BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019J14

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601250.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    361   2e-121   Nicotiana tomentosiformis
ref|XP_006364961.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    360   4e-121   Solanum tuberosum [potatoes]
ref|XP_009786663.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    360   5e-121   Nicotiana sylvestris
ref|XP_009601249.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    362   8e-121   Nicotiana tomentosiformis
emb|CAA06925.1|  Avr9 elicitor response protein                         361   2e-120   Nicotiana tabacum [American tobacco]
ref|XP_009786662.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    361   2e-120   Nicotiana sylvestris
ref|XP_011074895.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    360   4e-120   Sesamum indicum [beniseed]
ref|XP_004250351.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    360   5e-120   Solanum lycopersicum
ref|XP_006364960.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    360   6e-120   Solanum tuberosum [potatoes]
gb|EYU22897.1|  hypothetical protein MIMGU_mgv1a007777mg                358   2e-119   Erythranthe guttata [common monkey flower]
emb|CDP18301.1|  unnamed protein product                                355   5e-118   Coffea canephora [robusta coffee]
ref|XP_010095510.1|  Beta-1,3-galactosyltransferase 7                   353   2e-117   Morus notabilis
gb|KDP32735.1|  hypothetical protein JCGZ_12027                         352   6e-117   Jatropha curcas
ref|XP_010245068.1|  PREDICTED: beta-1,3-galactosyltransferase 7        352   6e-117   Nelumbo nucifera [Indian lotus]
gb|EYU23928.1|  hypothetical protein MIMGU_mgv1a007764mg                351   1e-116   Erythranthe guttata [common monkey flower]
ref|XP_003601132.1|  Avr9 elicitor response protein                     349   8e-116   Medicago truncatula
ref|XP_003601133.1|  Avr9 elicitor response protein                     349   1e-115   Medicago truncatula
ref|XP_008233932.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    349   1e-115   Prunus mume [ume]
ref|XP_008233934.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    349   1e-115   Prunus mume [ume]
ref|XP_008233933.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    348   2e-115   Prunus mume [ume]
ref|XP_011465327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    348   2e-115   Fragaria vesca subsp. vesca
ref|XP_007222961.1|  hypothetical protein PRUPE_ppa006755mg             348   2e-115   
ref|XP_004300420.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    348   2e-115   Fragaria vesca subsp. vesca
ref|XP_008233935.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    348   2e-115   Prunus mume [ume]
ref|XP_009367326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    348   2e-115   Pyrus x bretschneideri [bai li]
gb|KJB64380.1|  hypothetical protein B456_010G046600                    345   2e-115   Gossypium raimondii
ref|XP_009367325.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    348   2e-115   Pyrus x bretschneideri [bai li]
ref|XP_009367323.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    348   2e-115   Pyrus x bretschneideri [bai li]
ref|XP_009367324.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    348   2e-115   Pyrus x bretschneideri [bai li]
ref|XP_007136194.1|  hypothetical protein PHAVU_009G026100g             348   3e-115   Phaseolus vulgaris [French bean]
ref|XP_002302264.1|  galactosyltransferase family protein               347   4e-115   Populus trichocarpa [western balsam poplar]
gb|KHN26051.1|  Beta-1,3-galactosyltransferase 7                        345   5e-115   Glycine soja [wild soybean]
ref|XP_006578989.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    347   6e-115   Glycine max [soybeans]
gb|KHN47065.1|  Beta-1,3-galactosyltransferase 7                        346   6e-115   Glycine soja [wild soybean]
ref|XP_011027638.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    347   6e-115   Populus euphratica
ref|XP_003523469.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    347   7e-115   Glycine max [soybeans]
ref|XP_011027636.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    347   7e-115   Populus euphratica
ref|XP_011027637.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    347   7e-115   Populus euphratica
ref|XP_011027635.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    347   7e-115   Populus euphratica
ref|XP_010916559.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    347   9e-115   Elaeis guineensis
ref|XP_004515661.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    346   1e-114   Cicer arietinum [garbanzo]
ref|XP_004515660.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    346   1e-114   Cicer arietinum [garbanzo]
gb|KCW70545.1|  hypothetical protein EUGRSUZ_F03738                     343   2e-114   Eucalyptus grandis [rose gum]
gb|KJB64379.1|  hypothetical protein B456_010G046600                    346   2e-114   Gossypium raimondii
ref|XP_009367010.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    346   2e-114   Pyrus x bretschneideri [bai li]
ref|XP_002513842.1|  Beta-1,3-galactosyltransferase sqv-2, putative     346   2e-114   Ricinus communis
gb|KJB64381.1|  hypothetical protein B456_010G046600                    346   2e-114   Gossypium raimondii
ref|XP_008338811.1|  PREDICTED: beta-1,3-galactosyltransferase 7        345   3e-114   
ref|XP_011097468.1|  PREDICTED: beta-1,3-galactosyltransferase 7        345   3e-114   Sesamum indicum [beniseed]
ref|XP_008378524.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    345   3e-114   Malus domestica [apple tree]
ref|XP_008378523.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    345   3e-114   Malus domestica [apple tree]
ref|XP_010277678.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    345   3e-114   Nelumbo nucifera [Indian lotus]
ref|XP_008378522.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    345   3e-114   Malus domestica [apple tree]
ref|XP_008378526.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    345   4e-114   Malus domestica [apple tree]
ref|XP_003526605.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    345   4e-114   Glycine max [soybeans]
ref|XP_006581562.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    345   4e-114   Glycine max [soybeans]
gb|KCW70544.1|  hypothetical protein EUGRSUZ_F03738                     343   4e-114   Eucalyptus grandis [rose gum]
gb|KHN06134.1|  Beta-1,3-galactosyltransferase 7                        345   5e-114   Glycine soja [wild soybean]
ref|XP_006596309.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    345   5e-114   Glycine max [soybeans]
ref|XP_003542690.1|  PREDICTED: beta-1,3-galactosyltransferase 7        345   5e-114   Glycine max [soybeans]
ref|XP_008352694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    346   6e-114   
ref|XP_002306601.2|  galactosyltransferase family protein               343   1e-113   
gb|EPS64555.1|  hypothetical protein M569_10226                         343   2e-113   Genlisea aurea
gb|KHG03200.1|  Beta-1,3-galactosyltransferase 7 -like protein          343   2e-113   Gossypium arboreum [tree cotton]
ref|XP_010063326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    343   3e-113   Eucalyptus grandis [rose gum]
ref|XP_010063327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    343   3e-113   Eucalyptus grandis [rose gum]
ref|XP_010063329.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    342   3e-113   Eucalyptus grandis [rose gum]
ref|XP_010063328.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    342   3e-113   Eucalyptus grandis [rose gum]
gb|AFK48973.1|  unknown                                                 342   4e-113   Lotus japonicus
ref|XP_010943123.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    342   4e-113   Elaeis guineensis
ref|XP_009401434.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    342   8e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007141114.1|  hypothetical protein PHAVU_008G168500g             342   8e-113   Phaseolus vulgaris [French bean]
gb|KDO80826.1|  hypothetical protein CISIN_1g015683mg                   338   9e-113   Citrus sinensis [apfelsine]
ref|XP_006846610.1|  hypothetical protein AMTR_s00156p00023720          341   1e-112   Amborella trichopoda
ref|XP_009414059.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    341   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782246.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    341   1e-112   Phoenix dactylifera
ref|XP_002269415.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    340   3e-112   Vitis vinifera
ref|XP_010652984.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    340   4e-112   Vitis vinifera
ref|XP_004142613.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    340   5e-112   
gb|KGN54610.1|  hypothetical protein Csa_4G377730                       340   5e-112   Cucumis sativus [cucumbers]
ref|XP_008444116.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    340   5e-112   Cucumis melo [Oriental melon]
ref|XP_008444117.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    339   6e-112   Cucumis melo [Oriental melon]
ref|XP_010534616.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    339   7e-112   Tarenaya hassleriana [spider flower]
ref|XP_008802092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    339   9e-112   Phoenix dactylifera
ref|NP_001141176.1|  hypothetical protein                               335   1e-111   
gb|KDO80825.1|  hypothetical protein CISIN_1g015683mg                   339   1e-111   Citrus sinensis [apfelsine]
gb|ACF79671.1|  unknown                                                 338   1e-111   Zea mays [maize]
ref|XP_004952712.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    338   1e-111   Setaria italica
gb|KDO80824.1|  hypothetical protein CISIN_1g015683mg                   338   1e-111   Citrus sinensis [apfelsine]
ref|NP_001131318.1|  uncharacterized protein LOC100192632               338   1e-111   
ref|XP_006434095.1|  hypothetical protein CICLE_v10001364mg             338   1e-111   Citrus clementina [clementine]
ref|XP_006434096.1|  hypothetical protein CICLE_v10001364mg             338   2e-111   Citrus clementina [clementine]
ref|XP_006472695.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    338   3e-111   Citrus sinensis [apfelsine]
ref|XP_008778068.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    332   3e-111   Phoenix dactylifera
ref|XP_006472694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    338   3e-111   Citrus sinensis [apfelsine]
ref|XP_006647402.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    337   4e-111   Oryza brachyantha
dbj|BAD17751.1|  putative avr9 elicitor response protein                337   5e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454032.1|  hypothetical protein SORBIDRAFT_04g023470          337   5e-111   
gb|ACG41551.1|  avr9 elicitor response protein                          337   9e-111   Zea mays [maize]
ref|XP_008681428.1|  PREDICTED: hypothetical protein isoform X1         336   1e-110   
ref|XP_010672363.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    335   5e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002285826.1|  PREDICTED: beta-1,3-galactosyltransferase 7        335   5e-110   Vitis vinifera
ref|XP_010672316.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    335   5e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003575190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    333   1e-109   Brachypodium distachyon [annual false brome]
dbj|BAK03918.1|  predicted protein                                      333   1e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001779676.1|  predicted protein                                  333   3e-109   
ref|XP_009106424.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    332   3e-109   Brassica rapa
ref|XP_009106423.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    332   4e-109   Brassica rapa
gb|ADE77778.1|  unknown                                                 330   4e-109   Picea sitchensis
ref|NP_001141890.1|  hypothetical protein                               332   4e-109   Zea mays [maize]
gb|KFK42176.1|  hypothetical protein AALP_AA2G220800                    332   4e-109   Arabis alpina [alpine rockcress]
gb|KFK42175.1|  hypothetical protein AALP_AA2G220800                    332   5e-109   Arabis alpina [alpine rockcress]
ref|XP_010911041.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    332   6e-109   Elaeis guineensis
emb|CDX88390.1|  BnaC06g38340D                                          331   6e-109   
ref|XP_006836897.1|  hypothetical protein AMTR_s00099p00123290          332   1e-108   
gb|ADE75915.1|  unknown                                                 326   1e-108   Picea sitchensis
ref|XP_006301157.1|  hypothetical protein CARUB_v10021555mg             331   1e-108   Capsella rubella
ref|XP_002988781.1|  glycosyltransferase-like protein                   330   2e-108   Selaginella moellendorffii
gb|AAG51626.1|AC012193_8  putative (Avr9) elicitor response prote...    330   3e-108   Arabidopsis thaliana [mouse-ear cress]
gb|AGZ15279.1|  putative Avr9 elicitor response protein                 330   4e-108   Taraxacum brevicorniculatum
gb|AHL38868.1|  glycosyltransferase                                     329   4e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001781844.1|  predicted protein                                  329   4e-108   
ref|NP_974164.2|  beta-1,3-galactosyltransferase 7                      329   4e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002462477.1|  hypothetical protein SORBIDRAFT_02g026360          330   4e-108   
ref|XP_011097092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    329   5e-108   Sesamum indicum [beniseed]
ref|XP_006390051.1|  hypothetical protein EUTSA_v10018693mg             329   6e-108   Eutrema salsugineum [saltwater cress]
ref|XP_001754566.1|  predicted protein                                  328   8e-108   
ref|XP_010428866.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    329   8e-108   Camelina sativa [gold-of-pleasure]
ref|XP_010471980.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    328   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_002889162.1|  galactosyltransferase family protein               328   1e-107   
ref|XP_010471981.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    328   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010428865.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    328   1e-107   Camelina sativa [gold-of-pleasure]
ref|XP_006441805.1|  hypothetical protein CICLE_v10024512mg             328   2e-107   
ref|XP_006660681.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    325   2e-107   
ref|XP_010416738.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    328   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010416737.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    328   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_010278672.1|  PREDICTED: probable beta-1,3-galactosyltrans...    328   3e-107   Nelumbo nucifera [Indian lotus]
ref|XP_003576598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    327   6e-107   Brachypodium distachyon [annual false brome]
gb|KDP39142.1|  hypothetical protein JCGZ_00899                         327   7e-107   Jatropha curcas
ref|NP_001063339.1|  Os09g0452900                                       326   8e-107   
ref|XP_004956987.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    326   9e-107   Setaria italica
ref|XP_009612460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    326   9e-107   Nicotiana tomentosiformis
ref|XP_006365959.1|  PREDICTED: probable beta-1,3-galactosyltrans...    326   1e-106   Solanum tuberosum [potatoes]
ref|XP_009361001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    325   1e-106   Pyrus x bretschneideri [bai li]
ref|XP_009774309.1|  PREDICTED: probable beta-1,3-galactosyltrans...    326   2e-106   Nicotiana sylvestris
ref|XP_009610750.1|  PREDICTED: probable beta-1,3-galactosyltrans...    326   2e-106   Nicotiana tomentosiformis
ref|XP_007211967.1|  hypothetical protein PRUPE_ppa006589mg             325   2e-106   
emb|CAN63417.1|  hypothetical protein VITISV_007689                     324   2e-106   Vitis vinifera
ref|XP_006855892.1|  hypothetical protein AMTR_s00037p00154410          325   3e-106   Amborella trichopoda
ref|XP_008226885.1|  PREDICTED: probable beta-1,3-galactosyltrans...    325   3e-106   Prunus mume [ume]
ref|XP_008226884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    325   3e-106   Prunus mume [ume]
ref|XP_004162968.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   3e-106   
ref|XP_007039332.1|  Galactosyltransferase family protein isoform 1     325   3e-106   
ref|XP_006478362.1|  PREDICTED: probable beta-1,3-galactosyltrans...    326   3e-106   
ref|XP_002529902.1|  Beta-1,3-galactosyltransferase sqv-2, putative     319   4e-106   
ref|XP_007039333.1|  Galactosyltransferase family protein isoform 2     325   4e-106   
emb|CDP05735.1|  unnamed protein product                                325   5e-106   Coffea canephora [robusta coffee]
ref|XP_010252349.1|  PREDICTED: probable beta-1,3-galactosyltrans...    324   5e-106   
ref|XP_010063020.1|  PREDICTED: probable beta-1,3-galactosyltrans...    324   7e-106   Eucalyptus grandis [rose gum]
ref|XP_010063019.1|  PREDICTED: probable beta-1,3-galactosyltrans...    324   7e-106   Eucalyptus grandis [rose gum]
ref|XP_006475058.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   9e-106   
ref|XP_010929797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    324   1e-105   Elaeis guineensis
ref|XP_009361000.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_009774684.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    319   1e-105   Nicotiana sylvestris
ref|XP_010675728.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   1e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007039335.1|  Beta-1,3-galactosyltransferase 6 isoform 4         324   1e-105   
ref|XP_010276120.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   1e-105   Nelumbo nucifera [Indian lotus]
ref|XP_008804298.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   2e-105   Phoenix dactylifera
ref|XP_006439187.1|  hypothetical protein CICLE_v10020627mg             320   2e-105   
gb|KJB26942.1|  hypothetical protein B456_004G268200                    323   2e-105   Gossypium raimondii
ref|XP_008437459.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   2e-105   Cucumis melo [Oriental melon]
ref|XP_011461040.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   2e-105   Fragaria vesca subsp. vesca
gb|KDO76779.1|  hypothetical protein CISIN_1g021312mg                   320   2e-105   Citrus sinensis [apfelsine]
ref|XP_001758882.1|  predicted protein                                  323   2e-105   
ref|XP_006592811.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   2e-105   
ref|XP_004294404.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   2e-105   Fragaria vesca subsp. vesca
ref|XP_002279814.2|  PREDICTED: probable beta-1,3-galactosyltrans...    323   2e-105   Vitis vinifera
ref|XP_006439188.1|  hypothetical protein CICLE_v10020627mg             316   3e-105   
ref|XP_004159203.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    323   3e-105   
ref|XP_011095407.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   3e-105   Sesamum indicum [beniseed]
ref|XP_008455443.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   3e-105   Cucumis melo [Oriental melon]
ref|XP_004144497.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   3e-105   Cucumis sativus [cucumbers]
ref|XP_006375531.1|  hypothetical protein POPTR_0014s15200g             319   3e-105   
gb|KDP25226.1|  hypothetical protein JCGZ_20382                         322   4e-105   Jatropha curcas
gb|KGN63249.1|  hypothetical protein Csa_2G418850                       322   4e-105   Cucumis sativus [cucumbers]
ref|NP_177904.3|  beta-1,3-galactosyltransferase 7                      322   4e-105   
ref|XP_004145877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   4e-105   
ref|XP_004172360.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   5e-105   
ref|XP_004151891.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   5e-105   
ref|XP_009782227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   5e-105   Nicotiana sylvestris
gb|KGN49967.1|  hypothetical protein Csa_5G146900                       322   5e-105   
ref|XP_008455884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   5e-105   Cucumis melo [Oriental melon]
ref|XP_008359264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   7e-105   
ref|XP_008359262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   7e-105   
ref|XP_009397181.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   7e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004245304.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    321   7e-105   Solanum lycopersicum
ref|XP_006452382.1|  hypothetical protein CICLE_v10008439mg             322   8e-105   Citrus clementina [clementine]
ref|XP_008437460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    321   1e-104   Cucumis melo [Oriental melon]
ref|XP_006475057.1|  PREDICTED: probable beta-1,3-galactosyltrans...    321   1e-104   Citrus sinensis [apfelsine]
ref|XP_010471979.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    321   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_009398227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    321   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006592810.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   1e-104   
ref|XP_006346208.1|  PREDICTED: probable beta-1,3-galactosyltrans...    321   2e-104   Solanum tuberosum [potatoes]
gb|ACL53751.1|  unknown                                                 321   2e-104   Zea mays [maize]
ref|XP_003540300.1|  PREDICTED: probable beta-1,3-galactosyltrans...    321   2e-104   Glycine max [soybeans]
ref|NP_001149873.1|  LOC100283501                                       321   2e-104   
ref|XP_002970340.1|  glycosyltransferase-like protein                   320   2e-104   
ref|XP_006439190.1|  hypothetical protein CICLE_v10020627mg             320   2e-104   
ref|XP_010089999.1|  putative beta-1,3-galactosyltransferase 2          320   2e-104   Morus notabilis
gb|KDO54673.1|  hypothetical protein CISIN_1g015407mg                   317   2e-104   Citrus sinensis [apfelsine]
ref|XP_003539862.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   2e-104   Glycine max [soybeans]
gb|KHN21228.1|  Putative beta-1,3-galactosyltransferase 2               320   2e-104   Glycine soja [wild soybean]
ref|XP_009338707.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   2e-104   Pyrus x bretschneideri [bai li]
ref|XP_002968104.1|  glycosyltransferase-like protein                   320   2e-104   
ref|XP_009338706.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   3e-104   Pyrus x bretschneideri [bai li]
ref|XP_004970763.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   3e-104   
ref|XP_006476264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   3e-104   
ref|XP_003527496.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   3e-104   Glycine max [soybeans]
ref|XP_006476263.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   3e-104   
gb|EMT26667.1|  Beta-1,3-galactosyltransferase 7                        320   3e-104   
ref|XP_011047262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   3e-104   Populus euphratica
ref|XP_011047261.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   4e-104   Populus euphratica
ref|XP_004149353.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   4e-104   Cucumis sativus [cucumbers]
ref|XP_010910268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   4e-104   Elaeis guineensis
ref|XP_002320464.1|  galactosyltransferase family protein               320   4e-104   Populus trichocarpa [western balsam poplar]
ref|XP_004244109.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   5e-104   Solanum lycopersicum
ref|XP_004487414.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   5e-104   Cicer arietinum [garbanzo]
ref|XP_006375532.1|  hypothetical protein POPTR_0014s15200g             320   5e-104   Populus trichocarpa [western balsam poplar]
ref|XP_008385877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    319   6e-104   
ref|XP_002518935.1|  Beta-1,3-galactosyltransferase sqv-2, putative     319   6e-104   Ricinus communis
ref|XP_008463407.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    319   7e-104   
gb|EYU27344.1|  hypothetical protein MIMGU_mgv1a007546mg                319   7e-104   Erythranthe guttata [common monkey flower]
ref|XP_007132543.1|  hypothetical protein PHAVU_011G103400g             319   7e-104   Phaseolus vulgaris [French bean]
ref|XP_009607565.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    318   7e-104   Nicotiana tomentosiformis
ref|XP_011470881.1|  PREDICTED: probable beta-1,3-galactosyltrans...    319   7e-104   Fragaria vesca subsp. vesca
ref|XP_006447567.1|  hypothetical protein CICLE_v10015443mg             315   8e-104   
ref|XP_009777689.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    318   8e-104   Nicotiana sylvestris
ref|XP_006304048.1|  hypothetical protein CARUB_v10009858mg             315   9e-104   
ref|XP_010046417.1|  PREDICTED: probable beta-1,3-galactosyltrans...    319   9e-104   Eucalyptus grandis [rose gum]
ref|XP_009777688.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    318   9e-104   Nicotiana sylvestris
ref|XP_008392652.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   1e-103   
ref|XP_006355190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    318   1e-103   Solanum tuberosum [potatoes]
dbj|BAJ94062.1|  predicted protein                                      318   1e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007209207.1|  hypothetical protein PRUPE_ppa006612mg             318   1e-103   Prunus persica
gb|KEH29682.1|  beta-1,3-galactosyltransferase-like protein             317   1e-103   Medicago truncatula
ref|XP_002300511.1|  hypothetical protein POPTR_0001s45420g             317   1e-103   
ref|XP_010484738.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010484744.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   1e-103   Camelina sativa [gold-of-pleasure]
gb|EYU21104.1|  hypothetical protein MIMGU_mgv1a007738mg                318   2e-103   Erythranthe guttata [common monkey flower]
ref|XP_010475190.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010475189.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_008245629.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-103   Prunus mume [ume]
ref|XP_003543389.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-103   Glycine max [soybeans]
gb|KFK45039.1|  hypothetical protein AALP_AA1G336200                    318   2e-103   Arabis alpina [alpine rockcress]
ref|XP_006840618.1|  hypothetical protein AMTR_s00084p00079370          318   2e-103   Amborella trichopoda
gb|EPS73703.1|  hypothetical protein M569_01053                         311   2e-103   Genlisea aurea
ref|XP_009344054.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-103   Pyrus x bretschneideri [bai li]
ref|XP_009589155.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-103   Nicotiana tomentosiformis
ref|NP_174569.1|  putative beta-1,3-galactosyltransferase               318   2e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KDP22716.1|  hypothetical protein JCGZ_01818                         314   3e-103   Jatropha curcas
ref|XP_008808431.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    318   3e-103   
emb|CDY54843.1|  BnaC05g51320D                                          318   3e-103   Brassica napus [oilseed rape]
gb|KJB52408.1|  hypothetical protein B456_008G260300                    315   3e-103   Gossypium raimondii
ref|XP_011040606.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   4e-103   Populus euphratica
gb|KDO54672.1|  hypothetical protein CISIN_1g015407mg                   317   4e-103   Citrus sinensis [apfelsine]
ref|XP_009114848.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   4e-103   Brassica rapa
ref|XP_002892271.1|  galactosyltransferase family protein               317   4e-103   Arabidopsis lyrata subsp. lyrata
ref|NP_172009.1|  putative beta-1,3-galactosyltransferase 2             317   4e-103   
gb|KDO54670.1|  hypothetical protein CISIN_1g015407mg                   317   4e-103   Citrus sinensis [apfelsine]
gb|KDO54671.1|  hypothetical protein CISIN_1g015407mg                   317   4e-103   Citrus sinensis [apfelsine]
ref|XP_007019713.1|  Galactosyltransferase family protein isoform 1     317   4e-103   
ref|NP_001077462.1|  putative beta-1,3-galactosyltransferase 2          317   4e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011463344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   4e-103   Fragaria vesca subsp. vesca
ref|XP_002893747.1|  galactosyltransferase family protein               317   4e-103   
ref|XP_010251481.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   5e-103   Nelumbo nucifera [Indian lotus]
gb|KHF99242.1|  putative beta-1,3-galactosyltransferase 2 -like p...    317   5e-103   Gossypium arboreum [tree cotton]
ref|XP_006366586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   5e-103   Solanum tuberosum [potatoes]
ref|XP_004287949.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   5e-103   Fragaria vesca subsp. vesca
ref|XP_006304992.1|  hypothetical protein CARUB_v10009358mg             317   5e-103   Capsella rubella
ref|XP_006366587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   6e-103   
ref|XP_006370727.1|  hypothetical protein POPTR_0001s45420g             316   6e-103   
gb|KDP22107.1|  hypothetical protein JCGZ_25938                         318   6e-103   
ref|XP_011100272.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   6e-103   
ref|XP_009770915.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   6e-103   
ref|XP_002977391.1|  glycosyltransferase-like protein                   317   7e-103   
ref|XP_006418057.1|  hypothetical protein EUTSA_v10007787mg             317   7e-103   
ref|XP_002524194.1|  Beta-1,3-galactosyltransferase sqv-2, putative     315   7e-103   
ref|XP_010655390.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   7e-103   
ref|XP_010677261.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   8e-103   
gb|KHG17244.1|  putative beta-1,3-galactosyltransferase 6 -like p...    316   8e-103   
ref|XP_010677269.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   8e-103   
gb|KJB80505.1|  hypothetical protein B456_013G101400                    316   9e-103   
ref|XP_008777928.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   9e-103   
gb|KJB80507.1|  hypothetical protein B456_013G101400                    316   9e-103   
ref|XP_010104914.1|  putative beta-1,3-galactosyltransferase 6          317   9e-103   
ref|XP_009782081.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   9e-103   
gb|KHG10854.1|  putative beta-1,3-galactosyltransferase 2 -like p...    317   9e-103   
ref|XP_006469680.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   1e-102   
ref|XP_010923856.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   1e-102   
ref|XP_009598546.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   1e-102   
ref|XP_011006339.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    314   1e-102   
ref|XP_006469679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   1e-102   
ref|XP_004515096.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   1e-102   
ref|XP_006447568.1|  hypothetical protein CICLE_v10015443mg             316   1e-102   
ref|XP_002974972.1|  glycosyltransferase-like protein                   316   1e-102   
ref|XP_008802930.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   1e-102   
gb|KJB52405.1|  hypothetical protein B456_008G260300                    316   1e-102   
ref|XP_006342694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    314   2e-102   
ref|XP_010231346.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   2e-102   
emb|CBI16979.3|  unnamed protein product                                315   2e-102   
ref|XP_010542535.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   2e-102   
ref|XP_010542528.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   2e-102   
ref|XP_004243473.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   2e-102   
ref|XP_009353285.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   2e-102   
gb|EAZ14356.1|  hypothetical protein OsJ_04276                          312   2e-102   
ref|XP_009353286.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   2e-102   
ref|XP_010104592.1|  putative beta-1,3-galactosyltransferase 2          316   2e-102   
ref|XP_010457599.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   2e-102   
ref|XP_010457598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   2e-102   
ref|XP_011038007.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   3e-102   
ref|XP_010323831.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   3e-102   
gb|KEH29683.1|  beta-1,3-galactosyltransferase-like protein             315   3e-102   
gb|KJB59160.1|  hypothetical protein B456_009G242100                    314   3e-102   
ref|XP_004506364.1|  PREDICTED: probable beta-1,3-galactosyltrans...    314   3e-102   
ref|XP_006415137.1|  hypothetical protein EUTSA_v10007803mg             315   3e-102   
gb|KHN03478.1|  Putative beta-1,3-galactosyltransferase 2               312   3e-102   
ref|XP_010657202.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   3e-102   
ref|XP_002268282.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   3e-102   
gb|KFK42855.1|  hypothetical protein AALP_AA1G047700                    315   3e-102   
ref|NP_001044974.1|  Os01g0877400                                       315   3e-102   
ref|XP_010522341.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   3e-102   
ref|XP_010522344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   4e-102   
ref|XP_010657203.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   4e-102   
ref|XP_007149975.1|  hypothetical protein PHAVU_005G115300g             315   4e-102   
ref|XP_002979099.1|  glycosyltransferase-like protein                   314   4e-102   
ref|XP_002265159.2|  PREDICTED: probable beta-1,3-galactosyltrans...    315   4e-102   
ref|XP_008229956.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   4e-102   
gb|EYU34029.1|  hypothetical protein MIMGU_mgv1a007633mg                314   4e-102   
ref|XP_007215470.1|  hypothetical protein PRUPE_ppa006530mg             315   4e-102   
ref|XP_008374141.1|  PREDICTED: probable beta-1,3-galactosyltrans...    314   5e-102   
emb|CDX93812.1|  BnaA09g24120D                                          314   5e-102   
ref|XP_007215471.1|  hypothetical protein PRUPE_ppa006530mg             314   5e-102   
ref|XP_007153952.1|  hypothetical protein PHAVU_003G079100g             313   6e-102   
ref|XP_008379639.1|  PREDICTED: probable beta-1,3-galactosyltrans...    314   6e-102   
ref|XP_006415086.1|  hypothetical protein EUTSA_v10007836mg             314   6e-102   
ref|XP_008379640.1|  PREDICTED: probable beta-1,3-galactosyltrans...    314   6e-102   
ref|XP_003550487.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   7e-102   
ref|XP_011013418.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   7e-102   
emb|CDY67379.1|  BnaCnng54730D                                          313   7e-102   
ref|XP_007020793.1|  Galactosyltransferase family protein               314   8e-102   
ref|XP_009602082.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   1e-101   
ref|XP_009151468.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   1e-101   
ref|XP_010053046.1|  PREDICTED: probable beta-1,3-galactosyltrans...    312   1e-101   
ref|XP_009757629.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   1e-101   
ref|XP_010542088.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   1e-101   
ref|XP_003540564.1|  PREDICTED: probable beta-1,3-galactosyltrans...    312   1e-101   
emb|CDP10795.1|  unnamed protein product                                313   1e-101   
ref|XP_009757632.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   1e-101   
ref|XP_002513511.1|  transferase, transferring glycosyl groups, p...    314   1e-101   
ref|NP_174609.1|  putative beta-1,3-galactosyltransferase 8             313   1e-101   
ref|XP_006452383.1|  hypothetical protein CICLE_v10008439mg             310   1e-101   
ref|XP_009757630.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   1e-101   
ref|XP_008342010.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   1e-101   
ref|XP_007131321.1|  hypothetical protein PHAVU_011G003800g             312   1e-101   
ref|XP_010471978.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    313   2e-101   
ref|XP_010471977.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    314   2e-101   
ref|XP_008342011.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   2e-101   
ref|XP_004962000.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   2e-101   
ref|XP_010927833.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    312   2e-101   
ref|XP_010557003.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   2e-101   
emb|CDY46836.1|  BnaA10g03200D                                          313   2e-101   
gb|KJB62840.1|  hypothetical protein B456_009G440200                    311   2e-101   
ref|XP_002278708.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   2e-101   
ref|NP_001185130.1|  putative beta-1,3-galactosyltransferase 8          313   2e-101   
gb|KHN32455.1|  Putative beta-1,3-galactosyltransferase 8               311   2e-101   
gb|KJB62839.1|  hypothetical protein B456_009G440200                    311   3e-101   
ref|XP_010557001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   3e-101   
gb|KJB69212.1|  hypothetical protein B456_011G013600                    310   3e-101   
ref|XP_006646529.1|  PREDICTED: probable beta-1,3-galactosyltrans...    312   3e-101   
gb|EEC79262.1|  hypothetical protein OsI_20042                          312   3e-101   
ref|XP_011081357.1|  PREDICTED: probable beta-1,3-galactosyltrans...    312   3e-101   
ref|XP_011048788.1|  PREDICTED: probable beta-1,3-galactosyltrans...    312   4e-101   
emb|CDP04596.1|  unnamed protein product                                311   4e-101   
ref|XP_002302876.1|  hypothetical protein POPTR_0002s21280g             312   4e-101   
ref|XP_011048789.1|  PREDICTED: probable beta-1,3-galactosyltrans...    312   4e-101   
ref|XP_010539626.1|  PREDICTED: beta-1,3-galactosyltransferase 7        313   4e-101   
ref|XP_010461116.1|  PREDICTED: probable beta-1,3-galactosyltrans...    312   4e-101   
ref|NP_001055606.1|  Os05g0427200                                       312   5e-101   
ref|XP_010461115.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   5e-101   
ref|XP_009408655.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   6e-101   
ref|XP_010478679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   6e-101   
ref|XP_004982530.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   6e-101   
ref|XP_010053045.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   7e-101   
gb|EYU22689.1|  hypothetical protein MIMGU_mgv1a007366mg                308   7e-101   
ref|XP_010461174.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   7e-101   
ref|XP_002893769.1|  galactosyltransferase family protein               311   8e-101   
ref|XP_010461176.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   8e-101   
ref|XP_009119198.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   8e-101   
ref|XP_009119197.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   8e-101   
gb|AAV25017.1|  putative galactosyltransferase                          311   9e-101   
ref|XP_003533526.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   9e-101   
ref|XP_010499892.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   9e-101   
ref|XP_011095109.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   1e-100   
emb|CDY49507.1|  BnaC05g03190D                                          311   1e-100   
gb|KJB13704.1|  hypothetical protein B456_002G089700                    309   1e-100   
emb|CDY12206.1|  BnaC04g12360D                                          311   1e-100   
gb|KHN11643.1|  Putative beta-1,3-galactosyltransferase 8               310   2e-100   
ref|XP_010499840.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   2e-100   
gb|KDO78242.1|  hypothetical protein CISIN_1g015962mg                   309   2e-100   
ref|XP_008367159.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   2e-100   
emb|CDY48266.1|  BnaA05g10880D                                          310   2e-100   
gb|KDO78243.1|  hypothetical protein CISIN_1g015962mg                   307   2e-100   
ref|XP_006304768.1|  hypothetical protein CARUB_v10012254mg             310   2e-100   
ref|XP_009143988.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   2e-100   
gb|KJB62836.1|  hypothetical protein B456_009G440200                    310   2e-100   
ref|XP_009143989.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   2e-100   
ref|XP_006371368.1|  hypothetical protein POPTR_0019s09520g             310   2e-100   
gb|KJB13705.1|  hypothetical protein B456_002G089700                    309   2e-100   
ref|XP_006304002.1|  hypothetical protein CARUB_v10011446mg             310   3e-100   
gb|KJB69210.1|  hypothetical protein B456_011G013600                    310   3e-100   
ref|XP_006371369.1|  hypothetical protein POPTR_0019s09520g             311   3e-100   
gb|KJB69211.1|  hypothetical protein B456_011G013600                    310   3e-100   
gb|EYU22688.1|  hypothetical protein MIMGU_mgv1a007366mg                310   3e-100   
ref|XP_009360212.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   3e-100   
gb|EYU22690.1|  hypothetical protein MIMGU_mgv1a007366mg                309   3e-100   
ref|XP_006452384.1|  hypothetical protein CICLE_v10008439mg             310   4e-100   
ref|XP_006410375.1|  hypothetical protein EUTSA_v10016736mg             310   4e-100   
ref|XP_011097870.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   4e-100   
ref|XP_004250812.1|  PREDICTED: probable beta-1,3-galactosyltrans...    309   5e-100   
ref|XP_007039334.1|  Beta-1,3-galactosyltransferase 6 isoform 3         309   5e-100   
gb|AAS90659.1|  putative galactosyltransferase                          313   5e-100   
ref|XP_006654433.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   6e-100   
ref|XP_003564759.2|  PREDICTED: probable beta-1,3-galactosyltrans...    309   6e-100   
ref|XP_003562342.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   9e-100   
ref|XP_006467429.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-99    
ref|XP_006467430.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-99    
ref|XP_010478768.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-99    
ref|XP_010413996.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-99    
ref|XP_007026088.1|  Galactosyltransferase family protein isoform 1     308   1e-99    
ref|XP_010413995.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-99    
ref|XP_010510018.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-99    
gb|KJB13702.1|  hypothetical protein B456_002G089700                    308   1e-99    
ref|XP_010469586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-99    
ref|XP_010469587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   2e-99    
gb|KJB57752.1|  hypothetical protein B456_009G178900                    306   2e-99    
ref|XP_004507687.1|  PREDICTED: probable beta-1,3-galactosyltrans...    306   2e-99    
ref|NP_001141034.1|  hypothetical protein                               306   2e-99    
gb|KHG30061.1|  putative beta-1,3-galactosyltransferase 4 -like p...    308   2e-99    
ref|XP_004506363.1|  PREDICTED: probable beta-1,3-galactosyltrans...    307   2e-99    
ref|XP_004506362.1|  PREDICTED: probable beta-1,3-galactosyltrans...    307   2e-99    
gb|KHG03847.1|  putative beta-1,3-galactosyltransferase 2 -like p...    308   2e-99    
ref|XP_002441135.1|  hypothetical protein SORBIDRAFT_09g021080          307   2e-99    
ref|XP_010112065.1|  putative beta-1,3-galactosyltransferase 8          307   3e-99    
gb|KCW70985.1|  hypothetical protein EUGRSUZ_F04094                     308   3e-99    
gb|KJB57747.1|  hypothetical protein B456_009G178900                    307   3e-99    
gb|AAF17702.1|AC009243_29  F28K19.2                                     307   4e-99    
ref|XP_011097866.1|  PREDICTED: probable beta-1,3-galactosyltrans...    309   4e-99    
ref|XP_010065074.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   4e-99    
ref|XP_006294322.1|  hypothetical protein CARUB_v10023330mg             306   6e-99    
dbj|BAK07004.1|  predicted protein                                      306   8e-99    
ref|XP_008459501.1|  PREDICTED: probable beta-1,3-galactosyltrans...    305   9e-99    
gb|EMS57380.1|  Beta-1,3-galactosyltransferase 7                        305   1e-98    
ref|XP_008681412.1|  PREDICTED: hypothetical protein isoform X1         306   1e-98    
ref|XP_003596979.1|  hypothetical protein MTR_2g088270                  305   1e-98    
ref|XP_007019715.1|  Galactosyltransferase family protein isoform 3     305   2e-98    
ref|XP_006416240.1|  hypothetical protein EUTSA_v10009382mg             305   2e-98    
ref|XP_009775717.1|  PREDICTED: probable beta-1,3-galactosyltrans...    305   2e-98    
ref|XP_007200771.1|  hypothetical protein PRUPE_ppa023844mg             305   2e-98    
ref|XP_009775718.1|  PREDICTED: probable beta-1,3-galactosyltrans...    305   2e-98    
ref|XP_002879388.1|  galactosyltransferase family protein               305   2e-98    
ref|NP_180802.1|  putative beta-1,3-galactosyltransferase 3             305   3e-98    
ref|XP_002518474.1|  Beta-1,3-galactosyltransferase sqv-2, putative     304   3e-98    
gb|KDP20741.1|  hypothetical protein JCGZ_21212                         304   3e-98    
gb|AES87856.2|  beta-1,3-galactosyltransferase-like protein             304   4e-98    
ref|XP_006587723.1|  PREDICTED: probable beta-1,3-galactosyltrans...    304   4e-98    
ref|XP_008445355.1|  PREDICTED: beta-1,3-galactosyltransferase 7        304   5e-98    
gb|EYU19437.1|  hypothetical protein MIMGU_mgv1a007611mg                304   5e-98    
ref|XP_010459924.1|  PREDICTED: probable beta-1,3-galactosyltrans...    304   6e-98    
ref|XP_009383802.1|  PREDICTED: probable beta-1,3-galactosyltrans...    303   6e-98    
emb|CDM85234.1|  unnamed protein product                                322   6e-98    
ref|XP_006449734.1|  hypothetical protein CICLE_v10015441mg             301   7e-98    
ref|XP_002464309.1|  hypothetical protein SORBIDRAFT_01g015960          304   8e-98    
ref|XP_006828867.1|  hypothetical protein AMTR_s00001p00171620          303   1e-97    
ref|XP_010477453.1|  PREDICTED: probable beta-1,3-galactosyltrans...    303   1e-97    
gb|KJB80508.1|  hypothetical protein B456_013G101400                    303   1e-97    
ref|XP_010498661.1|  PREDICTED: probable beta-1,3-galactosyltrans...    303   1e-97    
gb|KFK44305.1|  hypothetical protein AALP_AA1G240600                    303   1e-97    
ref|XP_004150699.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    303   1e-97    
ref|XP_009383801.1|  PREDICTED: probable beta-1,3-galactosyltrans...    303   1e-97    
emb|CDP11534.1|  unnamed protein product                                303   1e-97    
ref|XP_010536663.1|  PREDICTED: probable beta-1,3-galactosyltrans...    303   2e-97    
ref|XP_009624798.1|  PREDICTED: probable beta-1,3-galactosyltrans...    301   2e-97    
gb|EMS45879.1|  putative beta-1,3-galactosyltransferase 8               301   2e-97    
ref|XP_010457597.1|  PREDICTED: probable beta-1,3-galactosyltrans...    303   3e-97    
ref|XP_009624796.1|  PREDICTED: probable beta-1,3-galactosyltrans...    302   3e-97    
ref|XP_010457596.1|  PREDICTED: probable beta-1,3-galactosyltrans...    303   3e-97    
gb|KHG10489.1|  Beta-1,3-galactosyltransferase 7 -like protein          298   3e-97    
ref|XP_009624797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    302   3e-97    
ref|XP_006650268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    302   3e-97    
emb|CDX96559.1|  BnaA08g21020D                                          300   4e-97    



>ref|XP_009601250.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
tomentosiformis]
Length=320

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLAATL RHRSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  146  KWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPEYWKF  205

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDERTM
Sbjct  206  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTM  265

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCGEGEE LWNALF
Sbjct  266  CCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  320



>ref|XP_006364961.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
 ref|XP_010312804.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Solanum 
lycopersicum]
Length=320

 Score =   360 bits (924),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLAATL RHRSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  146  KWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPEYWKF  205

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDERTM
Sbjct  206  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTM  265

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCGEGEE LWNALF
Sbjct  266  CCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  320



>ref|XP_009786663.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
sylvestris]
Length=320

 Score =   360 bits (923),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGMLAATL RHRSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  146  RWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPEYWKF  205

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDERTM
Sbjct  206  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTM  265

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCGEGEE LWNALF
Sbjct  266  CCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  320



>ref|XP_009601249.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
tomentosiformis]
Length=396

 Score =   362 bits (929),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLAATL RHRSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  222  KWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDERTM
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCGEGEE LWNALF
Sbjct  342  CCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>emb|CAA06925.1| Avr9 elicitor response protein [Nicotiana tabacum]
Length=396

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGMLAATL RHRSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  222  RWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDERTM
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCGEGEE LWNALF
Sbjct  342  CCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>ref|XP_009786662.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
sylvestris]
Length=396

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGMLAATL RHRSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  222  RWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDERTM
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCGEGEE LWNALF
Sbjct  342  CCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>ref|XP_011074895.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Sesamum indicum]
Length=372

 Score =   360 bits (923),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG LAATL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  198  KWDADFYVKVDDDVHVNLGTLAATLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  257

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  258  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  317

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEK+KFVH++CGEGEE LWNAL 
Sbjct  318  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKMKFVHDQCGEGEEALWNALL  372



>ref|XP_004250351.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Solanum 
lycopersicum]
Length=396

 Score =   360 bits (924),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLAATL RHRSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  222  KWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDERTM
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCGEGEE LWNALF
Sbjct  342  CCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>ref|XP_006364960.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=396

 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLAATL RHRSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  222  KWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDERTM
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC+WKA+AGNVCVASFDWSCSGICKSVEK+K+VHEKCGEGEE LWNALF
Sbjct  342  CCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>gb|EYU22897.1| hypothetical protein MIMGU_mgv1a007777mg [Erythranthe guttata]
Length=395

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG LAA L RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  221  KWDADFYVKVDDDVHVNLGTLAANLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  280

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQP+LHKYANEDVSLGAWFIGLEV+HID+R+M
Sbjct  281  GEEGNKYFRHATGQIYAISKDLATYISINQPLLHKYANEDVSLGAWFIGLEVEHIDDRSM  340

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+KFVHE+CGEGEE LWNAL 
Sbjct  341  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKFVHEQCGEGEEALWNALL  395



>emb|CDP18301.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   355 bits (911),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG+L ATL RHRSKPR+YIGCMKSGPVLS KNVKYHEPE WKF
Sbjct  221  KWDADFYVKVDDDVHVNLGVLGATLARHRSKPRIYIGCMKSGPVLSSKNVKYHEPEYWKF  280

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER+M
Sbjct  281  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDERSM  340

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CC TPP+CEWKAQAGNVCVASFDWSCSGICKSVEKI+FVHE+CGEGEE +WNALF
Sbjct  341  CCATPPECEWKAQAGNVCVASFDWSCSGICKSVEKIRFVHERCGEGEEAVWNALF  395



>ref|XP_010095510.1| Beta-1,3-galactosyltransferase 7 [Morus notabilis]
 gb|EXB60484.1| Beta-1,3-galactosyltransferase 7 [Morus notabilis]
Length=397

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL  HRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  223  KWDADFYVKVDDDVHVNLGMLATTLAHHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R M
Sbjct  283  GEDGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEG+ T+W++LF
Sbjct  343  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGDGTVWSSLF  397



>gb|KDP32735.1| hypothetical protein JCGZ_12027 [Jatropha curcas]
Length=398

 Score =   352 bits (904),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA++YVKVDDDVHVNLGMLAATL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  224  KWDAEYYVKVDDDVHVNLGMLAATLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  283

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQP+LHKYANEDVSLG+WFIGLEV+HID+R M
Sbjct  284  GEEGNKYFRHATGQIYAISKDLATYISINQPLLHKYANEDVSLGSWFIGLEVEHIDDRNM  343

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIKFVHE+CGEG+  +W+ALF
Sbjct  344  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKFVHERCGEGDGAVWSALF  398



>ref|XP_010245068.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Nelumbo nucifera]
Length=396

 Score =   352 bits (904),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLAATL RHRSKPRVY+GCMKSGPVLSQKNVKYHEPE WKF
Sbjct  222  KWDAEFYVKVDDDVHVNLGMLAATLARHRSKPRVYMGCMKSGPVLSQKNVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDER M
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHE+CGEG+  +W+ALF
Sbjct  342  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHERCGEGDGAVWSALF  396



>gb|EYU23928.1| hypothetical protein MIMGU_mgv1a007764mg [Erythranthe guttata]
Length=396

 Score =   351 bits (901),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG LAATL RHR KPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  222  KWDADFYVKVDDDVHVNLGTLAATLARHRPKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYA+SKDLATYISINQ ILHKYANEDVSLGAWFIGLEV+HIDER M
Sbjct  282  GEDGNKYFRHATGQIYALSKDLATYISINQHILHKYANEDVSLGAWFIGLEVEHIDERNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWK+QAGNVC+ASFDWSCSGICKSVEK+KFVHE+CGEGEE LWNAL 
Sbjct  342  CCGTPPDCEWKSQAGNVCIASFDWSCSGICKSVEKMKFVHEQCGEGEEALWNALL  396



>ref|XP_003601132.1| Avr9 elicitor response protein [Medicago truncatula]
 gb|AES71383.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=396

 Score =   349 bits (896),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG+LAATL RHRSKPRVYIGCMKSGPVLS+K+VKYHEPE WKFG
Sbjct  223  WDADFYVKVDDDVHVNLGVLAATLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPEFWKFG  282

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R+MC
Sbjct  283  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRSMC  342

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+ALF
Sbjct  343  CGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALF  396



>ref|XP_003601133.1| Avr9 elicitor response protein [Medicago truncatula]
 gb|AES71384.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
 gb|AFK45036.1| unknown [Medicago truncatula]
Length=395

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG+LAATL RHRSKPRVYIGCMKSGPVLS+K+VKYHEPE WKFG
Sbjct  222  WDADFYVKVDDDVHVNLGVLAATLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPEFWKFG  281

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R+MC
Sbjct  282  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRSMC  341

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+ALF
Sbjct  342  CGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALF  395



>ref|XP_008233932.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Prunus 
mume]
Length=400

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKFG
Sbjct  227  WDADFYVKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKFG  286

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R MC
Sbjct  287  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNMC  346

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCGEG+  +W++LF
Sbjct  347  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCGEGDAAVWSSLF  400



>ref|XP_008233934.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Prunus 
mume]
Length=397

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKFG
Sbjct  224  WDADFYVKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKFG  283

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R MC
Sbjct  284  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNMC  343

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCGEG+  +W++LF
Sbjct  344  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCGEGDAAVWSSLF  397



>ref|XP_008233933.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Prunus 
mume]
Length=399

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKFG
Sbjct  226  WDADFYVKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKFG  285

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R MC
Sbjct  286  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNMC  345

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCGEG+  +W++LF
Sbjct  346  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCGEGDAAVWSSLF  399



>ref|XP_011465327.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=399

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA+TL  HRSKPRVYIGCMKSGPVL+QK++KYHEPE WKF
Sbjct  225  KWDADFYVKVDDDVHVNLGMLASTLAHHRSKPRVYIGCMKSGPVLAQKSLKYHEPEHWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE GNKYFRHATGQIYAIS+DLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  285  GEAGNKYFRHATGQIYAISRDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIKFVHEKCGEG+  +W +LF
Sbjct  345  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKFVHEKCGEGDAAVWGSLF  399



>ref|XP_007222961.1| hypothetical protein PRUPE_ppa006755mg [Prunus persica]
 gb|EMJ24160.1| hypothetical protein PRUPE_ppa006755mg [Prunus persica]
Length=396

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKFG
Sbjct  223  WDADFYVKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKFG  282

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R MC
Sbjct  283  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNMC  342

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCGEG+  +W++LF
Sbjct  343  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCGEGDAAVWSSLF  396



>ref|XP_004300420.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=396

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA+TL  HRSKPRVYIGCMKSGPVL+QK++KYHEPE WKF
Sbjct  222  KWDADFYVKVDDDVHVNLGMLASTLAHHRSKPRVYIGCMKSGPVLAQKSLKYHEPEHWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE GNKYFRHATGQIYAIS+DLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  282  GEAGNKYFRHATGQIYAISRDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIKFVHEKCGEG+  +W +LF
Sbjct  342  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKFVHEKCGEGDAAVWGSLF  396



>ref|XP_008233935.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Prunus 
mume]
Length=396

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKFG
Sbjct  223  WDADFYVKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKFG  282

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R MC
Sbjct  283  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNMC  342

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHEKCGEG+  +W++LF
Sbjct  343  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKHVHEKCGEGDAAVWSSLF  396



>ref|XP_009367326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Pyrus 
x bretschneideri]
Length=396

 Score =   348 bits (893),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGML  TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  222  QWDADFYVKVDDDVHVNLGMLGTTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  282  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  342  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  396



>gb|KJB64380.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=322

 Score =   345 bits (886),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA TLGRHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKF
Sbjct  148  KWDAEFYVKVDDDVHVNLGMLATTLGRHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKF  207

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R M
Sbjct  208  GEEGNKYFRHATGQIYAISKELATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNM  267

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+K VH++CGEG++ +WN L 
Sbjct  268  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKTVHKRCGEGDDAVWNTLL  322



>ref|XP_009367325.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Pyrus 
x bretschneideri]
Length=397

 Score =   348 bits (893),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGML  TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  223  QWDADFYVKVDDDVHVNLGMLGTTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  283  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  343  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  397



>ref|XP_009367323.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Pyrus 
x bretschneideri]
Length=400

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGML  TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  226  QWDADFYVKVDDDVHVNLGMLGTTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  285

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  286  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  345

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  346  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  400



>ref|XP_009367324.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Pyrus 
x bretschneideri]
Length=399

 Score =   348 bits (893),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGML  TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  225  QWDADFYVKVDDDVHVNLGMLGTTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  285  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  345  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  399



>ref|XP_007136194.1| hypothetical protein PHAVU_009G026100g [Phaseolus vulgaris]
 gb|ESW08188.1| hypothetical protein PHAVU_009G026100g [Phaseolus vulgaris]
Length=393

 Score =   348 bits (892),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLG+LA TL RHRSKPRVYIGCMKSGPVLS+K+VKYHEPE WKF
Sbjct  219  RWDADFYVKVDDDVHVNLGVLATTLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPEFWKF  278

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R M
Sbjct  279  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNM  338

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+ALF
Sbjct  339  CCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALF  393



>ref|XP_002302264.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE81537.1| galactosyltransferase family protein [Populus trichocarpa]
Length=390

 Score =   347 bits (891),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  216  KWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  275

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLGAWFIGLEV+HID+ +M
Sbjct  276  GEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLGAWFIGLEVEHIDDHSM  335

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCGEG+ ++W+ALF
Sbjct  336  CCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCGEGDGSVWSALF  390



>gb|KHN26051.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=327

 Score =   345 bits (884),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG+LA TL RHRSKPR+YIGCMKSGPVLS+++VKYHEPE WKF
Sbjct  153  KWDADFYVKVDDDVHVNLGVLATTLARHRSKPRIYIGCMKSGPVLSRRDVKYHEPEFWKF  212

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R+M
Sbjct  213  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRSM  272

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+AL
Sbjct  273  CCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSAL  326



>ref|XP_006578989.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Glycine 
max]
Length=397

 Score =   347 bits (890),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG+LA TL RHRSKPRVYIGCMKSGPVLS+K+VKYHEPE WKFG
Sbjct  224  WDADFYVKVDDDVHVNLGVLATTLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPEFWKFG  283

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  284  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  343

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG   +W+ALF
Sbjct  344  CGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGNGAVWSALF  397



>gb|KHN47065.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=363

 Score =   346 bits (887),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG+LA TL RHRSKPRVYIGCMKSGPVLS+K+VKYHEPE WKFG
Sbjct  190  WDADFYVKVDDDVHVNLGVLATTLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPEFWKFG  249

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  250  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  309

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG   +W+ALF
Sbjct  310  CGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGNGAVWSALF  363



>ref|XP_011027638.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Populus 
euphratica]
Length=389

 Score =   347 bits (889),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  215  KWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  274

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLGAWFIGLEV+HID+ +M
Sbjct  275  GEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLGAWFIGLEVEHIDDHSM  334

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCGEG+ ++W+ALF
Sbjct  335  CCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCGEGDGSVWSALF  389



>ref|XP_003523469.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Glycine 
max]
Length=394

 Score =   347 bits (890),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG+LA TL RHRSKPRVYIGCMKSGPVLS+K+VKYHEPE WKFG
Sbjct  221  WDADFYVKVDDDVHVNLGVLATTLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPEFWKFG  280

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  281  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  340

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG   +W+ALF
Sbjct  341  CGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGNGAVWSALF  394



>ref|XP_011027636.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Populus 
euphratica]
Length=392

 Score =   347 bits (890),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  218  KWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  277

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLGAWFIGLEV+HID+ +M
Sbjct  278  GEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLGAWFIGLEVEHIDDHSM  337

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCGEG+ ++W+ALF
Sbjct  338  CCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCGEGDGSVWSALF  392



>ref|XP_011027637.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Populus 
euphratica]
Length=390

 Score =   347 bits (889),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  216  KWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  275

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLGAWFIGLEV+HID+ +M
Sbjct  276  GEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLGAWFIGLEVEHIDDHSM  335

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCGEG+ ++W+ALF
Sbjct  336  CCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCGEGDGSVWSALF  390



>ref|XP_011027635.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Populus 
euphratica]
Length=393

 Score =   347 bits (889),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  219  KWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  278

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYIS+NQPILHKYANEDVSLGAWFIGLEV+HID+ +M
Sbjct  279  GEEGNKYFRHATGQIYAISKELATYISLNQPILHKYANEDVSLGAWFIGLEVEHIDDHSM  338

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKAQAG+VC+ASFDWSCSGICKSVE+IKFVHEKCGEG+ ++W+ALF
Sbjct  339  CCGTPPDCAWKAQAGDVCIASFDWSCSGICKSVERIKFVHEKCGEGDGSVWSALF  393



>ref|XP_010916559.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=398

 Score =   347 bits (889),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDA+FYVKVDDDVHVNLGMLAATL RHRSKPR YIGCMKSGPVLSQKNVKYHEPE WKFG
Sbjct  225  WDAEFYVKVDDDVHVNLGMLAATLARHRSKPRTYIGCMKSGPVLSQKNVKYHEPEYWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  285  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDERNMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE++K VH +CGEG++ +W+ALF
Sbjct  345  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERMKEVHARCGEGDDGVWSALF  398



>ref|XP_004515661.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Cicer 
arietinum]
Length=392

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG+LAATL RHR KPRVYIGCMKSGPVLS+K+VKYHEPE WKFG
Sbjct  219  WDADFYVKVDDDVHVNLGVLAATLARHRLKPRVYIGCMKSGPVLSRKDVKYHEPEFWKFG  278

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R+MC
Sbjct  279  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRSMC  338

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+ALF
Sbjct  339  CGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALF  392



>ref|XP_004515660.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Cicer 
arietinum]
Length=393

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG+LAATL RHR KPRVYIGCMKSGPVLS+K+VKYHEPE WKFG
Sbjct  220  WDADFYVKVDDDVHVNLGVLAATLARHRLKPRVYIGCMKSGPVLSRKDVKYHEPEFWKFG  279

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R+MC
Sbjct  280  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRSMC  339

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+ALF
Sbjct  340  CGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALF  393



>gb|KCW70545.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=313

 Score =   343 bits (880),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKFG
Sbjct  140  WDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKFG  199

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  200  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  259

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CGEG+  +W+AL 
Sbjct  260  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDALI  313



>gb|KJB64379.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=397

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA TLGRHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKF
Sbjct  223  KWDAEFYVKVDDDVHVNLGMLATTLGRHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R M
Sbjct  283  GEEGNKYFRHATGQIYAISKELATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+K VH++CGEG++ +WN L 
Sbjct  343  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKTVHKRCGEGDDAVWNTLL  397



>ref|XP_009367010.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Pyrus x bretschneideri]
Length=396

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  222  QWDADFYVKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  282  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CC TPPDCEWKAQAGN+CVASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  342  CCRTPPDCEWKAQAGNMCVASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  396



>ref|XP_002513842.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF48425.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=396

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLAATL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  222  KWDAEFYIKVDDDVHVNLGMLAATLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGLE++HID+R M
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLEIEHIDDRNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAG+VCVASFDWSCSGICKSVEK+KFVHE+C EG+  +W AL 
Sbjct  342  CCGTPPDCEWKAQAGSVCVASFDWSCSGICKSVEKMKFVHERCSEGDGAVWGALI  396



>gb|KJB64381.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=400

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA TLGRHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKF
Sbjct  226  KWDAEFYVKVDDDVHVNLGMLATTLGRHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKF  285

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R M
Sbjct  286  GEEGNKYFRHATGQIYAISKELATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNM  345

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+K VH++CGEG++ +WN L 
Sbjct  346  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKTVHKRCGEGDDAVWNTLL  400



>ref|XP_008338811.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Malus domestica]
Length=396

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  222  QWDADFYVKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  282  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CC TPPDCEWKAQAGN+C+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  342  CCRTPPDCEWKAQAGNMCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  396



>ref|XP_011097468.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Sesamum indicum]
Length=395

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG LAA L RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  221  KWDADFYVKVDDDVHVNLGALAANLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  280

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GN YFRHATGQIYAISKDLA+YISINQPILHKYANEDVSLG+WFIGLE++HID+R M
Sbjct  281  GEDGNNYFRHATGQIYAISKDLASYISINQPILHKYANEDVSLGSWFIGLEIEHIDDRNM  340

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CC TPPDCEWKAQAG++CVASFDWSCSGICKSVEK+KFVH++CGEGEE LWNAL 
Sbjct  341  CCSTPPDCEWKAQAGSMCVASFDWSCSGICKSVEKMKFVHQRCGEGEEALWNALL  395



>ref|XP_008378524.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X3 [Malus 
domestica]
Length=396

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGML  TL RH SKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  222  QWDADFYVKVDDDVHVNLGMLGTTLARHHSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  282  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  342  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  396



>ref|XP_008378523.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Malus 
domestica]
Length=398

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGML  TL RH SKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  224  QWDADFYVKVDDDVHVNLGMLGTTLARHHSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  283

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  284  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  343

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  344  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  398



>ref|XP_010277678.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Nelumbo nucifera]
Length=395

 Score =   345 bits (885),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA TL RHRSKPRVY+GCMKSGPVL QKNVKYHEPE WKF
Sbjct  221  KWDAEFYVKVDDDVHVNLGMLATTLARHRSKPRVYMGCMKSGPVLYQKNVKYHEPEYWKF  280

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HIDER M
Sbjct  281  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERNM  340

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIK VH +CGEG+  +WN L 
Sbjct  341  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKNVHSRCGEGKGAIWNTLL  395



>ref|XP_008378522.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Malus 
domestica]
Length=399

 Score =   345 bits (885),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGML  TL RH SKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  225  QWDADFYVKVDDDVHVNLGMLGTTLARHHSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  285  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  345  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  399



>ref|XP_008378526.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X4 [Malus 
domestica]
Length=395

 Score =   345 bits (885),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGML  TL RH SKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  221  QWDADFYVKVDDDVHVNLGMLGTTLARHHSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  280

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  281  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  340

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  341  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  395



>ref|XP_003526605.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Glycine 
max]
 gb|KHN09160.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=394

 Score =   345 bits (885),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG+LA TL RH SKPRVYIGCMKSGPVLS+K+VKYHEPE WKFG
Sbjct  221  WDADFYVKVDDDVHVNLGVLATTLARHLSKPRVYIGCMKSGPVLSRKDVKYHEPEFWKFG  280

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  281  EEGNKYFRHATGQIYAISKDLATYISINKPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  340

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIK+VH KCGEG+E +W+ALF
Sbjct  341  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKYVHSKCGEGDEAVWSALF  394



>ref|XP_006581562.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Glycine 
max]
Length=397

 Score =   345 bits (885),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG+LA TL RH SKPRVYIGCMKSGPVLS+K+VKYHEPE WKFG
Sbjct  224  WDADFYVKVDDDVHVNLGVLATTLARHLSKPRVYIGCMKSGPVLSRKDVKYHEPEFWKFG  283

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  284  EEGNKYFRHATGQIYAISKDLATYISINKPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  343

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIK+VH KCGEG+E +W+ALF
Sbjct  344  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKYVHSKCGEGDEAVWSALF  397



>gb|KCW70544.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=356

 Score =   343 bits (881),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKFG
Sbjct  183  WDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKFG  242

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  243  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  302

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CGEG+  +W+AL 
Sbjct  303  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDALI  356



>gb|KHN06134.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=397

 Score =   345 bits (884),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLG+LA TL RHRSKPRVY+GCMKSGPVLS+K+VKYHEPE WKF
Sbjct  223  KWDAEFYVKVDDDVHVNLGVLATTLARHRSKPRVYVGCMKSGPVLSRKDVKYHEPEFWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R+M
Sbjct  283  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRSM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+AL
Sbjct  343  CCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSAL  396



>ref|XP_006596309.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Glycine max]
Length=397

 Score =   345 bits (884),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLG+LA TL RHRSKPRVY+GCMKSGPVLS+K+VKYHEPE WKF
Sbjct  223  KWDAEFYVKVDDDVHVNLGVLATTLARHRSKPRVYVGCMKSGPVLSRKDVKYHEPEFWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R+M
Sbjct  283  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRSM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+AL
Sbjct  343  CCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSAL  396



>ref|XP_003542690.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Glycine max]
Length=397

 Score =   345 bits (884),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG+LA TL RHRSKPR+YIGCMKSGPVLS+++VKYHEPE WKF
Sbjct  223  KWDADFYVKVDDDVHVNLGVLATTLARHRSKPRIYIGCMKSGPVLSRRDVKYHEPEFWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R+M
Sbjct  283  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRSM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+AL
Sbjct  343  CCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSAL  396



>ref|XP_008352694.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Malus domestica]
Length=435

 Score =   346 bits (887),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  261  QWDADFYVKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPEYWKF  320

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  321  GEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  380

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CC TPPDCEWKAQAGN+C+ASFDWSCSGICKSVE+IK VHEKCGEG+  +W++LF
Sbjct  381  CCRTPPDCEWKAQAGNMCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  435



>ref|XP_002306601.2| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE93597.2| galactosyltransferase family protein [Populus trichocarpa]
Length=399

 Score =   343 bits (881),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVLSQ+N KYHEPE WKF
Sbjct  225  KWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQRNAKYHEPEYWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            G EGN YFRHATGQIYAISK+LATYISINQPILHKYANEDVSLGAWFIGLEV+ ID+R M
Sbjct  285  GVEGNNYFRHATGQIYAISKELATYISINQPILHKYANEDVSLGAWFIGLEVELIDDRNM  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKA AGNVC+ASFDWSCSGICKSVEKIKFVHEKCGEG+E++W+ LF
Sbjct  345  CCGTPPDCEWKALAGNVCIASFDWSCSGICKSVEKIKFVHEKCGEGDESVWSDLF  399



>gb|EPS64555.1| hypothetical protein M569_10226 [Genlisea aurea]
Length=393

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG LAATL R R+ PRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  219  KWDADFYVKVDDDVHVNLGTLAATLARRRATPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  278

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQ ILHKYANEDVSLG+WFIGLEV+HID+R M
Sbjct  279  GEEGNKYFRHATGQIYAISKDLATYISINQHILHKYANEDVSLGSWFIGLEVEHIDDRDM  338

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGN+CVASFDWSCSGICKSV+KI+FVH++CGEGE+ LWNAL 
Sbjct  339  CCGTPPDCEWKAQAGNLCVASFDWSCSGICKSVDKIQFVHQQCGEGEDALWNALI  393



>gb|KHG03200.1| Beta-1,3-galactosyltransferase 7 -like protein [Gossypium arboreum]
Length=397

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGML  TLGRHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKF
Sbjct  223  KWDAEFYVKVDDDVHVNLGMLGTTLGRHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R M
Sbjct  283  GEEGNKYFRHATGQIYAISKELATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNA  234
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEK+K VHE+CGEG++ +WN 
Sbjct  343  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKTVHERCGEGDDAVWNT  395



>ref|XP_010063326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70541.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=392

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKFG
Sbjct  219  WDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKFG  278

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  279  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  338

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CGEG+  +W+AL 
Sbjct  339  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDALI  392



>ref|XP_010063327.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Eucalyptus 
grandis]
Length=391

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKFG
Sbjct  218  WDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKFG  277

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  278  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  337

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CGEG+  +W+AL 
Sbjct  338  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDALI  391



>ref|XP_010063329.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Eucalyptus 
grandis]
 gb|KCW70543.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=388

 Score =   342 bits (878),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKFG
Sbjct  215  WDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKFG  274

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  275  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  334

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CGEG+  +W+AL 
Sbjct  335  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDALI  388



>ref|XP_010063328.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Eucalyptus 
grandis]
 gb|KCW70542.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=389

 Score =   342 bits (878),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLS KNVKYHEPE WKFG
Sbjct  216  WDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPEYWKFG  275

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+S+DLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R MC
Sbjct  276  EEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMC  335

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VH +CGEG+  +W+AL 
Sbjct  336  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDALI  389



>gb|AFK48973.1| unknown [Lotus japonicus]
Length=394

 Score =   342 bits (878),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG+LA+TL R+RSKPRVY+GCMKSGPVLS+K+VKYHEPE WKF
Sbjct  220  KWDADFYVKVDDDVHVNLGVLASTLARYRSKPRVYMGCMKSGPVLSRKDVKYHEPEFWKF  279

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG+W IGLEV+HIDER+M
Sbjct  280  GEEGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLGSWLIGLEVEHIDERSM  339

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGN+CVASFDWSCSGICKSVEKIK+VH KCGEG+  +W+AL 
Sbjct  340  CCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALL  394



>ref|XP_010943123.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=397

 Score =   342 bits (878),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RHRSKPR YIGCMKSGPVLS +NVKYHEPE WKFG
Sbjct  224  WDADFYVKVDDDVHVNLGMLATTLARHRSKPRTYIGCMKSGPVLSNQNVKYHEPEFWKFG  283

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQPILHKYANEDVSLGAWFIGL+V+HIDER MC
Sbjct  284  EEGNKYFRHATGQLYAISKDLATYISINQPILHKYANEDVSLGAWFIGLDVEHIDERNMC  343

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVE+I+ VH KCGEG+  +WNA F
Sbjct  344  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIRDVHAKCGEGDGAVWNAFF  397



>ref|XP_009401434.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Musa acuminata 
subsp. malaccensis]
Length=400

 Score =   342 bits (877),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RHRSKPR YIGCMKSGPVLS KNVKYHEPE WKFG
Sbjct  227  WDADFYVKVDDDVHVNLGMLATTLARHRSKPRTYIGCMKSGPVLSSKNVKYHEPEYWKFG  286

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLA YISINQ ILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  287  EDGNKYFRHATGQIYAISKDLAMYISINQAILHKYANEDVSLGSWFIGLEVEHIDERNMC  346

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHE+CGEG+ T+W+ LF
Sbjct  347  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHERCGEGDGTVWSTLF  400



>ref|XP_007141114.1| hypothetical protein PHAVU_008G168500g [Phaseolus vulgaris]
 gb|ESW13108.1| hypothetical protein PHAVU_008G168500g [Phaseolus vulgaris]
Length=397

 Score =   342 bits (876),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG+LA TL  HRSKPRVYIGCMKSGPVLS+K+VKYHEPE WKF
Sbjct  223  KWDADFYVKVDDDVHVNLGVLATTLTHHRSKPRVYIGCMKSGPVLSRKDVKYHEPEFWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R+M
Sbjct  283  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRSM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CCGTPPDCEWKA+AGN+C ASFDWSCSGICKSVEKIK+VH KCGEG+  +W+AL
Sbjct  343  CCGTPPDCEWKAEAGNICAASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSAL  396



>gb|KDO80826.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=300

 Score =   338 bits (867),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  126  KWDADFYVKVDDDVHVNLGMLATTLSRHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  185

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGLEV+HID+R M
Sbjct  186  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLEVEHIDDRNM  245

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLW  240
            CC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCGE +  +W
Sbjct  246  CCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCGEEDSAIW  296



>ref|XP_006846610.1| hypothetical protein AMTR_s00156p00023720 [Amborella trichopoda]
 gb|ERN08285.1| hypothetical protein AMTR_s00156p00023720 [Amborella trichopoda]
Length=396

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGML ATL RH+SKPRVYIGCMKSGPVLSQK+VKYHEPE WKF
Sbjct  222  KWDAEFYVKVDDDVHVNLGMLVATLARHQSKPRVYIGCMKSGPVLSQKSVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHA+GQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEV+HID+R+ 
Sbjct  282  GEEGNKYFRHASGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRSF  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIK VH +CGEG+  +W+AL
Sbjct  342  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKNVHTRCGEGDGAVWSAL  395



>ref|XP_009414059.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Musa acuminata 
subsp. malaccensis]
Length=397

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDA+FYVKVDDDVH+NLGMLA TL RHRSKPR YIGCMKSGPVLS KNVKYHEPE WKFG
Sbjct  224  WDAEFYVKVDDDVHLNLGMLATTLARHRSKPRTYIGCMKSGPVLSDKNVKYHEPEYWKFG  283

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+SKDLATYISIN PILHKYANEDVSLG+WFIGLEV+HIDER+MC
Sbjct  284  EEGNKYFRHATGQIYAVSKDLATYISINHPILHKYANEDVSLGSWFIGLEVEHIDERSMC  343

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDWSCSGICKSVEKIK VHE+CGEG+  +W+ALF
Sbjct  344  CGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHERCGEGDGAVWSALF  397



>ref|XP_008782246.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=399

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLAATL RHRSKPR YIGCMKSGPVLSQKNVKY EPE WKF
Sbjct  225  KWDADFYVKVDDDVHVNLGMLAATLARHRSKPRTYIGCMKSGPVLSQKNVKYREPEYWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG+W IGLEV+HIDER M
Sbjct  285  GEEGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLGSWLIGLEVEHIDERNM  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGICKS E++K VH++CGEG++ +W+ALF
Sbjct  345  CCGTPPDCEWKAQAGNVCIASFDWSCSGICKSDERMKEVHKRCGEGDDGVWSALF  399



>ref|XP_002269415.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 ref|XP_010652983.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 emb|CBI21654.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDA+FYVKVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVLSQK VKYHEPE WKF
Sbjct  223  QWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQKTVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+NQPILHKYANEDVSLGAWFIGLEV+HID+R +
Sbjct  283  GEEGNKYFRHATGQIYAISKDLATYISVNQPILHKYANEDVSLGAWFIGLEVEHIDDRNL  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+  F
Sbjct  343  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDGAIWSTPF  397



>ref|XP_010652984.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Vitis 
vinifera]
Length=396

 Score =   340 bits (871),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDA+FYVKVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVLSQK VKYHEPE WKF
Sbjct  222  QWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQKTVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+NQPILHKYANEDVSLGAWFIGLEV+HID+R +
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISVNQPILHKYANEDVSLGAWFIGLEVEHIDDRNL  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+  F
Sbjct  342  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDGAIWSTPF  396



>ref|XP_004142613.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Cucumis sativus]
 ref|XP_004163674.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Cucumis sativus]
Length=399

 Score =   340 bits (871),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVK+DDDVHVNLGMLA TL  HRSKPRVYIGCMKSGPVLS K+VKYHEPE WKF
Sbjct  225  KWDADFYVKIDDDVHVNLGMLATTLAHHRSKPRVYIGCMKSGPVLSSKSVKYHEPEYWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATY+++NQPILHKYANEDVSLGAW IGLEV+HID+R M
Sbjct  285  GEEGNKYFRHATGQIYAISKDLATYVAVNQPILHKYANEDVSLGAWLIGLEVEHIDDRNM  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VHEKCGEG   +W+AL 
Sbjct  345  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKSVHEKCGEGNGAVWSALI  399



>gb|KGN54610.1| hypothetical protein Csa_4G377730 [Cucumis sativus]
Length=397

 Score =   340 bits (871),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVK+DDDVHVNLGMLA TL  HRSKPRVYIGCMKSGPVLS K+VKYHEPE WKF
Sbjct  223  KWDADFYVKIDDDVHVNLGMLATTLAHHRSKPRVYIGCMKSGPVLSSKSVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATY+++NQPILHKYANEDVSLGAW IGLEV+HID+R M
Sbjct  283  GEEGNKYFRHATGQIYAISKDLATYVAVNQPILHKYANEDVSLGAWLIGLEVEHIDDRNM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VHEKCGEG   +W+AL 
Sbjct  343  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKSVHEKCGEGNGAVWSALI  397



>ref|XP_008444116.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Cucumis 
melo]
Length=397

 Score =   340 bits (871),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVK+DDDVHVNLGMLA TL  HRSKPRVYIGCMKSGPVLS K+VKYHEPE WKF
Sbjct  223  KWDADFYVKIDDDVHVNLGMLATTLAYHRSKPRVYIGCMKSGPVLSSKSVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYI++NQPILHKYANEDVSLGAW IGLEV+HID+R M
Sbjct  283  GEEGNKYFRHATGQIYAISKDLATYIAVNQPILHKYANEDVSLGAWLIGLEVEHIDDRNM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VHEKCGEG   +W+AL 
Sbjct  343  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKSVHEKCGEGNGAVWSALI  397



>ref|XP_008444117.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Cucumis 
melo]
Length=396

 Score =   339 bits (870),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVK+DDDVHVNLGMLA TL  HRSKPRVYIGCMKSGPVLS K+VKYHEPE WKF
Sbjct  222  KWDADFYVKIDDDVHVNLGMLATTLAYHRSKPRVYIGCMKSGPVLSSKSVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYI++NQPILHKYANEDVSLGAW IGLEV+HID+R M
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYIAVNQPILHKYANEDVSLGAWLIGLEVEHIDDRNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VHEKCGEG   +W+AL 
Sbjct  342  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKSVHEKCGEGNGAVWSALI  396



>ref|XP_010534616.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Tarenaya hassleriana]
Length=396

 Score =   339 bits (870),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGMLA+TL  HRSKPRVYIGCMKSGPVLSQK VKYHEPE WKF
Sbjct  222  KWDAEFYVKVDDDVHVNLGMLASTLAHHRSKPRVYIGCMKSGPVLSQKTVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKAQAGNVCVASFDWSCSGICKSVE++K VHE CGEGE  +WNAL 
Sbjct  342  CCGTPPDCAWKAQAGNVCVASFDWSCSGICKSVERMKPVHEMCGEGEGAVWNALL  396



>ref|XP_008802092.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=399

 Score =   339 bits (869),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDA FYVKVDDDVHVNLGMLAATL RHRSKPR YIGCMKSG VLSQKNVKYHEPE WKFG
Sbjct  226  WDAAFYVKVDDDVHVNLGMLAATLARHRSKPRTYIGCMKSGQVLSQKNVKYHEPEYWKFG  285

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATY+SINQPILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  286  EEGNKYFRHATGQIYAISKDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHIDERNMC  345

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDW+CSGICKSVE++K VH +CGEG++ +W+ LF
Sbjct  346  CGTPPDCEWKAQAGNVCIASFDWTCSGICKSVERMKEVHTRCGEGDDGVWSTLF  399



>ref|NP_001141176.1| hypothetical protein [Zea mays]
 gb|ACF85625.1| unknown [Zea mays]
 gb|AFW71912.1| hypothetical protein ZEAMMB73_862603 [Zea mays]
Length=300

 Score =   335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+SKPR YIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  127  WDADFYVKVDDDVHVNLGMLATTLARHKSKPRTYIGCMKSGPVLADKNVKYHEPEYWKFG  186

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  187  EEGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLGSWFIGLEVNHIDERNMC  246

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+AL
Sbjct  247  CGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDSAVWSAL  299



>gb|KDO80825.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=402

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  228  KWDADFYVKVDDDVHVNLGMLATTLSRHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  287

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGLEV+HID+R M
Sbjct  288  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLEVEHIDDRNM  347

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLW  240
            CC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCGE +  +W
Sbjct  348  CCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCGEEDSAIW  398



>gb|ACF79671.1| unknown [Zea mays]
 gb|AFW62682.1| avr9 elicitor response protein [Zea mays]
Length=398

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+ KPR YIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNLGMLATTLARHKLKPRTYIGCMKSGPVLADKNVKYHEPEYWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  285  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVNHIDERNMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+ALF
Sbjct  345  CGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDSAVWSALF  398



>ref|XP_004952712.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Setaria italica]
Length=398

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+SKPR YIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNLGMLATTLARHKSKPRTYIGCMKSGPVLADKNVKYHEPEYWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  285  EEGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLGSWFIGLEVNHIDERNMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+AL 
Sbjct  345  CGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDSAVWSALI  398



>gb|KDO80824.1| hypothetical protein CISIN_1g015683mg [Citrus sinensis]
Length=394

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  220  KWDADFYVKVDDDVHVNLGMLATTLSRHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  279

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGLEV+HID+R M
Sbjct  280  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLEVEHIDDRNM  339

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLW  240
            CC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCGE +  +W
Sbjct  340  CCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCGEEDSAIW  390



>ref|NP_001131318.1| uncharacterized protein LOC100192632 [Zea mays]
 gb|ACG38477.1| avr9 elicitor response protein [Zea mays]
Length=398

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+ KPR YIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNLGMLATTLARHKLKPRTYIGCMKSGPVLADKNVKYHEPEYWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  285  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVNHIDERNMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+ALF
Sbjct  345  CGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDSAVWSALF  398



>ref|XP_006434095.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
 gb|ESR47335.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
Length=394

 Score =   338 bits (868),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  220  KWDADFYVKVDDDVHVNLGMLATTLSRHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  279

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGLEV+HID+R M
Sbjct  280  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLEVEHIDDRNM  339

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLW  240
            CC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCGE +  +W
Sbjct  340  CCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCGEEDSAIW  390



>ref|XP_006434096.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
 gb|ESR47336.1| hypothetical protein CICLE_v10001364mg [Citrus clementina]
Length=402

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  228  KWDADFYVKVDDDVHVNLGMLATTLSRHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  287

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGLEV+HID+R M
Sbjct  288  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLEVEHIDDRNM  347

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLW  240
            CC TPPDCEWKAQAGNVCVASFDWSCSGICKSVEKI+ VHEKCGE +  +W
Sbjct  348  CCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIRSVHEKCGEEDSAIW  398



>ref|XP_006472695.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Citrus 
sinensis]
Length=394

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  220  KWDADFYVKVDDDVHVNLGMLATTLSRHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  279

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGLEV+HID+R M
Sbjct  280  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLEVEHIDDRNM  339

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLW  240
            CC TPPDCEWKAQAGNVCVASFDWSCSGICKSVE+I+ VHEKCGE +  +W
Sbjct  340  CCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIRSVHEKCGEEDAAIW  390



>ref|XP_008778068.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=234

 Score =   332 bits (850),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RHRSKPR YIGCMKSGPVLS KNVKYHEPE WKFG
Sbjct  61   WDADFYVKVDDDVHVNLGMLATTLARHRSKPRTYIGCMKSGPVLSNKNVKYHEPEFWKFG  120

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYI+INQPILHKYANEDVSLGAWFIGL+V+HIDER MC
Sbjct  121  EEGNKYFRHATGQIYAISKDLATYITINQPILHKYANEDVSLGAWFIGLDVEHIDERNMC  180

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            C TPPDCE KA+AGNVC+ASFDWSCSGICKSVE+IK VH KCGEG+  +WNA F
Sbjct  181  CKTPPDCEGKARAGNVCIASFDWSCSGICKSVERIKDVHAKCGEGDGAVWNAFF  234



>ref|XP_006472694.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Citrus 
sinensis]
Length=402

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL RHRSKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  228  KWDADFYVKVDDDVHVNLGMLATTLSRHRSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  287

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGLEV+HID+R M
Sbjct  288  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLEVEHIDDRNM  347

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLW  240
            CC TPPDCEWKAQAGNVCVASFDWSCSGICKSVE+I+ VHEKCGE +  +W
Sbjct  348  CCQTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIRSVHEKCGEEDAAIW  398



>ref|XP_006647402.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Oryza brachyantha]
Length=398

 Score =   337 bits (865),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+SKPR YIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNLGMLATTLARHKSKPRTYIGCMKSGPVLADKNVKYHEPEYWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  285  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVNHIDERNMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CGTPPDCEWK QAGNVCVASFDW+CSGICKSVE+IK VH +CGEG+  +W+AL
Sbjct  345  CGTPPDCEWKGQAGNVCVASFDWTCSGICKSVERIKEVHARCGEGDSAVWSAL  397



>dbj|BAD17751.1| putative avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 gb|EAY86345.1| hypothetical protein OsI_07722 [Oryza sativa Indica Group]
 gb|EAZ23493.1| hypothetical protein OsJ_07189 [Oryza sativa Japonica Group]
Length=400

 Score =   337 bits (864),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+SKPR YIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  227  WDADFYVKVDDDVHVNLGMLATTLARHKSKPRTYIGCMKSGPVLADKNVKYHEPEYWKFG  286

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGLEV+HIDER MC
Sbjct  287  EEGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLEVNHIDERNMC  346

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+AL 
Sbjct  347  CGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKEVHARCGEGDSAVWSALI  400



>ref|XP_002454032.1| hypothetical protein SORBIDRAFT_04g023470 [Sorghum bicolor]
 gb|EES07008.1| hypothetical protein SORBIDRAFT_04g023470 [Sorghum bicolor]
Length=398

 Score =   337 bits (864),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH++KPR YIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNLGMLATTLARHKTKPRTYIGCMKSGPVLADKNVKYHEPEYWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  285  EEGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLGSWFIGLEVNHIDERNMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+AL 
Sbjct  345  CGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDSAVWSALI  398



>gb|ACG41551.1| avr9 elicitor response protein [Zea mays]
Length=398

 Score =   337 bits (863),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+SKPR YIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNLGMLATTLARHKSKPRTYIGCMKSGPVLADKNVKYHEPEYWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  285  EEGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLGSWFIGLEVNHIDERNMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+AL
Sbjct  345  CGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDSAVWSAL  397



>ref|XP_008681428.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34486.1| unknown [Zea mays]
 gb|AFW71914.1| avr9 elicitor response protein isoform 1 [Zea mays]
 gb|AFW71915.1| avr9 elicitor response protein isoform 2 [Zea mays]
Length=398

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+SKPR YIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNLGMLATTLARHKSKPRTYIGCMKSGPVLADKNVKYHEPEYWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLG+WFIGLEV+HIDER MC
Sbjct  285  EEGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLGSWFIGLEVNHIDERNMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSVE+IK VH +CGEG+  +W+AL
Sbjct  345  CGTPPDCEWKGQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDSAVWSAL  397



>ref|XP_010672363.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=396

 Score =   335 bits (858),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG+LA+TL  +RSKPR+YIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  221  KWDADFYVKVDDDVHVNLGVLASTLAHYRSKPRIYIGCMKSGPVLAQKNVKYHEPEFWKF  280

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGL+V+HID+R M
Sbjct  281  GEDGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLDVEHIDDRNM  340

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLW  240
            CCGTPPDCEWKAQAGNVCVASFDWSCSGIC+SVEK+KFVHEKCGEG++ +W
Sbjct  341  CCGTPPDCEWKAQAGNVCVASFDWSCSGICQSVEKLKFVHEKCGEGDDGIW  391



>ref|XP_002285826.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Vitis vinifera]
 emb|CBI19088.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   335 bits (858),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLGML ATL  H SKPRVYIGCMKSGPVLSQKNVKYHEPE WKF
Sbjct  222  KWDAEFYVKVDDDVHVNLGMLVATLAHHHSKPRVYIGCMKSGPVLSQKNVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HIDER M
Sbjct  282  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHIDERNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGIC SVEKIK VH +CGEG+  +W+   
Sbjct  342  CCGTPPDCEWKAQAGNVCIASFDWSCSGICNSVEKIKDVHARCGEGDGAVWSDFL  396



>ref|XP_010672316.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=399

 Score =   335 bits (858),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG+LA+TL  +RSKPR+YIGCMKSGPVL+QKNVKYHEPE WKF
Sbjct  224  KWDADFYVKVDDDVHVNLGVLASTLAHYRSKPRIYIGCMKSGPVLAQKNVKYHEPEFWKF  283

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLATYISINQPILHK+ANEDVSLG+WFIGL+V+HID+R M
Sbjct  284  GEDGNKYFRHATGQIYAISKDLATYISINQPILHKFANEDVSLGSWFIGLDVEHIDDRNM  343

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLW  240
            CCGTPPDCEWKAQAGNVCVASFDWSCSGIC+SVEK+KFVHEKCGEG++ +W
Sbjct  344  CCGTPPDCEWKAQAGNVCVASFDWSCSGICQSVEKLKFVHEKCGEGDDGIW  394



>ref|XP_003575190.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Brachypodium 
distachyon]
Length=397

 Score =   333 bits (855),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+SKPR YIGCMKSGPVL+ KN+KYHEPESWKFG
Sbjct  224  WDADFYVKVDDDVHVNLGMLATTLARHKSKPRTYIGCMKSGPVLADKNLKYHEPESWKFG  283

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLATY+SINQ ILHKYANEDVSLG+WFIGLEV+HIDER+MC
Sbjct  284  EDGNKYFRHATGQIYAISKDLATYVSINQHILHKYANEDVSLGSWFIGLEVNHIDERSMC  343

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSV+++K VH +CGEG+ ++W+AL 
Sbjct  344  CGTPPDCEWKGQAGNVCVASFDWSCSGICKSVDRLKDVHARCGEGDSSVWSALI  397



>dbj|BAK03918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score =   333 bits (855),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGMLA TL RH+SKPR YIGCMKSGPVL+ KN+KYHEPE+WKFG
Sbjct  224  WDADFYVKVDDDVHVNLGMLATTLARHKSKPRTYIGCMKSGPVLADKNMKYHEPEAWKFG  283

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLG+WFIGLEV+HI ER MC
Sbjct  284  EDGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVNHIGERNMC  343

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGN+CVASFDWSCSGICKSVE++K VH +CGEG+ ++W+AL 
Sbjct  344  CGTPPDCEWKGQAGNMCVASFDWSCSGICKSVERLKDVHARCGEGDSSVWSALI  397



>ref|XP_001779676.1| predicted protein [Physcomitrella patens]
 gb|EDQ55472.1| predicted protein [Physcomitrella patens]
Length=398

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVN+GMLA TL RHR+KPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  223  KWDADFYVKVDDDVHVNVGMLATTLARHRTKPRVYIGCMKSGPVLAQKGVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYI +N+P+LHKYANEDVSLGAW IGL+VDHID+R+M
Sbjct  283  GEEGNKYFRHATGQIYAISKDLATYIDVNRPLLHKYANEDVSLGAWIIGLDVDHIDDRSM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNA  234
            CCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE++K VH++CGEG++ LW+ 
Sbjct  343  CCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERLKDVHQRCGEGDDALWST  395



>ref|XP_009106424.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Brassica 
rapa]
 emb|CDX87501.1| BnaA07g33720D [Brassica napus]
Length=383

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  209  RWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  268

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYA+SKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  269  GEEGNKYFRHATGQIYAVSKDLAKYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  328

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE+ +WNAL 
Sbjct  329  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEDAVWNALL  383



>ref|XP_009106423.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Brassica 
rapa]
Length=386

 Score =   332 bits (851),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  212  RWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  271

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYA+SKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  272  GEEGNKYFRHATGQIYAVSKDLAKYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  331

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE+ +WNAL 
Sbjct  332  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEDAVWNALL  386



>gb|ADE77778.1| unknown [Picea sitchensis]
Length=335

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL R+RSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  161  KWDADFYVKVDDDVHVNLGMLATTLSRYRSKPRIYIGCMKSGPVLAQKGVKYHEPEYWKF  220

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGN+YFRHATGQIYAIS+DLATYISIN PILH+YANEDVSLGAWFIGL+V+HIDER+M
Sbjct  221  GEEGNRYFRHATGQIYAISRDLATYISINSPILHRYANEDVSLGAWFIGLDVEHIDERSM  280

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE++K VH  C EG+  +W+ L 
Sbjct  281  CCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERLKEVHRTCSEGDGAVWSTLI  335



>ref|NP_001141890.1| hypothetical protein [Zea mays]
 gb|ACF87243.1| unknown [Zea mays]
 tpg|DAA61737.1| TPA: hypothetical protein ZEAMMB73_056797 [Zea mays]
 gb|AIG52083.1| pyrabactin resistance-like protein [Zea mays]
Length=398

 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVH+NLGML ATLGRH+ KPRVYIGCMKSGPVLS KN KYHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHLNLGMLVATLGRHKLKPRVYIGCMKSGPVLSDKNAKYHEPEFWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGL+V+HID+R MC
Sbjct  285  EDGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLDVEHIDDRDMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDW CSG+C  VE+IK+VH +CGEG++ +W+A F
Sbjct  345  CGTPPDCEWKAQAGNVCIASFDWRCSGVCNPVERIKYVHSRCGEGQDAIWSASF  398



>gb|KFK42176.1| hypothetical protein AALP_AA2G220800 [Arabis alpina]
Length=389

 Score =   332 bits (851),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA++Y+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  215  KWDAEYYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  274

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  275  GEDGNKYFRHATGQIYAISKDLANYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  334

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGEE +WNAL 
Sbjct  335  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEEAVWNALL  389



>gb|KFK42175.1| hypothetical protein AALP_AA2G220800 [Arabis alpina]
Length=386

 Score =   332 bits (850),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA++Y+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  212  KWDAEYYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  271

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  272  GEDGNKYFRHATGQIYAISKDLANYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  331

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGEE +WNAL 
Sbjct  332  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEEAVWNALL  386



>ref|XP_010911041.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=398

 Score =   332 bits (851),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL R+RSKPR YIGCMKSGPVLSQK+VKYHEPE WKF
Sbjct  224  KWDADFYVKVDDDVHVNLGMLAGTLARYRSKPRTYIGCMKSGPVLSQKDVKYHEPEYWKF  283

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYA+SKDLATYISINQPILHKYANEDVSLGAW IGLEV+HIDER M
Sbjct  284  GEDGNKYFRHATGQIYAVSKDLATYISINQPILHKYANEDVSLGAWLIGLEVEHIDERNM  343

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVC+ASFDWSCSGIC+S E++  VH+KC EG++ LW AL 
Sbjct  344  CCGTPPDCEWKAQAGNVCIASFDWSCSGICESDERMMEVHKKCSEGDDGLWRALL  398



>emb|CDX88390.1| BnaC06g38340D [Brassica napus]
Length=382

 Score =   331 bits (849),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  208  RWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  267

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  268  GEEGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  327

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE+ +WNAL 
Sbjct  328  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEDAVWNALL  382



>ref|XP_006836897.1| hypothetical protein AMTR_s00099p00123290 [Amborella trichopoda]
 gb|ERM99750.1| hypothetical protein AMTR_s00099p00123290 [Amborella trichopoda]
Length=419

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGML  TL R+RSKPR+YIGCMKSGPVLSQK VKYHEPE WKFG
Sbjct  246  WDADFYVKVDDDVHVNLGMLVTTLARYRSKPRIYIGCMKSGPVLSQKGVKYHEPEFWKFG  305

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLA YISIN PILH+YANEDVSLGAW +GLEV+H+D+RTMC
Sbjct  306  EEGNKYFRHATGQIYAISKDLAAYISINSPILHRYANEDVSLGAWLLGLEVEHVDDRTMC  365

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGNVCVASFDWSCSGICKSV+K+K VH  CGEGE  +WNA+ 
Sbjct  366  CGTPPDCEWKVQAGNVCVASFDWSCSGICKSVDKMKDVHNSCGEGETAVWNAII  419



>gb|ADE75915.1| unknown [Picea sitchensis]
Length=246

 Score =   326 bits (835),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLGMLA TL R+RSKPR+YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  72   KWDADFYVKVDDDVHVNLGMLATTLSRYRSKPRIYIGCMKSGPVLAQKGVKYHEPEYWKF  131

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGN+YFRHATGQIYAIS+DLATYISIN PILH+YANEDVSLGAWFIGL+V+HIDER+M
Sbjct  132  GEEGNRYFRHATGQIYAISRDLATYISINSPILHRYANEDVSLGAWFIGLDVEHIDERSM  191

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE++K VH  C EG+  +W+ L 
Sbjct  192  CCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERLKEVHRTCSEGDGAVWSTLI  246



>ref|XP_006301157.1| hypothetical protein CARUB_v10021555mg [Capsella rubella]
 gb|EOA34055.1| hypothetical protein CARUB_v10021555mg [Capsella rubella]
Length=395

 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  221  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  280

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  281  GEDGNKYFRHATGQIYAISKDLAKYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  340

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  341  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  395



>ref|XP_002988781.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ10043.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=399

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDAD+YVKVDDDVH+NLGML  TL RHRSKPR YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  225  KWDADYYVKVDDDVHINLGMLTVTLARHRSKPRAYIGCMKSGPVLAQKGVKYHEPEYWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GN+YFRHATGQ+YAIS+DLATYISINQPILHKYANEDVSLG+WFIGL+VDHID+R+ 
Sbjct  285  GEDGNRYFRHATGQVYAISRDLATYISINQPILHKYANEDVSLGSWFIGLDVDHIDDRSF  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAG+VCV SFDW+CSGIC+SVE++ FVH++CGEG+  +WNA+ 
Sbjct  345  CCGTPPDCEWKAQAGSVCVGSFDWTCSGICRSVERLGFVHQRCGEGDSAVWNAVL  399



>gb|AAG51626.1|AC012193_8 putative (Avr9) elicitor response protein; 70358-68256 [Arabidopsis 
thaliana]
Length=390

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  216  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  275

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  276  GEDGNKYFRHATGQIYAISKDLANYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  335

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  336  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  390



>gb|AGZ15279.1| putative Avr9 elicitor response protein, partial [Taraxacum brevicorniculatum]
Length=392

 Score =   330 bits (845),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA FYVKVDDDVHVNLGMLAATLGR++SKPRVY GCMKSGPVLSQKNVKYHEPE WKF
Sbjct  218  KWDAKFYVKVDDDVHVNLGMLAATLGRYQSKPRVYTGCMKSGPVLSQKNVKYHEPEYWKF  277

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS DLA YIS NQPILHK+ANEDVSLGAWFIGL+V+HID+R M
Sbjct  278  GEEGNKYFRHATGQIYAISNDLAAYISTNQPILHKFANEDVSLGAWFIGLDVEHIDDRNM  337

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKA+AGNVC+ASFDWSCSGIC+SVE++K VH++CGE    LW+AL+
Sbjct  338  CCGTPPDCEWKAEAGNVCIASFDWSCSGICRSVERLKDVHKRCGEDPAALWSALY  392



>gb|AHL38868.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=387

 Score =   329 bits (844),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  213  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  272

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  273  GEDGNKYFRHATGQIYAISKDLANYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  332

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  333  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  387



>ref|XP_001781844.1| predicted protein [Physcomitrella patens]
 gb|EDQ53299.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   329 bits (843),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KW+ADFYVKVDDDVHVNLG+L  TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  196  KWNADFYVKVDDDVHVNLGVLGTTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKF  255

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAIS+DLA YIS+NQP+LHK+ANEDVSLGAW IGL+VDHID+R+M
Sbjct  256  GEEGNKYFRHATGQIYAISRDLANYISVNQPLLHKFANEDVSLGAWIIGLDVDHIDDRSM  315

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE+I+ VH++CGEG+  +W+A+F
Sbjct  316  CCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERIQEVHQRCGEGDGAVWSAVF  370



>ref|NP_974164.2| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
 gb|AEE36030.1| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
Length=384

 Score =   329 bits (844),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  210  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  269

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  270  GEDGNKYFRHATGQIYAISKDLANYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  329

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  330  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  384



>ref|XP_002462477.1| hypothetical protein SORBIDRAFT_02g026360 [Sorghum bicolor]
 gb|EER98998.1| hypothetical protein SORBIDRAFT_02g026360 [Sorghum bicolor]
Length=410

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVH+NLGML ATLGRH+ KPRVYIGCMKSGPVLS KN KYHEPE WKFG
Sbjct  237  WDADFYVKVDDDVHLNLGMLIATLGRHKLKPRVYIGCMKSGPVLSDKNAKYHEPEFWKFG  296

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQ+YAISKDLATYISINQPILHKYANEDVSLGAWFIGL+V+HID+R MC
Sbjct  297  EDGNKYFRHATGQLYAISKDLATYISINQPILHKYANEDVSLGAWFIGLDVEHIDDRDMC  356

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDW CSG+C  VE++K+VH +C EGE+ +W+A F
Sbjct  357  CGTPPDCEWKAQAGNVCVASFDWQCSGVCNPVERLKYVHSRCSEGEDAIWSASF  410



>ref|XP_011097092.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Sesamum indicum]
Length=396

 Score =   329 bits (844),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDA+FYVKVDDDVHVNLG LAATL RHR+KPRVYIGCMKSGPVL QKNVKYHEPE WKFG
Sbjct  223  WDANFYVKVDDDVHVNLGALAATLARHRNKPRVYIGCMKSGPVLYQKNVKYHEPEYWKFG  282

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLA YISINQPILHKYANEDV+LGAWFIGLEV HID+R MC
Sbjct  283  EEGNKYFRHATGQIYAISKDLAKYISINQPILHKYANEDVTLGAWFIGLEVMHIDDRNMC  342

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVA+FDWSCSGIC SVE+IK VH KCGE   TL N+L 
Sbjct  343  CGTPPDCEWKAQAGNICVATFDWSCSGICNSVERIKIVHVKCGEDVTTLRNSLL  396



>ref|XP_006390051.1| hypothetical protein EUTSA_v10018693mg [Eutrema salsugineum]
 gb|ESQ27337.1| hypothetical protein EUTSA_v10018693mg [Eutrema salsugineum]
Length=388

 Score =   329 bits (843),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  214  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  273

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLA YISINQ ILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  274  GEEGNKYFRHATGQIYAISKDLAKYISINQQILHKYANEDVSLGSWFIGLEVEHIDDRNF  333

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VH+ C EGE  +WNAL 
Sbjct  334  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHQVCSEGEGAVWNALL  388



>ref|XP_001754566.1| predicted protein [Physcomitrella patens]
 gb|EDQ80536.1| predicted protein [Physcomitrella patens]
Length=391

 Score =   328 bits (842),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVN+GMLA TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  217  KWDAEFYVKVDDDVHVNVGMLATTLSRHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKF  276

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYI +N+P+LHKYANEDVSLGAW IGL+VDHID+R+M
Sbjct  277  GEEGNKYFRHATGQIYAISKDLATYIDVNRPLLHKYANEDVSLGAWIIGLDVDHIDDRSM  336

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDW+CSGICKSVE++  VH++CGEG++ LW+   
Sbjct  337  CCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERMNDVHQRCGEGDDALWSTTI  391



>ref|XP_010428866.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Camelina 
sativa]
Length=396

 Score =   329 bits (843),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  222  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  282  GEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  342  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  396



>ref|XP_010471980.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X4 [Camelina 
sativa]
Length=399

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  225  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  285  GEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  345  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  399



>ref|XP_002889162.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65421.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  221  KWDAEFYIKVDDDVHVNLGMLASTLVRHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  280

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  281  GEDGNKYFRHATGQIYAISKDLAKYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  340

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  341  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  395



>ref|XP_010471981.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X5 [Camelina 
sativa]
Length=396

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  222  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  282  GEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  342  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  396



>ref|XP_010428865.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Camelina 
sativa]
Length=399

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  225  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  285  GEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  345  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  399



>ref|XP_006441805.1| hypothetical protein CICLE_v10024512mg [Citrus clementina]
 gb|ESR55045.1| hypothetical protein CICLE_v10024512mg [Citrus clementina]
Length=410

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGML  TL  H+SKPR+YIGCMKSGPVLSQK VKYHEPE WKFG
Sbjct  237  WDADFYVKVDDDVHVNLGMLVNTLANHKSKPRIYIGCMKSGPVLSQKGVKYHEPEYWKFG  296

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLA YISIN PILH+YANEDVSLG+WFIGLEV+H+D+R+MC
Sbjct  297  EEGNKYFRHATGQIYAISKDLAAYISINLPILHRYANEDVSLGSWFIGLEVEHVDDRSMC  356

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKA+AGN CVASFDWSCSGICKSVE++K VH  CGEG++T+WN  F
Sbjct  357  CGTPPDCEWKAKAGNACVASFDWSCSGICKSVERMKIVHNSCGEGDDTVWNVDF  410



>ref|XP_006660681.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Oryza brachyantha]
Length=317

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGML  TLGRH+ KPRVYIGCMKSGPVL+ KN KYHEPE WKFG
Sbjct  144  WDADFYVKVDDDVHVNLGMLITTLGRHKLKPRVYIGCMKSGPVLADKNAKYHEPEFWKFG  203

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLGAWFIGL+V+HID+R MC
Sbjct  204  EDGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLGAWFIGLDVEHIDDRDMC  263

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC+ASFDW CSG+C  VE++K+VH +C EG++ +W+A F
Sbjct  264  CGTPPDCEWKAQAGNVCIASFDWKCSGVCNPVERLKYVHSRCSEGDDAIWSASF  317



>ref|XP_010416738.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Camelina 
sativa]
Length=429

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  255  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  314

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  315  GEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  374

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  375  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  429



>ref|XP_010416737.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Camelina 
sativa]
Length=432

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  258  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  317

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GNKYFRHATGQIYAISKDLA YIS+NQPILHKYANEDVSLG+WFIGLEV+HID+R  
Sbjct  318  GEDGNKYFRHATGQIYAISKDLAKYISVNQPILHKYANEDVSLGSWFIGLEVEHIDDRNF  377

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  378  CCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  432



>ref|XP_010278672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  232  WDADFYVKVDDDVHVNIATLGTTLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  291

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATY+SINQ +LHKYANEDVSLGAWFIGL+V+HID+R +C
Sbjct  292  EEGNKYFRHATGQLYAISKDLATYMSINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLC  351

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH++CGEGE  LW+A+F
Sbjct  352  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSAERIKEVHQRCGEGENALWSAVF  405



>ref|XP_003576598.1| PREDICTED: probable beta-1,3-galactosyltransferase 5 [Brachypodium 
distachyon]
Length=398

 Score =   327 bits (837),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGM   TLGRH+ KPRVYIGCMKSGPVLS KN KYHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNLGMFITTLGRHKLKPRVYIGCMKSGPVLSDKNSKYHEPEFWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLATYIS+NQP+LHKYANEDVSLGAWFIGL+V+H+D+R MC
Sbjct  285  EDGNKYFRHATGQIYAISKDLATYISVNQPLLHKYANEDVSLGAWFIGLDVEHVDDRDMC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNA  234
            CGTPPDCEWKAQAGNVCVASFDW CSG+C  VE++K+VH +CGEG+E +W A
Sbjct  345  CGTPPDCEWKAQAGNVCVASFDWRCSGVCNPVERLKYVHSRCGEGDEAIWGA  396



>gb|KDP39142.1| hypothetical protein JCGZ_00899 [Jatropha curcas]
Length=404

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKFG
Sbjct  231  WDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKFG  290

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAIS DLATY+SINQ +LHKYANEDVSLG+WFIGL+VDHID+R +C
Sbjct  291  EEGNKYFRHATGQLYAISNDLATYVSINQHVLHKYANEDVSLGSWFIGLDVDHIDDRRLC  350

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKSV++IK VH +CGEGE  LW+A F
Sbjct  351  CGTPPDCEWKAQAGNICVASFDWSCSGICKSVDRIKEVHRRCGEGENALWSAEF  404



>ref|NP_001063339.1| Os09g0452900 [Oryza sativa Japonica Group]
 dbj|BAD38021.1| putative Avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 dbj|BAF25253.1| Os09g0452900 [Oryza sativa Japonica Group]
 dbj|BAG90885.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84687.1| hypothetical protein OsI_31612 [Oryza sativa Indica Group]
 gb|EEE69834.1| hypothetical protein OsJ_29598 [Oryza sativa Japonica Group]
Length=393

 Score =   326 bits (836),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGML  TLGRH+ KPRVYIGCMKSGPVL+ KNVKYHEPE WKFG
Sbjct  220  WDADFYVKVDDDVHVNLGMLITTLGRHKLKPRVYIGCMKSGPVLADKNVKYHEPEFWKFG  279

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLATYISIN+PILHKYANEDVSLGAWFIGL+V+HID+R MC
Sbjct  280  EDGNKYFRHATGQIYAISKDLATYISINRPILHKYANEDVSLGAWFIGLDVEHIDDRDMC  339

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDW CSG+C  VE++K+VH +C EG++ +W+A F
Sbjct  340  CGTPPDCEWKAQAGNICVASFDWKCSGVCNPVERLKYVHSRCSEGDDAIWSASF  393



>ref|XP_004956987.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Setaria italica]
Length=392

 Score =   326 bits (836),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVH+N+GML ATLGRH+ KPRVYIGCMKSGPVLS KN KYHEPE WKFG
Sbjct  219  WDADFYVKVDDDVHLNIGMLVATLGRHKLKPRVYIGCMKSGPVLSDKNAKYHEPEFWKFG  278

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGL+V+HID+R MC
Sbjct  279  EDGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLDVEHIDDRDMC  338

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAG+VCVASFDW CSG+C  VE++K+VH +C EGE+ +W+  F
Sbjct  339  CGTPPDCEWKAQAGSVCVASFDWKCSGVCNPVERLKYVHSRCSEGEDAIWSTSF  392



>ref|XP_009612460.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=398

 Score =   326 bits (836),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G LAATL RHRS PRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNIGALAATLARHRSTPRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GN+YFRHATGQ+YAISKDLATYISIN+ ILHKYANEDV+LG+WFIGL+V+HID+R +C
Sbjct  285  EDGNRYFRHATGQLYAISKDLATYISINRHILHKYANEDVTLGSWFIGLDVEHIDDRKLC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCE KAQAGN+CVASFDWSCSGICKSVE+IK VH +CGEGE  LW+A+F
Sbjct  345  CGTPPDCELKAQAGNICVASFDWSCSGICKSVERIKEVHSRCGEGENALWSAIF  398



>ref|XP_006365959.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=395

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G LAATL  HRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  222  WDADFYVKVDDDVHVNIGTLAATLATHRSKPRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  281

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQ+YAISKDLATYISIN+ ILHKYANEDV+LG+WFIGL+V+HID+R MC
Sbjct  282  EDGNKYFRHATGQLYAISKDLATYISINRHILHKYANEDVTLGSWFIGLDVEHIDDRKMC  341

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQ GN+CVASFDWSCSGICKSV++IK VH +CGEGE  LW+ +F
Sbjct  342  CGTPPDCEWKAQTGNICVASFDWSCSGICKSVDRIKEVHRRCGEGENALWSTVF  395



>ref|XP_009361001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=365

 Score =   325 bits (832),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  192  WDADFYVKVDDDVHVNIGTLGATLARHRPKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  251

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ +LHKY NEDVSLG+WFIGL+V+ +D+R +C
Sbjct  252  EEGNKYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLGSWFIGLDVEQVDDRRLC  311

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH +CGEGE  LWNA F
Sbjct  312  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHRRCGEGENALWNAAF  365



>ref|XP_009774309.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=409

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  236  WDADFYVKVDDDVHVNIGALGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  295

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GN+YFRHATGQ+YAISKDLATYISINQ +LHKY NEDVSLG+W IGL+V+HID+R +C
Sbjct  296  EDGNRYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLGSWLIGLDVEHIDDRRLC  355

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+SV++IK VH +CGEGE  LWNA+F
Sbjct  356  CGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCGEGENALWNAVF  409



>ref|XP_009610750.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Nicotiana 
tomentosiformis]
Length=409

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  236  WDADFYVKVDDDVHVNIGALGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  295

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GN+YFRHATGQ+YAISKDLATYISINQ +LHKY NEDVSLG+W IGL+V+HID+R +C
Sbjct  296  EDGNRYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLGSWLIGLDVEHIDDRRLC  355

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+SV++IK VH +CGEGE  LWNA+F
Sbjct  356  CGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCGEGENALWNAVF  409



>ref|XP_007211967.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
 gb|EMJ13166.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
Length=404

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHRS PRVYIGCMKSGPVL++K V+YHEPE WKFG
Sbjct  231  WDADFYVKVDDDVHVNIGTLGATLARHRSNPRVYIGCMKSGPVLARKGVRYHEPEYWKFG  290

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+V+ ID+R +C
Sbjct  291  EEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLC  350

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH +CGEGE  LWNA+F
Sbjct  351  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHRRCGEGENALWNAVF  404



>emb|CAN63417.1| hypothetical protein VITISV_007689 [Vitis vinifera]
Length=373

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSKPR+YIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  200  WDADFYVKVDDDVHVNIATLGATLARHRSKPRIYIGCMKSGPVLAQKGVRYHEPEYWKFG  259

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+ +HID+R +C
Sbjct  260  EEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLC  319

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+I+ VH +CGEGE  +W+A+F
Sbjct  320  CGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRCGEGENAVWSAVF  373



>ref|XP_006855892.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
 gb|ERN17359.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
Length=405

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHR+KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  232  WDADFYIKVDDDVHVNIATLGTTLVRHRAKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  291

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLGAWFIGL+V+HID+R +C
Sbjct  292  EEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLC  351

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKS E+IK VH++CGEGE  LW+A+F
Sbjct  352  CGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHQRCGEGEHALWSAVF  405



>ref|XP_008226885.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Prunus mume]
Length=403

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHRS PRVYIGCMKSGPVL++K V+YHEPE WKFG
Sbjct  230  WDADFYVKVDDDVHVNIGTLGATLARHRSNPRVYIGCMKSGPVLARKGVRYHEPEYWKFG  289

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+V+ ID+R +C
Sbjct  290  EEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLC  349

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDW+CSGICKS E+IK VH +CGEGE  LWNA+F
Sbjct  350  CGTPPDCEWKAQAGNVCVASFDWTCSGICKSSERIKEVHRRCGEGENALWNAVF  403



>ref|XP_008226884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Prunus mume]
Length=404

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHRS PRVYIGCMKSGPVL++K V+YHEPE WKFG
Sbjct  231  WDADFYVKVDDDVHVNIGTLGATLARHRSNPRVYIGCMKSGPVLARKGVRYHEPEYWKFG  290

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+V+ ID+R +C
Sbjct  291  EEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLC  350

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDW+CSGICKS E+IK VH +CGEGE  LWNA+F
Sbjct  351  CGTPPDCEWKAQAGNVCVASFDWTCSGICKSSERIKEVHRRCGEGENALWNAVF  404



>ref|XP_004162968.1| PREDICTED: probable beta-1,3-galactosyltransferase 6-like, partial 
[Cucumis sativus]
Length=199

 Score =   318 bits (814),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADF++KVDDDVH+NLGM+ +TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  25   KWDADFFIKVDDDVHINLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKF  84

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+PILHK+ANEDVSLG+WFIGL+V+HID+R++
Sbjct  85   GEEGNKYFRHATGQIYAISKDLATYISVNRPILHKFANEDVSLGSWFIGLDVEHIDDRSL  144

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTP DCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG+E +W+  F
Sbjct  145  CCGTPLDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  199



>ref|XP_007039332.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY23833.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=397

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  223  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  283  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG+E +W+  F
Sbjct  343  CCGTPPDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  397



>ref|XP_006478362.1| PREDICTED: probable beta-1,3-galactosyltransferase 8-like [Citrus 
sinensis]
Length=428

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGML  +L  H+SKPR+YIGCMKSGPVLSQK VKYHEPE WKFG
Sbjct  255  WDADFYVKVDDDVHVNLGMLVNSLANHKSKPRIYIGCMKSGPVLSQKGVKYHEPEYWKFG  314

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLA YISIN PILH+YANEDVSLG+WFIGLEV+H+D+R+MC
Sbjct  315  EEGNKYFRHATGQIYAISKDLAGYISINLPILHRYANEDVSLGSWFIGLEVEHVDDRSMC  374

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKA+AGN CVASFDWSCSGICKSVE++K VH  CGEG++T+WN  F
Sbjct  375  CGTPPDCEWKAKAGNACVASFDWSCSGICKSVERMKIVHNSCGEGDDTVWNVDF  428



>ref|XP_002529902.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF32456.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=238

 Score =   319 bits (817),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVL+ K VKYHEPE WKFG
Sbjct  65   WDADFYVKVDDDVHVNIATLGTTLARHRSKPRVYIGCMKSGPVLAHKGVKYHEPEYWKFG  124

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  125  EEGNKYFRHATGQLYAISNDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  184

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGICKSVE+IK VH +CGEGE  LW+A F
Sbjct  185  CGTPPDCEWKAQAGNICVASFDWSCSGICKSVERIKEVHGRCGEGENALWSAEF  238



>ref|XP_007039333.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY23834.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
Length=402

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  228  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKF  287

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  288  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  347

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG+E +W+  F
Sbjct  348  CCGTPPDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  402



>emb|CDP05735.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RH SKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  230  WDADFYVKVDDDVHVNIGTLGATLSRHLSKPRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  289

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  290  EYGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRQLC  349

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDW CSGIC SVE+IK VH +CGEGE  LWNA+F
Sbjct  350  CGTPPDCEWKAQAGNICVASFDWRCSGICNSVERIKEVHRRCGEGENALWNAVF  403



>ref|XP_010252349.1| PREDICTED: probable beta-1,3-galactosyltransferase 8 [Nelumbo 
nucifera]
Length=397

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDD+HVNLGMLA+ L ++RSKPR+YIGCMKSGPVLSQK VKYHEPE WKFG
Sbjct  220  WDADFYVKVDDDIHVNLGMLASRLAQYRSKPRIYIGCMKSGPVLSQKGVKYHEPEFWKFG  279

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLA Y+SIN PILH+YANEDVSLG+W IGLEV+HID+R+MC
Sbjct  280  EEGNKYFRHATGQIYAISKDLAAYVSINAPILHRYANEDVSLGSWLIGLEVEHIDDRSMC  339

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWN  237
            CGTPPDCEWK QAGNVCVASFDWSCSG+CKSVE++K VH  CGEGE  +WN
Sbjct  340  CGTPPDCEWKTQAGNVCVASFDWSCSGVCKSVERMKDVHNTCGEGERAVWN  390



>ref|XP_010063020.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW70193.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=402

 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  229  WDADFYVKVDDDVHVNIATLGATLMRHRSKPRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  288

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGN+YFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+ +HID+R +C
Sbjct  289  EEGNRYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLC  348

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE++K VH +CGEGE  LW+  F
Sbjct  349  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERMKVVHRRCGEGENVLWSTAF  402



>ref|XP_010063019.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Eucalyptus grandis]
 gb|KCW70192.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=403

 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  230  WDADFYVKVDDDVHVNIATLGATLMRHRSKPRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  289

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGN+YFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+ +HID+R +C
Sbjct  290  EEGNRYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLC  349

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE++K VH +CGEGE  LW+  F
Sbjct  350  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERMKVVHRRCGEGENVLWSTAF  403



>ref|XP_006475058.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
 ref|XP_006475059.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X4 [Citrus sinensis]
 gb|KDO62742.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=367

 Score =   323 bits (827),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  194  WDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  253

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLA+YISINQ +LHK+ANEDVSLG+WFIGL+ +HID+R +C
Sbjct  254  EEGNKYFRHATGQLYAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLC  313

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGIC+S E++K VH +CGEGE  LW+A F
Sbjct  314  CGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERMKEVHRRCGEGENALWSAAF  367



>ref|XP_010929797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Elaeis 
guineensis]
Length=411

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHRS PRVYIGCMKSGPVL++K V+YHEPE WKFG
Sbjct  238  WDADFYIKVDDDVHVNIATLGTTLARHRSNPRVYIGCMKSGPVLARKGVRYHEPEYWKFG  297

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQIYAISKDLATYISINQ +LH+YANEDVSLGAWFIGL+V+HID+R +C
Sbjct  298  EEGNKYFRHATGQIYAISKDLATYISINQHVLHRYANEDVSLGAWFIGLDVEHIDDRRLC  357

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+I+ VH +CGEGE  LW+A+F
Sbjct  358  CGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIREVHRRCGEGENALWSAIF  411



>ref|XP_009361000.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=403

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  230  WDADFYVKVDDDVHVNIGTLGATLARHRPKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  289

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ +LHKY NEDVSLG+WFIGL+V+ +D+R +C
Sbjct  290  EEGNKYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLGSWFIGLDVEQVDDRRLC  349

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH +CGEGE  LWNA F
Sbjct  350  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHRRCGEGENALWNAAF  403



>ref|XP_009774684.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Nicotiana sylvestris]
Length=279

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLG LAATL R+R K  VYIGCMKSGPVL  KNVKYHEPE WKF
Sbjct  105  KWDAEFYVKVDDDVHVNLGTLAATLARNRLKSMVYIGCMKSGPVLYHKNVKYHEPEFWKF  164

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE GNKYFRHATGQIYAISKDLATYI+ N+PILHKYANEDVSLGAW IGLEV+HIDER+M
Sbjct  165  GEAGNKYFRHATGQIYAISKDLATYIANNRPILHKYANEDVSLGAWLIGLEVEHIDERSM  224

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPP+CEWKAQAGNVCVASF+WSCSGIC+SVE+IK VH KCGE   TLW AL 
Sbjct  225  CCGTPPECEWKAQAGNVCVASFEWSCSGICRSVERIKHVHAKCGETAATLWGALL  279



>ref|XP_010675728.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVN+  L ATL RHRSKPR+YIGCMKSGPVL+QK V+YHEPE WKF
Sbjct  225  KWDAEFYVKVDDDVHVNIATLGATLIRHRSKPRLYIGCMKSGPVLAQKGVRYHEPEHWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            G++GNKYFRHATGQ+YAIS+DLATYISINQ +LHKYANEDVSLGAWFIGL+V+HID+R +
Sbjct  285  GDDGNKYFRHATGQLYAISRDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRL  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGNVCVASFDW+CSG+CKSVE++K VH +CGEGE+ LW+A F
Sbjct  345  CCGTPPDCEWKAQAGNVCVASFDWTCSGVCKSVERMKEVHRRCGEGEKALWSATF  399



>ref|XP_007039335.1| Beta-1,3-galactosyltransferase 6 isoform 4 [Theobroma cacao]
 gb|EOY23836.1| Beta-1,3-galactosyltransferase 6 isoform 4 [Theobroma cacao]
Length=429

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  255  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKF  314

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  315  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  374

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG+E +W+  F
Sbjct  375  CCGTPPDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  429



>ref|XP_010276120.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nelumbo 
nucifera]
Length=404

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  231  WDADFYIKVDDDVHVNIATLGMTLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  290

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLGAWFIG++V+HID+R +C
Sbjct  291  EQGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGVDVEHIDDRRLC  350

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVC ASFDWSCSGIC+S E+IK VH++CGEGE+ LW+A+F
Sbjct  351  CGTPPDCEWKAQAGNVCAASFDWSCSGICRSAERIKEVHQRCGEGEKALWSAVF  404



>ref|XP_008804298.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Phoenix 
dactylifera]
Length=411

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDD+HVN+G L  TL RHRS PRVYIGCMKSGPVL++K V+YHEPE WKFG
Sbjct  238  WDADFYVKVDDDIHVNIGTLGLTLARHRSNPRVYIGCMKSGPVLARKGVRYHEPEYWKFG  297

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGN+YFRHATGQIYAISKDLATYISINQ +LHKYANEDVSLGAWFIGL+V+HID+R +C
Sbjct  298  EEGNRYFRHATGQIYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLC  357

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+++ VH +CGEGE  LW+A F
Sbjct  358  CGTPPDCEWKAQAGNICVASFDWSCSGICRSAERVREVHRRCGEGENALWSATF  411



>ref|XP_006439187.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
 gb|ESR52427.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
Length=314

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVL QK VKYHEPE WKF
Sbjct  140  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLGQKGVKYHEPEYWKF  199

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  200  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  259

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGT PDCEWKAQAGN C ASFDWSCSG+CKSVE++  VH++CGEG+E +W+  F
Sbjct  260  CCGTAPDCEWKAQAGNPCAASFDWSCSGVCKSVERMGEVHQRCGEGDEAIWHTSF  314



>gb|KJB26942.1| hypothetical protein B456_004G268200 [Gossypium raimondii]
Length=391

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDA+FYVKVDDDVH+NLGMLA TL ++RSKPRVYIGCMKSGPVLS+K VKYHEPE WKFG
Sbjct  218  WDAEFYVKVDDDVHLNLGMLATTLAQYRSKPRVYIGCMKSGPVLSEKGVKYHEPEYWKFG  277

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIY ISKDLA YISIN PILH+YANEDVSLG+W IGLEV+H+D+R+MC
Sbjct  278  EDGNKYFRHATGQIYGISKDLAAYISINSPILHRYANEDVSLGSWLIGLEVEHVDDRSMC  337

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSG+CKSVEK+K+VH  CGEG+  +W + F
Sbjct  338  CGTPPDCEWKAQAGNICVASFDWSCSGVCKSVEKMKYVHNSCGEGDSGIWKSDF  391



>ref|XP_008437459.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 isoform 
X1 [Cucumis melo]
Length=405

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADF++KVDDDVH+NLGM+ +TL RHRSKPRVYIGCMKSGPVL+Q  VKYHEPE WKF
Sbjct  231  KWDADFFIKVDDDVHINLGMVGSTLARHRSKPRVYIGCMKSGPVLAQSGVKYHEPEYWKF  290

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+PILHKYANEDVSLG+WFIGL+V+HID+R++
Sbjct  291  GEEGNKYFRHATGQIYAISKDLATYISVNRPILHKYANEDVSLGSWFIGLDVEHIDDRSL  350

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTP DCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG+E +W+  F
Sbjct  351  CCGTPLDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  405



>ref|XP_011461040.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=406

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDA+FYVKVDDDVHVN+G L  TLGRHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  233  WDAEFYVKVDDDVHVNIGTLGTTLGRHRLKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  292

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAIS+DLATYISINQ +LHKY NEDVSLG+W +GL+V+HID+R +C
Sbjct  293  EEGNKYFRHATGQLYAISRDLATYISINQHVLHKYVNEDVSLGSWLLGLDVEHIDDRRLC  352

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VH +CGEGE  LW+A+F
Sbjct  353  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKEVHRRCGEGENALWSAVF  406



>gb|KDO76779.1| hypothetical protein CISIN_1g021312mg [Citrus sinensis]
Length=314

 Score =   320 bits (819),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVL QK VKYHEPE WKF
Sbjct  140  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLGQKGVKYHEPEYWKF  199

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  200  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  259

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGT PDCEWKAQAGN C ASFDWSCSG+CKSVE++  VH++CGEG+E +W+  F
Sbjct  260  CCGTAPDCEWKAQAGNPCAASFDWSCSGVCKSVERMGEVHQRCGEGDEAIWHTSF  314



>ref|XP_001758882.1| predicted protein [Physcomitrella patens]
 gb|EDQ76388.1| predicted protein [Physcomitrella patens]
Length=398

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFYVKVDDDVHVNLG+L  TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  223  KWDADFYVKVDDDVHVNLGVLGTTLARHRSKPRVYIGCMKSGPVLNQKGVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYA+SKDLA YI++NQ +LHKYANEDVSLGAW IGL+V H+D+R M
Sbjct  283  GEEGNKYFRHATGQIYALSKDLANYIAVNQLLLHKYANEDVSLGAWIIGLDVSHVDDRNM  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKA AGN+CVASFDW+CSGICKSVE+IK VH++CGEG++ +W+A+F
Sbjct  343  CCGTPPDCEWKALAGNICVASFDWTCSGICKSVERIKEVHQRCGEGDDAVWSAVF  397



>ref|XP_006592811.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Glycine max]
Length=371

 Score =   322 bits (825),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  198  WDADFYIKVDDDVHVNIATLGQTLLRHRSKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFG  257

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYIS N+ +LHKYANEDVSLG+WFIGL+VDHID+R +C
Sbjct  258  EAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHIDDRRLC  317

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH++CGEGE+ LWNA F
Sbjct  318  CGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  371



>ref|XP_004294404.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDA+FYVKVDDDVHVN+G L  TLGRHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  234  WDAEFYVKVDDDVHVNIGTLGTTLGRHRLKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  293

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAIS+DLATYISINQ +LHKY NEDVSLG+W +GL+V+HID+R +C
Sbjct  294  EEGNKYFRHATGQLYAISRDLATYISINQHVLHKYVNEDVSLGSWLLGLDVEHIDDRRLC  353

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVE+IK VH +CGEGE  LW+A+F
Sbjct  354  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKEVHRRCGEGENALWSAVF  407



>ref|XP_002279814.2| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI26647.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSKPR+YIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  232  WDADFYVKVDDDVHVNIATLGATLARHRSKPRIYIGCMKSGPVLAQKGVRYHEPEYWKFG  291

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+ +HID+R +C
Sbjct  292  EEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLC  351

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+I+ VH +CGEGE  +W+A+F
Sbjct  352  CGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRCGEGENAVWSAVF  405



>ref|XP_006439188.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
 gb|ESR52428.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
Length=229

 Score =   316 bits (810),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVL QK VKYHEPE WKF
Sbjct  55   KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLGQKGVKYHEPEYWKF  114

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  115  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  174

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGT PDCEWKAQAGN C ASFDWSCSG+CKSVE++  VH++CGEG+E +W+  F
Sbjct  175  CCGTAPDCEWKAQAGNPCAASFDWSCSGVCKSVERMGEVHQRCGEGDEAIWHTSF  229



>ref|XP_004159203.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2-like [Cucumis sativus]
Length=407

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  234  WDADFYIKVDDDVHVNIATLGETLVRHRSKPRVYIGCMKSGPVLSQKGVRYHEPEHWKFG  293

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  294  EFGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  353

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CGEGE TLW+A F
Sbjct  354  CGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENTLWSATF  407



>ref|XP_011095407.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  232  WDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  291

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  292  EHGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  351

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC S ++IK VH +CGEGE  LWN+ F
Sbjct  352  CGTPPDCEWKAQAGNICVASFDWSCSGICNSADRIKEVHRRCGEGETVLWNSAF  405



>ref|XP_008455443.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=407

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  234  WDADFYIKVDDDVHVNIATLGETLVRHRSKPRVYIGCMKSGPVLSQKGVRYHEPEHWKFG  293

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  294  EFGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  353

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CGEGE TLW+A F
Sbjct  354  CGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENTLWSATF  407



>ref|XP_004144497.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN43517.1| hypothetical protein Csa_7G043590 [Cucumis sativus]
Length=407

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  234  WDADFYIKVDDDVHVNIATLGETLVRHRSKPRVYIGCMKSGPVLSQKGVRYHEPEHWKFG  293

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  294  EFGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  353

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CGEGE TLW+A F
Sbjct  354  CGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENTLWSATF  407



>ref|XP_006375531.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53328.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=303

 Score =   319 bits (817),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  130  WDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFG  189

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+VDHID+R +C
Sbjct  190  EAGNKYFRHATGQLYAISKDLATYISINQHLLHKYANEDVSLGSWFIGLDVDHIDDRRLC  249

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE+ LW A F
Sbjct  250  CGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  303



>gb|KDP25226.1| hypothetical protein JCGZ_20382 [Jatropha curcas]
Length=403

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVLSQK VKYHEPE WKF
Sbjct  229  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLSQKGVKYHEPEYWKF  288

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+Y+NEDVSLG+WFIGL+V+HIDER++
Sbjct  289  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYSNEDVSLGSWFIGLDVEHIDERSL  348

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGN C ASFDW+CSGICKSVE++  VH++CGEG+  +W+  F
Sbjct  349  CCGTPPDCEWKAQAGNPCAASFDWTCSGICKSVERMVEVHQRCGEGDGAIWHTSF  403



>gb|KGN63249.1| hypothetical protein Csa_2G418850 [Cucumis sativus]
Length=409

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L  TL RHRSKPRVYIGCMKSGPVLSQ+ V+YHEPE WKFG
Sbjct  236  WDADFYVKVDDDVHVNIGTLGETLARHRSKPRVYIGCMKSGPVLSQRGVRYHEPEHWKFG  295

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS DLATYISINQ ILHKYANEDVSLG+W IGL+V+HID+R +C
Sbjct  296  EAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHIDDRRLC  355

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E+IK VH +CGEGE  LW+A F
Sbjct  356  CGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  409



>ref|NP_177904.3| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
 sp|Q6NQB7.1|B3GT7_ARATH RecName: Full=Beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
 gb|AAQ65164.1| At1g77810 [Arabidopsis thaliana]
 dbj|BAD43246.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD94299.1| At1g77810 [Arabidopsis thaliana]
 gb|AEE36029.1| beta-1,3-galactosyltransferase 7 [Arabidopsis thaliana]
Length=393

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 161/181 (89%), Gaps = 6/181 (3%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQ------KNVKYHE  591
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+Q      + VKYHE
Sbjct  213  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQNLLNCFRTVKYHE  272

Query  590  PESWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDH  411
            PE WKFGE+GNKYFRHATGQIYAISKDLA YISINQPILHKYANEDVSLG+WFIGLEV+H
Sbjct  273  PEYWKFGEDGNKYFRHATGQIYAISKDLANYISINQPILHKYANEDVSLGSWFIGLEVEH  332

Query  410  IDERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            ID+R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L
Sbjct  333  IDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTL  392

Query  230  F  228
             
Sbjct  393  L  393



>ref|XP_004145877.1| PREDICTED: probable beta-1,3-galactosyltransferase 6-like [Cucumis 
sativus]
Length=401

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADF++KVDDDVH+NLGM+ +TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  227  KWDADFFIKVDDDVHINLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKF  286

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+PILHK+ANEDVSLG+WFIGL+V+HID+R++
Sbjct  287  GEEGNKYFRHATGQIYAISKDLATYISVNRPILHKFANEDVSLGSWFIGLDVEHIDDRSL  346

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTP DCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG+E +W+  F
Sbjct  347  CCGTPLDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  401



>ref|XP_004172360.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   322 bits (826),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L  TL RHRSKPRVYIGCMKSGPVLSQ+ V+YHEPE WKFG
Sbjct  235  WDADFYVKVDDDVHVNIGTLGETLARHRSKPRVYIGCMKSGPVLSQRGVRYHEPEHWKFG  294

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS DLATYISINQ ILHKYANEDVSLG+W IGL+V+HID+R +C
Sbjct  295  EAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHIDDRRLC  354

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E+IK VH +CGEGE  LW+A F
Sbjct  355  CGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  408



>ref|XP_004151891.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   322 bits (826),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L  TL RHRSKPRVYIGCMKSGPVLSQ+ V+YHEPE WKFG
Sbjct  235  WDADFYVKVDDDVHVNIGTLGETLARHRSKPRVYIGCMKSGPVLSQRGVRYHEPEHWKFG  294

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS DLATYISINQ ILHKYANEDVSLG+W IGL+V+HID+R +C
Sbjct  295  EAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHIDDRRLC  354

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E+IK VH +CGEGE  LW+A F
Sbjct  355  CGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  408



>ref|XP_009782227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=398

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG LAATL R+RSKP VYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  225  WDADFYVKVDDDVHVNLGTLAATLARNRSKPMVYIGCMKSGPVLAQKGVRYHEPEHWKFG  284

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GN+YFRHATGQ+YAISKDLATYISIN+ ILHKYANEDV+LG+WFIGL+V+H+D+R +C
Sbjct  285  EDGNRYFRHATGQLYAISKDLATYISINRHILHKYANEDVTLGSWFIGLDVEHVDDRKLC  344

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCE KAQAGN+CVASFDWSCSGICKSVE+IK VH +CGEGE  LW+A F
Sbjct  345  CGTPPDCELKAQAGNICVASFDWSCSGICKSVERIKEVHRRCGEGENALWSAAF  398



>gb|KGN49967.1| hypothetical protein Csa_5G146900 [Cucumis sativus]
Length=401

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADF++KVDDDVH+NLGM+ +TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  227  KWDADFFIKVDDDVHINLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPEYWKF  286

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+PILHK+ANEDVSLG+WFIGL+V+HID+R++
Sbjct  287  GEEGNKYFRHATGQIYAISKDLATYISVNRPILHKFANEDVSLGSWFIGLDVEHIDDRSL  346

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTP DCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG+E +W+  F
Sbjct  347  CCGTPLDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  401



>ref|XP_008455884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=408

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L  TL RHRSKPRVYIGCMKSGPVLSQ+ V+YHEPE WKFG
Sbjct  235  WDADFYVKVDDDVHVNIGTLGETLARHRSKPRVYIGCMKSGPVLSQRGVRYHEPEHWKFG  294

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS DLATYISINQ ILHKYANEDVSLG+W IGL+V+HID+R +C
Sbjct  295  EAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHIDDRRLC  354

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E+IK VH +CGEGE  LW+A F
Sbjct  355  CGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  408



>ref|XP_008359264.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=411

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  238  WDADFYVKVDDDVHVNIGTLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  297

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
             EGNKYFRHATGQ+YAISKDLA YIS NQ +LHKYANEDVSLG+WFIGL+V+ ID+R +C
Sbjct  298  AEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLC  357

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH++CGEGE  LWNA F
Sbjct  358  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  411



>ref|XP_008359262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=412

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  239  WDADFYVKVDDDVHVNIGTLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  298

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
             EGNKYFRHATGQ+YAISKDLA YIS NQ +LHKYANEDVSLG+WFIGL+V+ ID+R +C
Sbjct  299  AEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLC  358

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH++CGEGE  LWNA F
Sbjct  359  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  412



>ref|XP_009397181.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   322 bits (824),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L ATL +HRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  232  WDADFYIKVDDDVHVNIATLGATLAKHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  291

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  292  EEGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  351

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC S E+IK VH +CGEGE+T+W A+F
Sbjct  352  CGTPPDCEWKAQAGNICVASFDWSCSGICNSAERIKEVHRRCGEGEKTVWKAVF  405



>ref|XP_004245304.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Solanum lycopersicum]
Length=396

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVK+DDDVHVNLG LAATL RHR KPRVYIGCMKSGPVL QK+VKYHEPE WKF
Sbjct  222  KWDAEFYVKIDDDVHVNLGTLAATLARHRLKPRVYIGCMKSGPVLYQKSVKYHEPEFWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE GNKYFRHATGQIYAISK+LATY++ N+PILHKYANEDVSLGAW IGLEV+HID+R +
Sbjct  282  GETGNKYFRHATGQIYAISKELATYVANNRPILHKYANEDVSLGAWLIGLEVEHIDDRNL  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPP+CEWKAQAGNVCVASFDWSCSGICKSVE+IK VH KC E   TLW AL 
Sbjct  342  CCGTPPECEWKAQAGNVCVASFDWSCSGICKSVERIKQVHAKCSESPATLWGALI  396



>ref|XP_006452382.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 ref|XP_006475056.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR65622.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|KDO62740.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=407

 Score =   322 bits (824),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  234  WDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  293

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLA+YISINQ +LHK+ANEDVSLG+WFIGL+ +HID+R +C
Sbjct  294  EEGNKYFRHATGQLYAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLC  353

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGIC+S E++K VH +CGEGE  LW+A F
Sbjct  354  CGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERMKEVHRRCGEGENALWSAAF  407



>ref|XP_008437460.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 isoform 
X2 [Cucumis melo]
Length=401

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADF++KVDDDVH+NLGM+ +TL RHRSKPRVYIGCMKSGPVL+Q  VKYHEPE WKF
Sbjct  227  KWDADFFIKVDDDVHINLGMVGSTLARHRSKPRVYIGCMKSGPVLAQSGVKYHEPEYWKF  286

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+PILHKYANEDVSLG+WFIGL+V+HID+R++
Sbjct  287  GEEGNKYFRHATGQIYAISKDLATYISVNRPILHKYANEDVSLGSWFIGLDVEHIDDRSL  346

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTP DCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG+E +W+  F
Sbjct  347  CCGTPLDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  401



>ref|XP_006475057.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO62741.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=406

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  233  WDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  292

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLA+YISINQ +LHK+ANEDVSLG+WFIGL+ +HID+R +C
Sbjct  293  EEGNKYFRHATGQLYAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLC  352

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGIC+S E++K VH +CGEGE  LW+A F
Sbjct  353  CGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERMKEVHRRCGEGENALWSAAF  406



>ref|XP_010471979.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X3 [Camelina 
sativa]
Length=403

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 161/179 (90%), Gaps = 4/179 (2%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FY+KVDDDVHVNLGMLA+TL RHRSKPRVYIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  225  KWDAEFYIKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISIN----QPILHKYANEDVSLGAWFIGLEVDHID  405
            GE+GNKYFRHATGQIYAISKDLA YIS+N    +PILHKYANEDVSLG+WFIGLEV+HID
Sbjct  285  GEDGNKYFRHATGQIYAISKDLAKYISVNHLNFRPILHKYANEDVSLGSWFIGLEVEHID  344

Query  404  ERTMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            +R  CCGTPPDC WKA+AG+VCVASF+WSCSGICKSVE++K VHE C EGE  +WN L 
Sbjct  345  DRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWNTLL  403



>ref|XP_009398227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L ATL +HRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  240  WDADFYIKVDDDVHVNIATLGATLAKHRSKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  299

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYIS+NQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  300  EEGNKYFRHATGQLYAISKDLATYISMNQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  359

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC S E+IK VH +CGEG+  L NA+F
Sbjct  360  CGTPPDCEWKAQAGNICVASFDWSCSGICNSAERIKEVHRRCGEGKNALLNAVF  413



>ref|XP_006592810.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=383

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  210  WDADFYIKVDDDVHVNIATLGQTLLRHRSKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFG  269

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYIS N+ +LHKYANEDVSLG+WFIGL+VDHID+R +C
Sbjct  270  EAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHIDDRRLC  329

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH++CGEGE+ LWNA F
Sbjct  330  CGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  383



>ref|XP_006346208.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=408

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+G L ATL RH SKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  235  WDADFYIKVDDDVHVNIGALGATLARHHSKPRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  294

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GN+YFRHATGQ+YAISKDLATYIS+NQ +LHKY NEDVSLG+W IGL+V+HID+R +C
Sbjct  295  EDGNRYFRHATGQLYAISKDLATYISLNQHVLHKYVNEDVSLGSWLIGLDVEHIDDRRLC  354

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+SV++IK VH +CGEGE  LWNA F
Sbjct  355  CGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCGEGENALWNASF  408



>gb|ACL53751.1| unknown [Zea mays]
 gb|AFW84406.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=412

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDD+H+NLGMLA+ L +HR++PRVY+GCMKSGPVLSQK VKYHEPE WKFG
Sbjct  239  WDADFYVKVDDDIHLNLGMLASRLAKHRTRPRVYVGCMKSGPVLSQKGVKYHEPEYWKFG  298

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            +EGNKYFRHATGQIYAISKDLA YISINQPILH++ANEDVSLGAW IGLEV+H+D+R+MC
Sbjct  299  DEGNKYFRHATGQIYAISKDLAAYISINQPILHRFANEDVSLGAWLIGLEVEHVDDRSMC  358

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNA  234
            C TPPDCEWK +AGNVCVASFDWSCSG+CKSV++++ +H+ CGEGE  +WNA
Sbjct  359  CATPPDCEWKKRAGNVCVASFDWSCSGVCKSVDRMRHIHKACGEGEGAVWNA  410



>ref|XP_003540300.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoformX1 
[Glycine max]
 gb|KHN44874.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  234  WDADFYIKVDDDVHVNIATLGQTLLRHRSKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFG  293

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYIS N+ +LHKYANEDVSLG+WFIGL+VDHID+R +C
Sbjct  294  EAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHIDDRRLC  353

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH++CGEGE+ LWNA F
Sbjct  354  CGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  407



>ref|NP_001149873.1| LOC100283501 [Zea mays]
 gb|ACG37060.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=415

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDD+H+NLGMLA+ L +HR++PRVY+GCMKSGPVLSQK VKYHEPE WKFG
Sbjct  242  WDADFYVKVDDDIHLNLGMLASRLAKHRTRPRVYVGCMKSGPVLSQKGVKYHEPEYWKFG  301

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            +EGNKYFRHATGQIYAISKDLA YISINQPILH++ANEDVSLGAW IGLEV+H+D+R+MC
Sbjct  302  DEGNKYFRHATGQIYAISKDLAAYISINQPILHRFANEDVSLGAWLIGLEVEHVDDRSMC  361

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNA  234
            C TPPDCEWK +AGNVCVASFDWSCSG+CKSV++++ +H+ CGEGE  +WNA
Sbjct  362  CATPPDCEWKKRAGNVCVASFDWSCSGVCKSVDRMRHIHKACGEGEGAVWNA  413



>ref|XP_002970340.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ28470.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=397

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVN+GML +TL   RS+PR YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  223  KWDAEFYVKVDDDVHVNIGMLVSTLSLLRSQPRTYIGCMKSGPVLAQKGVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GN+YFRHATGQ+YAISKDLATYI+INQPILH++ANEDVSLGAWFIGL+V+H+DER+ 
Sbjct  283  GEDGNRYFRHATGQLYAISKDLATYIAINQPILHQFANEDVSLGAWFIGLDVNHVDERSF  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGT PDC+W+AQAGNVCVASFDWSCSGICKSVE++K VHEKCGEG+  +WNA+F
Sbjct  343  CCGTSPDCDWQAQAGNVCVASFDWSCSGICKSVERMKIVHEKCGEGDRAVWNAVF  397



>ref|XP_006439190.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
 gb|ESR52430.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
Length=378

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVL QK VKYHEPE WKF
Sbjct  204  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLGQKGVKYHEPEYWKF  263

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  264  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  323

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGT PDCEWKAQAGN C ASFDWSCSG+CKSVE++  VH++CGEG+E +W+  F
Sbjct  324  CCGTAPDCEWKAQAGNPCAASFDWSCSGVCKSVERMGEVHQRCGEGDEAIWHTSF  378



>ref|XP_010089999.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB38730.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=404

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHR K RVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  231  WDADFYVKVDDDVHVNIATLGATLARHRDKSRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  290

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQ+YAISKDLATYISINQ +LH+YANEDVSLG+WFIGL+V+HID+R +C
Sbjct  291  EDGNKYFRHATGQLYAISKDLATYISINQHVLHRYANEDVSLGSWFIGLDVEHIDDRRLC  350

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGIC+SVE++K VH +CGEGE  LW+A F
Sbjct  351  CGTPPDCEWKAQAGNVCVASFDWSCSGICRSVERMKEVHRRCGEGENALWSAEF  404



>gb|KDO54673.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=303

 Score =   317 bits (812),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  130  WDADFYVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFG  189

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GN+YFRHATGQ+YAISKDLA YISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  190  EAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  249

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDW+CSGIC+S ++IK VH +CGEGE  LW+A F
Sbjct  250  CGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  303



>ref|XP_003539862.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
Length=406

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHRSKPR+YIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  233  WDADFYVKVDDDVHVNIATLGETLVRHRSKPRIYIGCMKSGPVLSQKGVRYHEPEYWKFG  292

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GN+YFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  293  EAGNRYFRHATGQLYAISNDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  352

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CGEGE  LW+A F
Sbjct  353  CGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENVLWSASF  406



>gb|KHN21228.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=406

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHRSKPR+YIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  233  WDADFYVKVDDDVHVNIATLGETLVRHRSKPRIYIGCMKSGPVLSQKGVRYHEPEYWKFG  292

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GN+YFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  293  EAGNRYFRHATGQLYAISNDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  352

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CGEGE  LW+A F
Sbjct  353  CGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENVLWSASF  406



>ref|XP_009338707.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=410

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHRSKPRVYIGCMKSGPV++QK V+YHEPE WKFG
Sbjct  237  WDADFYVKVDDDVHVNIGTLGATLARHRSKPRVYIGCMKSGPVIAQKGVRYHEPEYWKFG  296

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
             EGNKYFRHATGQ+YAISKDLA YIS NQ +LHKYANEDVSLG+WFIGL+V+ ID+R +C
Sbjct  297  AEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLC  356

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH++CGEGE  LWNA F
Sbjct  357  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  410



>ref|XP_002968104.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ30358.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=397

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVN+GML +TL   RS+PR YIGCMKSGPVL+QK VKYHEPE WKF
Sbjct  223  KWDAEFYVKVDDDVHVNIGMLVSTLSLLRSQPRTYIGCMKSGPVLAQKGVKYHEPEYWKF  282

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE+GN+YFRHATGQ+Y ISKDLATYISINQPILH++ANEDVSLGAWFIGL+V+H DER+ 
Sbjct  283  GEDGNRYFRHATGQLYVISKDLATYISINQPILHQFANEDVSLGAWFIGLDVNHFDERSF  342

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGT PDCEW+AQAGNVCVASFDWSCSGICKSVE++K VHEKCGEG+  +WNA+F
Sbjct  343  CCGTSPDCEWQAQAGNVCVASFDWSCSGICKSVERMKIVHEKCGEGDRAVWNAVF  397



>ref|XP_009338706.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=411

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHRSKPRVYIGCMKSGPV++QK V+YHEPE WKFG
Sbjct  238  WDADFYVKVDDDVHVNIGTLGATLARHRSKPRVYIGCMKSGPVIAQKGVRYHEPEYWKFG  297

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
             EGNKYFRHATGQ+YAISKDLA YIS NQ +LHKYANEDVSLG+WFIGL+V+ ID+R +C
Sbjct  298  AEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLC  357

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH++CGEGE  LWNA F
Sbjct  358  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  411



>ref|XP_004970763.1| PREDICTED: probable beta-1,3-galactosyltransferase 8-like [Setaria 
italica]
Length=402

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVH+NLGML++ L +HR++PRVY+GCMKSGPVLSQK VKYHEPE WKFG
Sbjct  229  WDADFYVKVDDDVHLNLGMLSSRLAKHRTRPRVYVGCMKSGPVLSQKGVKYHEPEYWKFG  288

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            +EGNKYFRHATGQIYAISKDLA YISINQPILH++ANEDVSLGAW IGLEV+H+D+R+MC
Sbjct  289  DEGNKYFRHATGQIYAISKDLAAYISINQPILHRFANEDVSLGAWLIGLEVEHVDDRSMC  348

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWN  237
            C TPPDCEWK +AGNVCVASFDWSCSG+CKSV++++ +H+ CGEGE  +WN
Sbjct  349  CATPPDCEWKKRAGNVCVASFDWSCSGVCKSVDRMRHIHKACGEGEGAVWN  399



>ref|XP_006476264.1| PREDICTED: probable beta-1,3-galactosyltransferase 6-like isoform 
X2 [Citrus sinensis]
Length=401

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVL QK VKYHEPE WKF
Sbjct  227  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLGQKGVKYHEPEYWKF  286

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  287  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  346

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGT PDCEWKAQAGN C ASFDWSCSGICKSVE++  VH++CGEG+E +W+  F
Sbjct  347  CCGTAPDCEWKAQAGNPCAASFDWSCSGICKSVERMGEVHQRCGEGDEAIWHTSF  401



>ref|XP_003527496.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN41227.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHRSKPR+YIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  234  WDADFYVKVDDDVHVNIATLGQTLVRHRSKPRIYIGCMKSGPVLSQKGVRYHEPEYWKFG  293

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GN+YFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  294  EAGNRYFRHATGQLYAISNDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  353

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CGEGE  LW+A F
Sbjct  354  CGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  407



>ref|XP_006476263.1| PREDICTED: probable beta-1,3-galactosyltransferase 6-like isoform 
X1 [Citrus sinensis]
Length=404

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPRVYIGCMKSGPVL QK VKYHEPE WKF
Sbjct  230  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLGQKGVKYHEPEYWKF  289

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  290  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  349

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGT PDCEWKAQAGN C ASFDWSCSGICKSVE++  VH++CGEG+E +W+  F
Sbjct  350  CCGTAPDCEWKAQAGNPCAASFDWSCSGICKSVERMGEVHQRCGEGDEAIWHTSF  404



>gb|EMT26667.1| Beta-1,3-galactosyltransferase 7 [Aegilops tauschii]
Length=395

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGML  TLGRH+ KPRVYIGCMKSGPVLS K+ KYHEPE WKFG
Sbjct  222  WDADFYVKVDDDVHVNLGMLLTTLGRHKLKPRVYIGCMKSGPVLSDKSSKYHEPEFWKFG  281

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLATYIS+N P+LHK+ANEDVSLGAWFIGL+V+HID+R MC
Sbjct  282  EDGNKYFRHATGQIYAISKDLATYISVNNPLLHKFANEDVSLGAWFIGLDVEHIDDRDMC  341

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN CVASFDW CSG+C  VE++K VH +CGEG++ +W+A F
Sbjct  342  CGTPPDCEWKAQAGNACVASFDWRCSGVCNPVERLKDVHMRCGEGDDAIWSASF  395



>ref|XP_011047262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  232  WDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFG  291

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+VDHID+R +C
Sbjct  292  EAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVDHIDDRRLC  351

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE+ LW A F
Sbjct  352  CGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  405



>ref|XP_011047261.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  235  WDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFG  294

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+VDHID+R +C
Sbjct  295  EAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVDHIDDRRLC  354

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE+ LW A F
Sbjct  355  CGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  408



>ref|XP_004149353.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN56118.1| hypothetical protein Csa_3G076540 [Cucumis sativus]
Length=407

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  LA+TL RHRSK RVY+GCMKSGPVL+QK V+YHEPE WKFG
Sbjct  234  WDADFYVKVDDDVHVNIATLASTLARHRSKSRVYMGCMKSGPVLAQKGVRYHEPEYWKFG  293

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ ILHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  294  EEGNKYFRHATGQLYAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHIDDRRLC  353

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E++K VH +CGEGE  L +A+F
Sbjct  354  CGTPPDCEWKAQAGNICIASFDWSCSGICKSAERMKEVHRRCGEGENALLSAVF  407



>ref|XP_010910268.1| PREDICTED: probable beta-1,3-galactosyltransferase 8 [Elaeis 
guineensis]
Length=409

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLG L  TL R+R+KPR+YIGCMKSGPVLSQK VKYHEPE WKFG
Sbjct  236  WDADFYVKVDDDVHVNLGTLVTTLTRYRAKPRIYIGCMKSGPVLSQKGVKYHEPEFWKFG  295

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EE NKYFRHATGQIYAISKDLA YISIN PILH+YANEDVSLG+W IGLEV+HID+R MC
Sbjct  296  EEKNKYFRHATGQIYAISKDLAAYISINAPILHRYANEDVSLGSWLIGLEVEHIDDRMMC  355

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGNVCVASFDWSCSG+CKSVE++K VH  CGEG+  +WN + 
Sbjct  356  CGTPPDCEWKMQAGNVCVASFDWSCSGVCKSVERMKDVHNSCGEGDGAIWNVVI  409



>ref|XP_002320464.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98779.1| galactosyltransferase family protein [Populus trichocarpa]
Length=405

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  232  WDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFG  291

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+VDHID+R +C
Sbjct  292  EAGNKYFRHATGQLYAISKDLATYISINQHLLHKYANEDVSLGSWFIGLDVDHIDDRRLC  351

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE+ LW A F
Sbjct  352  CGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  405



>ref|XP_004244109.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Solanum 
lycopersicum]
Length=408

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+G L ATL RH SKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  235  WDADFYIKVDDDVHVNIGALGATLARHHSKPRVYIGCMKSGPVLAQKGVRYHEPEHWKFG  294

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQ+YAISKDLATYIS+NQ +LHKY NEDVSLG+W IGL+V+HID+R +C
Sbjct  295  EDGNKYFRHATGQLYAISKDLATYISLNQHVLHKYVNEDVSLGSWLIGLDVEHIDDRRLC  354

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+SV++I  VH +CGEGE  LWNA F
Sbjct  355  CGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIMEVHRRCGEGENALWNASF  408



>ref|XP_004487414.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFY+KVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  235  WDADFYIKVDDDVHVNIATLGETLVRHRSKPRVYIGCMKSGPVLSQKGVRYHEPEHWKFG  294

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLA YIS N+ +LHKYANEDVSLGAWFIGL+VDHID+R +C
Sbjct  295  ENGNKYFRHATGQLYAISKDLAAYISTNKHVLHKYANEDVSLGAWFIGLDVDHIDDRRLC  354

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDW+CSGIC+S E+IK VH+KCGEGE+ LW+A F
Sbjct  355  CGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKKCGEGEKALWSASF  408



>ref|XP_006375532.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53329.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=408

 Score =   320 bits (819),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  235  WDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFG  294

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+VDHID+R +C
Sbjct  295  EAGNKYFRHATGQLYAISKDLATYISINQHLLHKYANEDVSLGSWFIGLDVDHIDDRRLC  354

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE+ LW A F
Sbjct  355  CGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  408



>ref|XP_008385877.1| PREDICTED: probable beta-1,3-galactosyltransferase 2, partial 
[Malus domestica]
Length=407

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+G L ATL RHR KPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  234  WDADFYVKVDDDVHVNIGTLGATLARHRXKPRVYIGCMKSGPVLAQKGVRYHEPEYWKFG  293

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
             EGNKYFRHATGQ+YAISKDLA YIS NQ +LHKYANEDVSLG+WFIGL+V+ ID+R +C
Sbjct  294  AEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLC  353

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGICKS E+IK VH++CGEGE  LWNA F
Sbjct  354  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  407



>ref|XP_002518935.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF43468.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=403

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDADFY+KVDDDVH+NLGM+ +TL RHRSKPRVYIGCMKSGPVLSQK VKYHEPE WKF
Sbjct  229  RWDADFYIKVDDDVHINLGMIGSTLARHRSKPRVYIGCMKSGPVLSQKGVKYHEPEYWKF  288

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISK+LATYIS+N+ ILH+YANEDVS+G+WFIGL+V+HID+R++
Sbjct  289  GEEGNKYFRHATGQIYAISKNLATYISVNRHILHRYANEDVSMGSWFIGLDVEHIDDRSL  348

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGN C ASFDW+CSGICKSVE+++ VH++CGEG+  +W+  F
Sbjct  349  CCGTPPDCEWKAQAGNPCAASFDWTCSGICKSVERMEEVHQRCGEGDGAIWHTSF  403



>ref|XP_008463407.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
3 [Cucumis melo]
Length=412

 Score =   319 bits (818),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  LA+TL RHRSK RVY+GCMKSGPVL+QK V+YHEPE WKFG
Sbjct  239  WDADFYVKVDDDVHVNIATLASTLARHRSKSRVYMGCMKSGPVLAQKGVRYHEPEYWKFG  298

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            EEGNKYFRHATGQ+YAISKDLATYISINQ ILHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  299  EEGNKYFRHATGQLYAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHIDDRRLC  358

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+C+ASFDWSCSGICKS E++K VH +CGEGE  L +A+F
Sbjct  359  CGTPPDCEWKAQAGNICIASFDWSCSGICKSAERMKEVHRRCGEGENALLSAVF  412



>gb|EYU27344.1| hypothetical protein MIMGU_mgv1a007546mg [Erythranthe guttata]
Length=404

 Score =   319 bits (818),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L ATL RHRSK RVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  231  WDADFYVKVDDDVHVNIATLGATLARHRSKERVYIGCMKSGPVLAQKGVRYHEPEYWKFG  290

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQ+YAIS+DLATYIS NQ  LHKYANEDVSLGAWFIGL+V+HID+R +C
Sbjct  291  EQGNKYFRHATGQLYAISRDLATYISKNQHFLHKYANEDVSLGAWFIGLDVEHIDDRRLC  350

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGNVCVASFDWSCSGIC S ++IK VH +CGEGE TLWN  F
Sbjct  351  CGTPPDCEWKAQAGNVCVASFDWSCSGICNSADRIKEVHRRCGEGEHTLWNTAF  404



>ref|XP_007132543.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
 gb|ESW04537.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
Length=406

 Score =   319 bits (818),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHRSKPR+YIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  233  WDADFYVKVDDDVHVNIATLGETLVRHRSKPRIYIGCMKSGPVLSQKGVRYHEPEYWKFG  292

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS DLATYISINQ +LHKYANEDVSLG+WFIGL+ +HID+R +C
Sbjct  293  EAGNKYFRHATGQLYAISNDLATYISINQDVLHKYANEDVSLGSWFIGLDAEHIDDRRLC  352

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S E+IK VH +CGEGE  LW+A F
Sbjct  353  CGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  406



>ref|XP_009607565.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Nicotiana tomentosiformis]
Length=390

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVKVDDDVHVNLG LAATL RHR KPRVY GCMKSGPVL +K+VKYHEPE WKF
Sbjct  216  KWDAEFYVKVDDDVHVNLGTLAATLARHRLKPRVYTGCMKSGPVLYKKSVKYHEPEFWKF  275

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE GNKYFRHATGQIYAISK+LATYI+ N+PILHKYANEDVSLGAW IGLEV+HID+R M
Sbjct  276  GETGNKYFRHATGQIYAISKELATYIANNKPILHKYANEDVSLGAWLIGLEVEHIDDRNM  335

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CCGTPP+CEWKAQAGNVCVASFDWSCSGICKSVE+IK VH KC E   TLW AL
Sbjct  336  CCGTPPECEWKAQAGNVCVASFDWSCSGICKSVERIKQVHAKCSESPATLWGAL  389



>ref|XP_011470881.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 [Fragaria 
vesca subsp. vesca]
Length=405

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVHVNLGM+ +TL RHRSKPR YIGCMKSGPVL+ + VKYHEPE WKF
Sbjct  231  KWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRTYIGCMKSGPVLAHQGVKYHEPEYWKF  290

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYA+SKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V HIDER++
Sbjct  291  GEEGNKYFRHATGQIYALSKDLATYISVNRHILHRYANEDVSLGSWFIGLDVQHIDERSL  350

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPPDCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG++ +W+  F
Sbjct  351  CCGTPPDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDDAIWHTSF  405



>ref|XP_006447567.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 gb|ESR60807.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=303

 Score =   315 bits (808),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADF+VKVDDDVHVN+  L  TL RHRSKPRVYIGCMKSGPVL+QK V+YHEPE WKFG
Sbjct  130  WDADFFVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPEYWKFG  189

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GN+YFRHATGQ+YAISKDLA YISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  190  EAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  249

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDW+CSGIC+S ++IK VH +CGEGE  LW+A F
Sbjct  250  CGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  303



>ref|XP_009777689.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
sylvestris]
Length=396

 Score =   318 bits (816),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA++YVKVDDDVHVNLG LAATL +HR KPRVYIGCMKSGPVL +K+VKYHEPE WKF
Sbjct  222  KWDAEYYVKVDDDVHVNLGTLAATLAKHRLKPRVYIGCMKSGPVLYKKSVKYHEPEFWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE GNKYFRHATGQIYAISK+LATYI+ N+PILHKYANEDVSLGAW IGLEV+HID+R M
Sbjct  282  GETGNKYFRHATGQIYAISKELATYIANNKPILHKYANEDVSLGAWLIGLEVEHIDDRNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPP+CEWKAQAGNVCVASFDWSCSGICKSVE+IK VH KC E   TLW AL 
Sbjct  342  CCGTPPECEWKAQAGNVCVASFDWSCSGICKSVERIKHVHAKCSESPATLWGALI  396



>ref|XP_006304048.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
 gb|EOA36946.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
Length=303

 Score =   315 bits (808),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR KPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  130  WDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFG  189

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLGAWFIG++V HID+R +C
Sbjct  190  ENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLC  249

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWK QAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE+ LW+A F
Sbjct  250  CGTPPDCEWKTQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  303



>ref|XP_010046417.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW88779.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
 gb|KCW88780.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
Length=407

 Score =   319 bits (817),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR K RVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  233  WDADFYVKVDDDVHVNIATLGETLVRHRPKRRVYIGCMKSGPVLSQKGVRYHEPEHWKFG  292

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAISKDLATYISINQ +LHKYANEDVSLG+WFIGL+V+HID+R +C
Sbjct  293  ESGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLC  352

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+SVE+IK VH +CGEGE  LW+A F
Sbjct  353  CGTPPDCEWKAQAGNICVASFDWSCSGICRSVERIKEVHRRCGEGENALWSATF  406



>ref|XP_009777688.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
sylvestris]
Length=399

 Score =   318 bits (816),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA++YVKVDDDVHVNLG LAATL +HR KPRVYIGCMKSGPVL +K+VKYHEPE WKF
Sbjct  225  KWDAEYYVKVDDDVHVNLGTLAATLAKHRLKPRVYIGCMKSGPVLYKKSVKYHEPEFWKF  284

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE GNKYFRHATGQIYAISK+LATYI+ N+PILHKYANEDVSLGAW IGLEV+HID+R M
Sbjct  285  GETGNKYFRHATGQIYAISKELATYIANNKPILHKYANEDVSLGAWLIGLEVEHIDDRNM  344

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPP+CEWKAQAGNVCVASFDWSCSGICKSVE+IK VH KC E   TLW AL 
Sbjct  345  CCGTPPECEWKAQAGNVCVASFDWSCSGICKSVERIKHVHAKCSESPATLWGALI  399



>ref|XP_008392652.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 [Malus domestica]
Length=404

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVH+NLGM+ +TL RHRSKPR YIGCMKSGPVL+ K VKYHEPE WKF
Sbjct  230  KWDADFYIKVDDDVHINLGMVGSTLARHRSKPRTYIGCMKSGPVLANKGVKYHEPEYWKF  289

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS++  ILHKYANEDVSLG+WFIGL+V+HIDER++
Sbjct  290  GEEGNKYFRHATGQIYAISKDLATYISVHHHILHKYANEDVSLGSWFIGLDVEHIDERSL  349

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPP+CEWKAQAGN C ASFDWSCSGICKSVE+++ VHE+CGEG+E +W+  F
Sbjct  350  CCGTPPECEWKAQAGNPCAASFDWSCSGICKSVERMEEVHERCGEGDEAIWHTSF  404



>ref|XP_006355190.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Solanum tuberosum]
Length=396

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDA+FYVK+DDDVHVNLG LAATL RHR KPRVYIGCMKSG VL QK+VKYHEPE WKF
Sbjct  222  KWDAEFYVKIDDDVHVNLGTLAATLARHRLKPRVYIGCMKSGSVLYQKSVKYHEPEFWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GE GNKYFRHATGQIYAISK+LATY++ N+PILHKYANEDVSLGAW IGLEV+HID+R +
Sbjct  282  GETGNKYFRHATGQIYAISKELATYVANNRPILHKYANEDVSLGAWLIGLEVEHIDDRNL  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPP+CEWKAQAGNVCVASFDWSCSGICKSVE+IK VH KC E   TLW AL 
Sbjct  342  CCGTPPECEWKAQAGNVCVASFDWSCSGICKSVERIKHVHAKCSESPATLWGALI  396



>dbj|BAJ94062.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVNLGML  TLGR + KPRVYIGCMKSGPVLS K+ KYHEPE WKFG
Sbjct  223  WDADFYVKVDDDVHVNLGMLLTTLGRQKLKPRVYIGCMKSGPVLSDKSSKYHEPEFWKFG  282

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E+GNKYFRHATGQIYAISKDLATYIS+N+P+LHK+ANEDVSLGAWFIGL+V+HID+R MC
Sbjct  283  EDGNKYFRHATGQIYAISKDLATYISVNKPLLHKFANEDVSLGAWFIGLDVEHIDDRDMC  342

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN CVASFDW CSG+C  VE++K VH +CGEG++ +W+A F
Sbjct  343  CGTPPDCEWKAQAGNACVASFDWRCSGVCNPVERLKDVHARCGEGDDAIWSASF  396



>ref|XP_007209207.1| hypothetical protein PRUPE_ppa006612mg [Prunus persica]
 gb|EMJ10406.1| hypothetical protein PRUPE_ppa006612mg [Prunus persica]
Length=403

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVH+NLGM+ +TL RHRSKPR YIGCMKSGPVL+ K VKYHEPE WKF
Sbjct  229  KWDADFYIKVDDDVHINLGMVGSTLARHRSKPRTYIGCMKSGPVLANKGVKYHEPEYWKF  288

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+++ ILH+YANEDVSLG+WFIGL+V+HIDER++
Sbjct  289  GEEGNKYFRHATGQIYAISKDLATYISVHRHILHRYANEDVSLGSWFIGLDVEHIDERSL  348

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGTPP+CEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEG+E +W+  F
Sbjct  349  CCGTPPECEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  403



>gb|KEH29682.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=349

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHRSK R+YIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  176  WDADFYVKVDDDVHVNIATLGETLVRHRSKQRIYIGCMKSGPVLSQKGVRYHEPEHWKFG  235

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS DLATYIS NQ +LHKYANEDVS+GAWFIGL+V+HID+R +C
Sbjct  236  ESGNKYFRHATGQLYAISNDLATYISTNQNVLHKYANEDVSIGAWFIGLDVEHIDDRRLC  295

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE  LW+A F
Sbjct  296  CGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSASF  349



>ref|XP_002300511.1| hypothetical protein POPTR_0001s45420g [Populus trichocarpa]
 gb|EEE85316.1| hypothetical protein POPTR_0001s45420g [Populus trichocarpa]
Length=355

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            KWDADFY+KVDDDVH+NLGM+ +TL RHRSKPRVY+GCMKSGPVL+Q  VKYHEPE WKF
Sbjct  181  KWDADFYIKVDDDVHINLGMVGSTLARHRSKPRVYMGCMKSGPVLAQTGVKYHEPEYWKF  240

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLATYIS+N+ ILH+YANEDVSLG+WFIGL+V+HID+R++
Sbjct  241  GEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSL  300

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CCGT PDCEWKAQAGN C ASFDWSCSGICKSVE+++ VH++CGEGE  +W+  F
Sbjct  301  CCGTAPDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGEGAIWHTSF  355



>ref|XP_010484738.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=408

 Score =   318 bits (816),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR KPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  235  WDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFG  294

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLGAWFIG++V HID+R +C
Sbjct  295  ENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLC  354

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE+ LW+A F
Sbjct  355  CGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  408



>ref|XP_010484744.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=405

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR KPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  232  WDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFG  291

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLGAWFIG++V HID+R +C
Sbjct  292  ENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLC  351

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE+ LW+A F
Sbjct  352  CGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  405



>gb|EYU21104.1| hypothetical protein MIMGU_mgv1a007738mg [Erythranthe guttata]
Length=396

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  752  KWDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKF  573
            +WDA+FYVKVDDDVHVNLG LAATL RHRSK  VYIGCMKSGPVL QKNVKYHEPE WKF
Sbjct  222  RWDAEFYVKVDDDVHVNLGTLAATLARHRSKHGVYIGCMKSGPVLYQKNVKYHEPEHWKF  281

Query  572  GEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTM  393
            GEEGNKYFRHATGQIYAISKDLA YIS+NQ ILHKYANEDVSLGAWFIGL+++HID+R M
Sbjct  282  GEEGNKYFRHATGQIYAISKDLANYISVNQKILHKYANEDVSLGAWFIGLDIEHIDDRNM  341

Query  392  CCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNAL  231
            CCGT P+CEWKA+AGN+CVASFDWSCSGICKSVE+IK VH KCGE    L NAL
Sbjct  342  CCGTSPECEWKAKAGNICVASFDWSCSGICKSVERIKAVHAKCGEDAAILRNAL  395



>ref|XP_010475190.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=406

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -3

Query  749  WDADFYVKVDDDVHVNLGMLAATLGRHRSKPRVYIGCMKSGPVLSQKNVKYHEPESWKFG  570
            WDADFYVKVDDDVHVN+  L  TL RHR KPRVYIGCMKSGPVLSQK V+YHEPE WKFG
Sbjct  233  WDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFG  292

Query  569  EEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVDHIDERTMC  390
            E GNKYFRHATGQ+YAIS+DLA+YISINQ +LHKYANEDVSLGAWFIG++V HID+R +C
Sbjct  293  ENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLC  352

Query  389  CGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKIKFVHEKCGEGEETLWNALF  228
            CGTPPDCEWKAQAGN+CVASFDWSCSGIC+S ++IK VH +CGEGE+ LW+A F
Sbjct  353  CGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  406



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050