262  GIPFAELPLYLKSGAGCLLNLGANTSGCNGAPLLPLLYIATNMAFNISMLRLMKISSAVV  321

Query  452  SCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAI  336
            S L    SVP+++++ +LPLPYL   +SL P F+ G+ I
Sbjct  322  SSLVVMLSVPLAIYVLSLPLPYLPEGASLSPFFLFGSVI  360



>ref|XP_002283727.1| PREDICTED: crt homolog 1 [Vitis vinifera]
 emb|CBI19288.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S   GIPF QLP+Y+K GA CFLN+G+ I GCDGAPLLPLL++  N+ FNISLL+L+KIS
Sbjct  302  SNFRGIPFPQLPSYLKAGAGCFLNIGSNIPGCDGAPLLPLLYLATNIAFNISLLNLVKIS  361

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGF  354
            SAVVS LA+  SVPIS+++ +LPLPYL   +SL P F
Sbjct  362  SAVVSTLAAMASVPISIYVLSLPLPYLPQGASLSPFF  398



>emb|CAN72155.1| hypothetical protein VITISV_019018 [Vitis vinifera]
Length=478

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S   GIPF QLP+Y+K GA CFLN+G+ I GCDGAPLLPLL++  N+ FNISLL+L+KIS
Sbjct  358  SNFRGIPFPQLPSYLKAGAGCFLNIGSNIPGCDGAPLLPLLYLATNIAFNISLLNLVKIS  417

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGF  354
            SAVVS LA+  SVPIS+++ +LPLPYL   +SL P F
Sbjct  418  SAVVSTLAAMASVPISIYVLSLPLPYLPQGASLSPFF  454



>emb|CAB45081.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79356.1| hypothetical protein [Arabidopsis thaliana]
Length=380

 Score = 95.5 bits (236),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLG-TIQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF  LP+Y+KDGA CF N G  I GCDGAP+LPLL++  N+ FNISLLHL+KIS
Sbjct  280  SNLKGIPFASLPSYLKDGAGCFFNTGAKISGCDGAPILPLLYISTNLAFNISLLHLVKIS  339

Query  464  SAVVSCLASTFSVP  423
            SA+VS L    S P
Sbjct  340  SAIVSSLTMMLSGP  353


 Score = 30.8 bits (68),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = -1

Query  736  ARKLKGGTVDLXVVNTFGSTFQ  671
            A++L+G ++D+ VVN+FGS FQ
Sbjct  247  AKRLEGKSLDIFVVNSFGSGFQ  268



>gb|KHN08288.1| Crt like 3 [Glycine soja]
Length=308

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -3

Query  560  IQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLG  381
            +  C GAPLLPLL+VI+N+ FNISLL+ +K SSAVV+ L    SVPISV+I +LPLPYL 
Sbjct  213  VSDCYGAPLLPLLYVIINLAFNISLLNAVKTSSAVVASLLVMLSVPISVYILSLPLPYLP  272

Query  380  VASSLPPGFIVGAAILVLGMLIYAWT  303
              +SL P F+ G AIL+ G+ +Y  T
Sbjct  273  EGTSLSPFFLFGGAILLCGLFLYNTT  298



>ref|XP_010320228.1| PREDICTED: crt homolog 3 isoform X3 [Solanum lycopersicum]
Length=393

 Score = 88.2 bits (217),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGT-IQGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            S L GIPF +LP+++K GA CF N+G  + GCDGAPLLPLL++  N+ FNIS L+L+KIS
Sbjct  308  SNLKGIPFSELPSFLKSGAGCFFNIGNNVSGCDGAPLLPLLYIFTNIAFNISALNLMKIS  367

Query  464  SAVVSCL  444
            SAV+S L
Sbjct  368  SAVISSL  374


 Score = 30.4 bits (67),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  736  ARKLKGGTVDLXVVNTFGSTFQ  671
            A +LKG  +D+ VVN+FGS FQ
Sbjct  275  ASRLKGKVLDIFVVNSFGSGFQ  296



>ref|XP_002526058.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36335.1| conserved hypothetical protein [Ricinus communis]
Length=73

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  430  ENVDARQDTTAEEILSRCNNDILKPMLTMTNSNGNKGAPSHPCIVPRFKKQAAPSFTY  603
            ENV+AR+DTTAE+IL RCNND+LKPMLT TNS G++GAPSHP      KK    S  Y
Sbjct  8    ENVEAREDTTAEDILRRCNNDMLKPMLTRTNSKGSRGAPSHPAGSQIRKKSNGMSIGY  65



>gb|KJB35700.1| hypothetical protein B456_006G124500 [Gossypium raimondii]
Length=351

 Score = 67.0 bits (162),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLG  564
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+G
Sbjct  308  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNIG  343


 Score = 36.6 bits (83),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -1

Query  736  ARKLKGGTVDLXVVNTFGSTFQFL  665
            A++LKGG++DL VVN++GS FQ L
Sbjct  285  AQRLKGGSIDLFVVNSYGSAFQAL  308



>gb|KEH17262.1| CRT (chloroquine-resistance transporter)-like transporter, putative 
[Medicago truncatula]
Length=345

 Score = 67.4 bits (163),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI  558
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+G +
Sbjct  295  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNIGKL  332


 Score = 35.8 bits (81),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -1

Query  733  RKLKGGTVDLXVVNTFGSTFQFL  665
            +KLKGG++DL VVN+FGS FQ L
Sbjct  273  QKLKGGSLDLFVVNSFGSAFQAL  295



>gb|KJB83546.1| hypothetical protein B456_013G253300 [Gossypium raimondii]
Length=379

 Score = 67.4 bits (163),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLG  564
            +FI LLLPFLSKLWGIPF QLP Y+KDGAACFLN+G
Sbjct  310  LFICLLLPFLSKLWGIPFSQLPNYLKDGAACFLNMG  345


 Score = 35.8 bits (81),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -1

Query  733  RKLKGGTVDLXVVNTFGSTFQFL  665
            ++LKGG+VDL VVN++GS FQ L
Sbjct  288  KRLKGGSVDLFVVNSYGSAFQAL  310



>ref|XP_002526057.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36334.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score = 65.1 bits (157),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLG  564
            +FI LLLPF+SKLWG+PF QLP+Y+KDGA CFLN+G
Sbjct  232  LFICLLLPFMSKLWGVPFGQLPSYLKDGAVCFLNMG  267


 Score = 36.6 bits (83),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -1

Query  736  ARKLKGGTVDLXVVNTFGSTFQFL  665
            A++LKGG+VD+ VVN++GS FQ L
Sbjct  209  AKRLKGGSVDIFVVNSYGSAFQAL  232



>ref|XP_005650231.1| hypothetical protein COCSUDRAFT_64779 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25687.1| hypothetical protein COCSUDRAFT_64779 [Coccomyxa subellipsoidea 
C-169]
Length=487

 Score = 75.9 bits (185),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 5/132 (4%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNL--GTIQGCDGAPLLPLLFVIVNMGF  498
             F+ LLLP L+ L GI   +LP Y+ +G  C   +       C  APL+   +V  N+G 
Sbjct  347  AFVFLLLPGLAALRGINPGELPQYLTEGFQCLRGITPDCAGDCSRAPLIATAYVACNLGL  406

Query  497  NISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGML  318
            NISLL LL+ +  VV  L+    +P++++ FT P P L  +  L P F++G  I++ G+L
Sbjct  407  NISLLALLRQAGNVVQSLSMQTVIPLTIWAFTFPWPLLDPSPPLGPKFVLGTGIMLSGLL  466

Query  317  IY---AWTPSLH  291
             Y    W P L 
Sbjct  467  TYNSAQWLPILQ  478


 Score = 25.0 bits (53),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -1

Query  733  RKLKGGTVDLXVVNTFGSTFQ  671
            +KL G  +D+ VVN+FGS  Q
Sbjct  325  QKLGGKQLDIFVVNSFGSAAQ  345



>ref|XP_002526059.1| hypothetical protein RCOM_1478870 [Ricinus communis]
 gb|EEF36336.1| hypothetical protein RCOM_1478870 [Ricinus communis]
Length=58

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  431  SVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTP  300
            +VPISV++FTLPLP+LGVASSLP GF+ GA +LVLG+LIYAWTP
Sbjct  2    AVPISVYVFTLPLPFLGVASSLPTGFVAGAIVLVLGLLIYAWTP  45



>gb|KDO54776.1| hypothetical protein CISIN_1g0128212mg, partial [Citrus sinensis]
Length=108

 Score = 67.4 bits (163),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTI  558
            +FI LLLPFLSKLWGIPF QLP Y++DGAACFLNLGT+
Sbjct  63   LFICLLLPFLSKLWGIPFSQLPIYLRDGAACFLNLGTL  100


 Score = 31.2 bits (69),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 1/24 (4%)
 Frame = -1

Query  736  ARKLKGGTVDLXVVNTFGSTFQFL  665
            A++LKGG VDL VVN++GS FQ L
Sbjct  41   AQRLKGG-VDLFVVNSYGSAFQAL  63



>gb|KCW68526.1| hypothetical protein EUGRSUZ_F02159 [Eucalyptus grandis]
Length=390

 Score = 66.2 bits (160),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 58/122 (48%), Gaps = 42/122 (34%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISS  462
            S L GIPF QLP Y+K+GA CFLN+G                                  
Sbjct  311  SNLRGIPFAQLPQYLKEGAGCFLNIG----------------------------------  336

Query  461  AVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMAK  282
                   +  +VPIS+++ + PLPYL   +SL P F++G  ILVLG+++Y   P   +AK
Sbjct  337  -------ANTTVPISIYVLSRPLPYLPEGASLSPFFVIGGIILVLGLVLYN-VPQRQVAK  388

Query  281  AS  276
            + 
Sbjct  389  SD  390


 Score = 30.4 bits (67),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  736  ARKLKGGTVDLXVVNTFGSTFQ  671
            AR+LK  ++D+ VVN+FGS FQ
Sbjct  278  ARRLKEKSLDIFVVNSFGSGFQ  299



>ref|XP_002955483.1| hypothetical protein VOLCADRAFT_96374 [Volvox carteri f. nagariensis]
 gb|EFJ43554.1| hypothetical protein VOLCADRAFT_96374 [Volvox carteri f. nagariensis]
Length=340

 Score = 58.5 bits (140),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 15/133 (11%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNL--GTIQGCD------------GAPLL  531
            F+ LLLP ++ + G     LPT++      F       + G                PL+
Sbjct  185  FVLLLLPVMTAVKGTALADLPTHLAASLRVFAGNVPPEVSGVTGAAAAGGWWVPYTVPLV  244

Query  530  PLLFVIVNMGFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFI  351
             L +V++N+ FNIS+L LL+   +V + L ++  VP+++  FTLPLPYL  A  + P F+
Sbjct  245  ALSYVVMNLVFNISILTLLRSVGSVTTTLVASSLVPLTIAAFTLPLPYLEPA-LIGPNFV  303

Query  350  VGAAILVLGMLIY  312
            VGA++L+ G++ Y
Sbjct  304  VGASLLMAGLVTY  316


 Score = 26.9 bits (58),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = -1

Query  730  KLKGGTVDLXVVNTFGSTFQ  671
             + G T+D+ VVN+FGS FQ
Sbjct  163  AVHGRTLDIFVVNSFGSLFQ  182



>gb|AEW09112.1| hypothetical protein CL4012Contig1_03, partial [Pinus radiata]
Length=44

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  407  FTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMAKAS  276
            FTLPLPYLGV  +LPPGF+VGAA+LV+G+ +Y    ++   K  
Sbjct  1    FTLPLPYLGVDCTLPPGFLVGAAVLVIGLFVYNLPHAMEATKVQ  44



>gb|AFG66928.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66929.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66931.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66932.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66933.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66934.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66935.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66936.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66937.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66938.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66939.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66940.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66941.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66942.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66943.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
 gb|AFG66944.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
Length=44

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = -3

Query  407  FTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMAKAST  273
            FTLPLPYLGV  +LPPGF+VGAA+LV+G+ +Y      H A+A+ 
Sbjct  1    FTLPLPYLGVDCTLPPGFLVGAAVLVIGLFVYNLP---HAAEATK  42



>gb|AFG66930.1| hypothetical protein CL4012Contig1_03, partial [Pinus taeda]
Length=44

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  407  FTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMAKAS  276
            FTLPLPYLGV  +LPPGF+VGAA+LV+G+ +Y    ++   K  
Sbjct  1    FTLPLPYLGVDCTLPPGFLVGAAVLVIGLFVYNLPHAVEATKVQ  44



>ref|XP_011396396.1| hypothetical protein F751_4405 [Auxenochlorella protothecoides]
 gb|KFM23523.1| hypothetical protein F751_4405 [Auxenochlorella protothecoides]
Length=258

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNLGTIQGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVVS  450
            GIP   LP Y+ +G + F  L    G  GAP+LPLL++  N+ FNI+ L+L++ +  V++
Sbjct  133  GIPLSGLPGYLAEGWSVFWGLAG--GATGAPMLPLLYIGANLAFNIAALNLVRSAGNVIT  190

Query  449  CLASTFSVPISVFIFT  402
             L     VP +++ FT
Sbjct  191  SLVMASIVPFTIYAFT  206



>ref|XP_008647668.1| PREDICTED: uncharacterized protein LOC100277036 isoform X2 [Zea 
mays]
 ref|XP_008647669.1| PREDICTED: uncharacterized protein LOC100277036 isoform X2 [Zea 
mays]
Length=338

 Score = 46.2 bits (108),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGT  561
            VF+ LLLPFLS L GI F +LP Y+  GA CFLN+  
Sbjct  211  VFVFLLLPFLSNLRGIKFAELPAYLNGGAECFLNVAE  247


 Score = 30.0 bits (66),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = -1

Query  736  ARKLKGGTVDLXVVNTFGSTFQ  671
            A++LKG   D+ VVN+FGS FQ
Sbjct  188  AKRLKGKRPDIFVVNSFGSGFQ  209



>gb|KCW68528.1| hypothetical protein EUGRSUZ_F02159 [Eucalyptus grandis]
Length=365

 Score = 44.7 bits (104),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  641  SKLWGIPFFQLPTYVKDGAACFLNLGTIQGCDG  543
            S L GIPF QLP Y+K+GA CFLN+G     +G
Sbjct  311  SNLRGIPFAQLPQYLKEGAGCFLNIGANTTDEG  343


 Score = 30.4 bits (67),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = -1

Query  736  ARKLKGGTVDLXVVNTFGSTFQ  671
            AR+LK  ++D+ VVN+FGS FQ
Sbjct  278  ARRLKEKSLDIFVVNSFGSGFQ  299



>ref|XP_004341623.1| transmembrane protein [Acanthamoeba castellanii str. Neff]
 gb|ELR19537.1| transmembrane protein [Acanthamoeba castellanii str. Neff]
Length=513

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 61/118 (52%), Gaps = 7/118 (6%)
 Frame = -3

Query  629  GIPFFQLPTYVKDGAACFLNL-------GTIQGCDGAPLLPLLFVIVNMGFNISLLHLLK  471
            G+ F ++P  ++DGA C             +  C+ A  + L ++I N+ +NI +L +LK
Sbjct  301  GLTFSEIPDNLEDGARCLFTGHNSITTGKNVDDCEWAWTMTLGYIIANIAYNIVILLMLK  360

Query  470  ISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPS  297
              SA +  +AS   +P++   FTL       A++L P  I G  ++++G++IY  T  
Sbjct  361  YGSAALLYVASAVVLPLANIAFTLDFIMGKEATTLSPYDIAGLVVILIGLVIYRSTSE  418



>gb|KIZ05413.1| hypothetical protein MNEG_2548 [Monoraphidium neglectum]
Length=280

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 66/126 (52%), Gaps = 4/126 (3%)
 Frame = -3

Query  671  VFISLLLPFLSKLWGIPFFQLPTYVKDGAACFLNLGTIQGCD---GAPLLPLLFVIVNMG  501
            VF+  LLP ++ + G+P   LP  + +G           G     GAPL P  +V+ N+ 
Sbjct  148  VFVLALLPLITAIRGLPLESLPQVLLEGGRVLAGQPAQVGGAVLPGAPLFPAAYVLANVA  207

Query  500  FNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGM  321
            FNI+ L L++ + AV + LA    VP+SV  F LPLP L  A +L P F  G  +L+ G+
Sbjct  208  FNITALSLVRSTGAVTASLALACLVPLSVLAFALPLPLLQQA-ALGPNFWAGCGLLMGGL  266

Query  320  LIYAWT  303
              Y W 
Sbjct  267  ACYNWK  272



>ref|XP_001689582.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09320.1| predicted protein [Chlamydomonas reinhardtii]
Length=384

 Score = 51.6 bits (122),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 56/113 (50%), Gaps = 18/113 (16%)
 Frame = -3

Query  668  FISLLLPFLSKLWGIPFFQLPTYVKDGAACFLN------------------LGTIQGCDG  543
            F+ LLLP  + L GI    LP ++   +  FL                   L  +     
Sbjct  242  FVLLLLPITTALKGIALSDLPAHLMASSRAFLGEPSAAACAAFGGGADAGGLVGVLARHS  301

Query  542  APLLPLLFVIVNMGFNISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYL  384
             PLL L +V +N+ FN+++L+LL+   +V + L  +  VP+++  FTLPLPYL
Sbjct  302  TPLLALSYVALNLVFNVAMLNLLRSVGSVTTTLVGSSLVPLTIAAFTLPLPYL  354


 Score = 22.7 bits (47),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 1/22 (5%)
 Frame = -1

Query  736  ARKLKGGTVDLXVVNTFGSTFQ  671
            A+KL G  +D+ VVN+FGS  Q
Sbjct  219  AQKL-GQPLDIFVVNSFGSLAQ  239



>ref|XP_009824222.1| hypothetical protein H257_02337 [Aphanomyces astaci]
 gb|ETV85750.1| hypothetical protein H257_02337 [Aphanomyces astaci]
Length=360

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 8/124 (6%)
 Frame = -3

Query  626  IPFFQLPTYVKDGAACFLNLGTI------QGCDGAPLLPLLFVIVNMGFNISLLHLLKIS  465
            +P   LP  + DG  C++   TI        CD A L   ++++ N+G+N+ ++ +LK  
Sbjct  225  VPPRDLPQNLYDGMRCYMGHNTIVDGPHPDDCDKATLFVTIYILFNVGYNLLIILMLKFG  284

Query  464  SAVVSCLASTFSVPISVFIFTLPLPYLGVASSLPPGFIVGAAILVLGMLIYAWTPSLHMA  285
            SA +  LA T  VP+    FT   P++     L    +VG  +++ G+ +Y +   +  A
Sbjct  285  SANLLWLAMTIMVPLGNVAFT--FPFMPEHQPLHTTDVVGLVVIMTGLFVYRFLQDIVAA  342

Query  284  KAST  273
            + S+
Sbjct  343  RKSS  346



>ref|XP_004338113.1| transmembrane protein [Acanthamoeba castellanii str. Neff]
 gb|ELR16100.1| transmembrane protein [Acanthamoeba castellanii str. Neff]
Length=481

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 64/118 (54%), Gaps = 5/118 (4%)
 Frame = -3

Query  626  IPFFQLPTYVKDGAACFLNLGTI--QGCDGAPLLPLLFVIVNMGFNISLLHLLKISSAVV  453
            + F ++  Y+ +GA+C +         C G P L +++V VN+ +NISLL LLK   AV 
Sbjct  332  VSFHEIGDYIPNGASCLVGFTPTPQDDCSGEPWLMMMYVCVNLSWNISLLLLLKKGGAVF  391

Query  452  SCLASTFSVPISVFIFTLPLPYLGVAS-SLPPGFIVGAAILVLGMLIYAWTPSLHMAK  282
            + + S  S+P+S F F +  P +G  + S   G  +G  ++ +G++IY +   +   K
Sbjct  392  TFIGSAVSLPLSHFAFAINWPIIGSGTVSWEDG--LGLGLVFVGLIIYRYYAVVQRKK  447



>ref|XP_005537125.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81089.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=436

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 55/97 (57%), Gaps = 8/97 (8%)
 Frame = -3

Query  665  ISLLLPFLSKLWGIPFF-QLPTYVKDGAACFLNLGTIQGCDGA--PLLPLLFVIVNMGFN  495
            ISL+LPF +     PF  +L      G      L T  G + +  P L L +V VN+ FN
Sbjct  311  ISLMLPFTT-----PFAARLAESPSIGDYFSSALSTFAGRESSWMPWLALAYVAVNIVFN  365

Query  494  ISLLHLLKISSAVVSCLASTFSVPISVFIFTLPLPYL  384
            I+ L LLKI+SA+ S +AS  SVP++  +F LP+P L
Sbjct  366  ITGLRLLKIASALDSVVASLISVPLTTLVFCLPVPLL  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500