BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019E11

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06483.1|  unnamed protein product                                170   1e-45   Coffea canephora [robusta coffee]
ref|XP_009796835.1|  PREDICTED: uncharacterized protein LOC104243...    166   1e-44   Nicotiana sylvestris
gb|KJB55742.1|  hypothetical protein B456_009G092000                    164   1e-44   Gossypium raimondii
ref|XP_009796833.1|  PREDICTED: uncharacterized protein LOC104243...    165   1e-44   Nicotiana sylvestris
gb|KJB55744.1|  hypothetical protein B456_009G092000                    164   3e-44   Gossypium raimondii
gb|KHG10598.1|  putative E3 ubiquitin-protein ligase XBOS34             166   4e-44   Gossypium arboreum [tree cotton]
gb|KJB55736.1|  hypothetical protein B456_009G092000                    164   5e-44   Gossypium raimondii
ref|XP_009796832.1|  PREDICTED: uncharacterized protein LOC104243...    165   7e-44   Nicotiana sylvestris
ref|XP_006365595.1|  PREDICTED: uncharacterized protein LOC102603607    165   7e-44   Solanum tuberosum [potatoes]
gb|KJB55738.1|  hypothetical protein B456_009G092000                    165   8e-44   Gossypium raimondii
gb|KJB55737.1|  hypothetical protein B456_009G092000                    164   1e-43   Gossypium raimondii
gb|KJB55741.1|  hypothetical protein B456_009G092000                    165   2e-43   Gossypium raimondii
ref|XP_009598981.1|  PREDICTED: uncharacterized protein LOC104094...    162   2e-43   
gb|KJB55740.1|  hypothetical protein B456_009G092000                    164   2e-43   Gossypium raimondii
ref|XP_008243700.1|  PREDICTED: uncharacterized protein LOC103341...    160   7e-43   Prunus mume [ume]
ref|XP_009598980.1|  PREDICTED: uncharacterized protein LOC104094...    161   1e-42   Nicotiana tomentosiformis
ref|XP_008243696.1|  PREDICTED: uncharacterized protein LOC103341...    160   4e-42   Prunus mume [ume]
ref|XP_008243690.1|  PREDICTED: uncharacterized protein LOC103341...    160   4e-42   Prunus mume [ume]
gb|KHN46943.1|  Putative E3 ubiquitin-protein ligase XBAT34             158   7e-42   Glycine soja [wild soybean]
ref|XP_008351211.1|  PREDICTED: uncharacterized protein LOC103414623    154   9e-42   
ref|XP_006602668.1|  PREDICTED: uncharacterized protein LOC100791057    158   2e-41   Glycine max [soybeans]
ref|XP_007205144.1|  hypothetical protein PRUPE_ppa005237mg             158   2e-41   Prunus persica
ref|XP_006583657.1|  PREDICTED: uncharacterized protein LOC100777...    156   3e-41   
gb|KHN36429.1|  Putative E3 ubiquitin-protein ligase XBAT35             156   6e-41   Glycine soja [wild soybean]
ref|XP_010037700.1|  PREDICTED: uncharacterized protein LOC104426377    157   7e-41   Eucalyptus grandis [rose gum]
ref|XP_006583656.1|  PREDICTED: uncharacterized protein LOC100777...    156   7e-41   Glycine max [soybeans]
ref|XP_007207438.1|  hypothetical protein PRUPE_ppa005117mg             156   1e-40   Prunus persica
ref|XP_010253903.1|  PREDICTED: uncharacterized protein LOC104595...    154   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010253902.1|  PREDICTED: uncharacterized protein LOC104595...    154   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_007140331.1|  hypothetical protein PHAVU_008G103400g             155   2e-40   Phaseolus vulgaris [French bean]
ref|XP_006429392.1|  hypothetical protein CICLE_v100136621mg            150   2e-40   
ref|XP_008390694.1|  PREDICTED: uncharacterized protein LOC103452949    155   4e-40   
ref|XP_010095238.1|  Putative E3 ubiquitin-protein ligase XBAT35        150   5e-40   
ref|XP_008220824.1|  PREDICTED: uncharacterized protein LOC103320859    155   5e-40   Prunus mume [ume]
ref|XP_010253900.1|  PREDICTED: uncharacterized protein LOC104595...    154   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010253901.1|  PREDICTED: uncharacterized protein LOC104595...    154   6e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008370095.1|  PREDICTED: uncharacterized protein LOC103433605    154   6e-40   
ref|XP_010326076.1|  PREDICTED: uncharacterized protein LOC101252...    154   7e-40   Solanum lycopersicum
ref|XP_004246765.1|  PREDICTED: uncharacterized protein LOC101252...    154   9e-40   Solanum lycopersicum
gb|KDP24449.1|  hypothetical protein JCGZ_25013                         154   1e-39   Jatropha curcas
ref|XP_011006557.1|  PREDICTED: uncharacterized protein LOC105112530    152   3e-39   Populus euphratica
ref|XP_006481039.1|  PREDICTED: uncharacterized protein LOC102608051    152   3e-39   Citrus sinensis [apfelsine]
ref|XP_007026702.1|  RING/U-box superfamily protein, putative iso...    152   5e-39   
ref|XP_007026701.1|  RING/U-box superfamily protein, putative iso...    152   5e-39   
ref|XP_004514227.1|  PREDICTED: uncharacterized protein LOC101489056    152   6e-39   
ref|XP_010923286.1|  PREDICTED: uncharacterized protein LOC105046404    150   2e-38   Elaeis guineensis
ref|XP_010262861.1|  PREDICTED: uncharacterized protein LOC104601271    150   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_009347262.1|  PREDICTED: uncharacterized protein LOC103938936    149   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_008791206.1|  PREDICTED: uncharacterized protein LOC103708...    149   4e-38   Phoenix dactylifera
ref|XP_009377761.1|  PREDICTED: uncharacterized protein LOC103966331    149   5e-38   Pyrus x bretschneideri [bai li]
ref|XP_008791207.1|  PREDICTED: uncharacterized protein LOC103708...    149   6e-38   Phoenix dactylifera
ref|XP_011019119.1|  PREDICTED: uncharacterized protein LOC105121...    147   8e-38   Populus euphratica
ref|XP_002322980.2|  hypothetical protein POPTR_0016s12360g             148   1e-37   
ref|XP_011019118.1|  PREDICTED: uncharacterized protein LOC105121...    147   4e-37   Populus euphratica
ref|XP_002528092.1|  ubiquitin-protein ligase, putative                 146   6e-37   
ref|XP_004302551.1|  PREDICTED: uncharacterized protein LOC101309361    145   9e-37   Fragaria vesca subsp. vesca
gb|KJB17073.1|  hypothetical protein B456_002G263500                    145   9e-37   Gossypium raimondii
gb|KJB17074.1|  hypothetical protein B456_002G263500                    145   1e-36   Gossypium raimondii
gb|KJB17075.1|  hypothetical protein B456_002G263500                    145   1e-36   Gossypium raimondii
ref|XP_002308218.2|  hypothetical protein POPTR_0006s10120g             145   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010676738.1|  PREDICTED: uncharacterized protein LOC104892488    144   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007016101.1|  Ubiquitin-protein ligase, putative isoform 2       143   2e-36   
ref|XP_007026703.1|  RING/U-box superfamily protein, putative iso...    144   3e-36   
gb|KHG23614.1|  Putative E3 ubiquitin-protein ligase XBAT35             144   4e-36   Gossypium arboreum [tree cotton]
ref|XP_007026700.1|  RING/U-box superfamily protein, putative iso...    144   4e-36   
gb|KHG23613.1|  Putative E3 ubiquitin-protein ligase XBAT35             144   4e-36   Gossypium arboreum [tree cotton]
ref|XP_010033005.1|  PREDICTED: uncharacterized protein LOC104422...    144   4e-36   Eucalyptus grandis [rose gum]
ref|XP_010033006.1|  PREDICTED: uncharacterized protein LOC104422...    144   5e-36   Eucalyptus grandis [rose gum]
ref|XP_002279069.2|  PREDICTED: uncharacterized protein LOC100258653    144   5e-36   Vitis vinifera
gb|KDP46493.1|  hypothetical protein JCGZ_08465                         143   8e-36   Jatropha curcas
ref|XP_007016100.1|  RING/U-box superfamily protein isoform 1           143   9e-36   
ref|XP_011095012.1|  PREDICTED: uncharacterized protein LOC105174...    142   1e-35   Sesamum indicum [beniseed]
ref|XP_011095011.1|  PREDICTED: uncharacterized protein LOC105174...    142   1e-35   Sesamum indicum [beniseed]
ref|XP_008349667.1|  PREDICTED: uncharacterized protein LOC103412941    140   1e-35   
ref|XP_009397537.1|  PREDICTED: uncharacterized protein LOC103982...    140   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397538.1|  PREDICTED: uncharacterized protein LOC103982...    140   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW52521.1|  hypothetical protein EUGRSUZ_J01909                     141   6e-35   Eucalyptus grandis [rose gum]
ref|XP_011460950.1|  PREDICTED: uncharacterized protein LOC101291...    139   6e-35   Fragaria vesca subsp. vesca
ref|XP_008384801.1|  PREDICTED: uncharacterized protein LOC103447392    140   7e-35   
ref|XP_011460948.1|  PREDICTED: uncharacterized protein LOC101291...    139   2e-34   Fragaria vesca subsp. vesca
ref|XP_011460949.1|  PREDICTED: uncharacterized protein LOC101291...    139   2e-34   Fragaria vesca subsp. vesca
gb|KEH23171.1|  ubiquitin-protein ligase, putative                      137   1e-33   Medicago truncatula
ref|XP_008355058.1|  PREDICTED: uncharacterized protein LOC103418723    135   5e-33   
ref|XP_002525648.1|  ubiquitin-protein ligase, putative                 132   7e-32   
ref|XP_002264526.1|  PREDICTED: uncharacterized protein LOC100247...    130   3e-31   Vitis vinifera
ref|XP_006848229.1|  hypothetical protein AMTR_s00029p00246370          127   5e-30   
gb|KDO66889.1|  hypothetical protein CISIN_1g0435821mg                  122   9e-30   Citrus sinensis [apfelsine]
emb|CDY07747.1|  BnaA03g17640D                                          124   3e-29   Brassica napus [oilseed rape]
ref|XP_009133239.1|  PREDICTED: uncharacterized protein LOC103857...    124   4e-29   Brassica rapa
ref|XP_009133237.1|  PREDICTED: uncharacterized protein LOC103857...    123   5e-29   
ref|XP_006425068.1|  hypothetical protein CICLE_v10030173mg             123   1e-28   Citrus clementina [clementine]
ref|NP_973632.1|  protein ABERRANT POLLEN DEVELOPMENT 1                 121   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KJB55739.1|  hypothetical protein B456_009G092000                    122   2e-28   Gossypium raimondii
ref|XP_002879731.1|  hypothetical protein ARALYDRAFT_321523             124   4e-28   
ref|NP_973633.2|  protein ABERRANT POLLEN DEVELOPMENT 1                 121   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565884.2|  protein ABERRANT POLLEN DEVELOPMENT 1                 121   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAC27168.1|  unknown protein                                         114   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010685553.1|  PREDICTED: uncharacterized protein LOC104899...    120   6e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002299808.2|  hypothetical protein POPTR_0001s25890g             119   8e-28   
ref|XP_006488687.1|  PREDICTED: uncharacterized protein LOC102622796    119   2e-27   Citrus sinensis [apfelsine]
ref|XP_010685554.1|  PREDICTED: uncharacterized protein LOC104899...    119   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011043774.1|  PREDICTED: uncharacterized protein LOC105139...    114   4e-26   Populus euphratica
ref|XP_011043773.1|  PREDICTED: uncharacterized protein LOC105139...    115   5e-26   Populus euphratica
ref|XP_010505434.1|  PREDICTED: uncharacterized protein LOC104782...    115   7e-26   
ref|XP_010505437.1|  PREDICTED: uncharacterized protein LOC104782...    114   7e-26   Camelina sativa [gold-of-pleasure]
emb|CDP09192.1|  unnamed protein product                                113   2e-25   Coffea canephora [robusta coffee]
ref|XP_006411024.1|  hypothetical protein EUTSA_v10016735mg             111   9e-25   
ref|XP_006294282.1|  hypothetical protein CARUB_v10023281mg             110   2e-24   Capsella rubella
emb|CDY11200.1|  BnaA03g00360D                                          109   4e-24   Brassica napus [oilseed rape]
emb|CDX80772.1|  BnaC03g00260D                                          109   6e-24   
ref|XP_010517108.1|  PREDICTED: uncharacterized protein LOC104792617    108   8e-24   
ref|XP_007026704.1|  RING/U-box superfamily protein, putative iso...    108   9e-24   
ref|XP_009130651.1|  PREDICTED: uncharacterized protein LOC103855419    108   1e-23   Brassica rapa
ref|XP_006288261.1|  hypothetical protein CARUB_v10001505mg             107   1e-23   
emb|CDY14482.1|  BnaC03g21130D                                          107   2e-23   Brassica napus [oilseed rape]
ref|XP_010451984.1|  PREDICTED: uncharacterized protein LOC104734158    107   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010423955.1|  PREDICTED: uncharacterized protein LOC104708994    106   5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010490564.1|  PREDICTED: uncharacterized protein LOC104768319    106   5e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010509210.1|  PREDICTED: uncharacterized protein LOC104785655    105   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009143409.1|  PREDICTED: uncharacterized protein LOC103867...    102   9e-22   Brassica rapa
ref|XP_009143410.1|  PREDICTED: uncharacterized protein LOC103867...    102   9e-22   Brassica rapa
ref|XP_009143408.1|  PREDICTED: uncharacterized protein LOC103867...    102   1e-21   Brassica rapa
emb|CAN70836.1|  hypothetical protein VITISV_015872                     104   2e-21   Vitis vinifera
ref|XP_010517109.1|  PREDICTED: uncharacterized protein LOC104792618  99.8    8e-21   Camelina sativa [gold-of-pleasure]
gb|KFK24649.1|  hypothetical protein AALP_AA8G007200                  99.4    2e-20   Arabis alpina [alpine rockcress]
gb|KFK22532.1|  hypothetical protein AALP_AAs66306U000100             95.9    2e-20   Arabis alpina [alpine rockcress]
emb|CDX74902.1|  BnaA05g06480D                                        97.8    4e-20   
ref|XP_010509207.1|  PREDICTED: uncharacterized protein LOC104785650  97.8    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006411023.1|  hypothetical protein EUTSA_v10017777mg           97.4    9e-20   
ref|NP_181357.2|  RING-finger domain-containing protein               95.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001118467.1|  protein ABERRANT POLLEN DEVELOPMENT 4            94.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAY82262.1|  hypothetical protein At2g38185                        94.7    4e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAO86831.1|  hypothetical protein                                  92.4    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001118468.1|  protein ABERRANT POLLEN DEVELOPMENT 4            94.4    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004963647.1|  PREDICTED: uncharacterized protein LOC101757949  94.4    7e-19   
ref|XP_002440099.1|  hypothetical protein SORBIDRAFT_09g026010        93.6    9e-19   
ref|XP_006654661.1|  PREDICTED: uncharacterized protein LOC102709646  93.2    1e-18   
gb|EYU41896.1|  hypothetical protein MIMGU_mgv1a012839mg              89.7    9e-18   Erythranthe guttata [common monkey flower]
ref|NP_195765.3|  RING/U-box domain-containing protein                87.4    3e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAB81928.1|  putative protein                                     87.4    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543205.1|  PREDICTED: uncharacterized protein LOC104816193  86.7    5e-16   Tarenaya hassleriana [spider flower]
ref|NP_001174492.1|  Os05g0520700                                     87.4    7e-16   
ref|XP_002870915.1|  protein binding protein                          85.5    2e-15   
ref|XP_009627915.1|  PREDICTED: uncharacterized protein LOC104118...  79.3    1e-13   
ref|XP_009627916.1|  PREDICTED: uncharacterized protein LOC104118...  79.0    1e-13   
ref|XP_001768110.1|  predicted protein                                79.7    1e-13   
ref|XP_009627917.1|  PREDICTED: uncharacterized protein LOC104118...  79.0    2e-13   
ref|XP_010233161.1|  PREDICTED: uncharacterized protein LOC104583123  77.8    6e-13   
ref|XP_004966864.1|  PREDICTED: E3 ubiquitin-protein ligase mind-...  73.6    9e-13   Setaria italica
ref|XP_010530429.1|  PREDICTED: uncharacterized protein LOC104807018  76.3    2e-12   Tarenaya hassleriana [spider flower]
gb|EMT21657.1|  E3 ubiquitin-protein ligase NEURL1B                   75.5    2e-12   
ref|XP_002510132.1|  ubiquitin-protein ligase, putative               72.4    7e-12   
ref|XP_006472255.1|  PREDICTED: uncharacterized protein LOC102612248  73.2    1e-11   
ref|XP_006469474.1|  PREDICTED: uncharacterized protein LOC102622120  73.6    1e-11   
ref|XP_002283899.1|  PREDICTED: baculoviral IAP repeat-containing...  69.7    3e-11   Vitis vinifera
ref|XP_010664531.1|  PREDICTED: uncharacterized protein LOC100248...  72.0    3e-11   Vitis vinifera
emb|CBI33738.3|  unnamed protein product                              69.7    3e-11   Vitis vinifera
ref|XP_002283216.2|  PREDICTED: uncharacterized protein LOC100248...  72.0    4e-11   Vitis vinifera
ref|XP_008220290.1|  PREDICTED: uncharacterized protein LOC103320...  70.9    7e-11   Prunus mume [ume]
ref|XP_006413462.1|  hypothetical protein EUTSA_v10027110mg           68.2    7e-11   
gb|EYU44457.1|  hypothetical protein MIMGU_mgv1a015305mg              68.2    8e-11   Erythranthe guttata [common monkey flower]
ref|XP_006374856.1|  hypothetical protein POPTR_0014s02100g           70.9    9e-11   
ref|XP_008220289.1|  PREDICTED: uncharacterized protein LOC103320...  70.9    1e-10   Prunus mume [ume]
ref|XP_011029097.1|  PREDICTED: uncharacterized protein LOC105128...  70.5    1e-10   Populus euphratica
ref|XP_011029089.1|  PREDICTED: uncharacterized protein LOC105128...  70.1    2e-10   Populus euphratica
gb|KDO81585.1|  hypothetical protein CISIN_1g036765mg                 69.7    2e-10   Citrus sinensis [apfelsine]
ref|XP_009137784.1|  PREDICTED: RNA-binding protein MEX3B             67.0    2e-10   Brassica rapa
gb|KJB29438.1|  hypothetical protein B456_005G100500                  68.6    2e-10   Gossypium raimondii
gb|KJB29433.1|  hypothetical protein B456_005G100500                  68.9    2e-10   Gossypium raimondii
ref|XP_002960269.1|  hypothetical protein SELMODRAFT_74018            65.1    2e-10   
ref|XP_010448595.1|  PREDICTED: uncharacterized protein LOC104731038  67.0    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006433589.1|  hypothetical protein CICLE_v10003482mg           69.7    3e-10   
emb|CDY34265.1|  BnaA01g13680D                                        66.6    3e-10   Brassica napus [oilseed rape]
gb|KJB29431.1|  hypothetical protein B456_005G100500                  69.3    3e-10   Gossypium raimondii
gb|KJB29430.1|  hypothetical protein B456_005G100500                  69.3    3e-10   Gossypium raimondii
gb|KJB29434.1|  hypothetical protein B456_005G100500                  68.9    3e-10   Gossypium raimondii
ref|XP_007225736.1|  hypothetical protein PRUPE_ppa010006mg           67.8    4e-10   
emb|CDY03476.1|  BnaC01g16060D                                        66.2    4e-10   
ref|XP_009372465.1|  PREDICTED: RNA-binding protein MEX3B-like is...  65.5    6e-10   Pyrus x bretschneideri [bai li]
gb|KJB17986.1|  hypothetical protein B456_003G027700                  65.5    8e-10   Gossypium raimondii
ref|XP_009372463.1|  PREDICTED: RNA-binding protein MEX3B-like is...  65.5    9e-10   
ref|XP_009372464.1|  PREDICTED: RNA-binding protein MEX3B-like is...  65.5    1e-09   
ref|XP_009336090.1|  PREDICTED: RNA-binding protein MEX3B-like        65.5    1e-09   
ref|XP_010439071.1|  PREDICTED: mitochondrial ubiquitin ligase ac...  65.1    1e-09   Camelina sativa [gold-of-pleasure]
gb|KDP41659.1|  hypothetical protein JCGZ_16066                       67.8    1e-09   Jatropha curcas
ref|XP_004499030.1|  PREDICTED: uncharacterized protein LOC101496542  67.4    2e-09   Cicer arietinum [garbanzo]
ref|XP_010028145.1|  PREDICTED: baculoviral IAP repeat-containing...  63.9    2e-09   Eucalyptus grandis [rose gum]
ref|XP_010433802.1|  PREDICTED: RNA-binding E3 ubiquitin-protein ...  64.3    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_001772864.1|  predicted protein                                67.0    3e-09   
ref|XP_002438171.1|  hypothetical protein SORBIDRAFT_10g009080        64.3    3e-09   
ref|XP_002967442.1|  hypothetical protein SELMODRAFT_87199            62.0    3e-09   
ref|XP_007047432.1|  RING finger protein B, putative                  63.5    4e-09   
ref|XP_010495684.1|  PREDICTED: uncharacterized protein LOC104772813  62.0    4e-09   Camelina sativa [gold-of-pleasure]
dbj|BAD46155.1|  hypothetical protein                                 63.5    5e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CDP01243.1|  unnamed protein product                              65.9    5e-09   Coffea canephora [robusta coffee]
ref|XP_007136732.1|  hypothetical protein PHAVU_009G069600g           65.9    5e-09   Phaseolus vulgaris [French bean]
gb|EEE65460.1|  hypothetical protein OsJ_20838                        61.2    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011458845.1|  PREDICTED: uncharacterized protein LOC101292...  65.1    8e-09   Fragaria vesca subsp. vesca
gb|ABK24811.1|  unknown                                               65.1    1e-08   Picea sitchensis
ref|XP_010271532.1|  PREDICTED: uncharacterized protein LOC104607564  64.7    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_004292747.1|  PREDICTED: uncharacterized protein LOC101292...  64.7    1e-08   Fragaria vesca subsp. vesca
ref|XP_007018571.1|  RING/U-box superfamily protein isoform 2         64.7    1e-08   
gb|ABD33279.1|  Zinc finger, RING-type                                64.7    1e-08   Medicago truncatula
ref|XP_007018572.1|  RING/U-box superfamily protein isoform 3         64.7    1e-08   
gb|AES59366.2|  ubiquitin-protein ligase, putative                    64.7    1e-08   Medicago truncatula
ref|XP_004287981.1|  PREDICTED: E3 ubiquitin-protein ligase Mdm2      62.4    1e-08   Fragaria vesca subsp. vesca
ref|XP_011099344.1|  PREDICTED: apoptosis 1 inhibitor-like            62.0    1e-08   Sesamum indicum [beniseed]
ref|XP_002867675.1|  hypothetical protein ARALYDRAFT_329238           62.0    1e-08   
ref|XP_008338401.1|  PREDICTED: RNA-binding protein MEX3B-like is...  61.6    2e-08   
emb|CDP02557.1|  unnamed protein product                              62.0    2e-08   Coffea canephora [robusta coffee]
ref|XP_010277150.1|  PREDICTED: uncharacterized protein LOC104611...  64.3    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010277151.1|  PREDICTED: uncharacterized protein LOC104611...  63.9    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_011008574.1|  PREDICTED: apoptosis 1 inhibitor-like            62.0    2e-08   Populus euphratica
ref|XP_008338399.1|  PREDICTED: RNA-binding protein MEX3B-like is...  62.0    2e-08   
ref|XP_002524949.1|  conserved hypothetical protein                   60.1    2e-08   
gb|EYU18316.1|  hypothetical protein MIMGU_mgv1a006609mg              63.9    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_008338400.1|  PREDICTED: RNA-binding protein MEX3B-like is...  61.6    3e-08   
ref|XP_010059871.1|  PREDICTED: uncharacterized protein LOC104447...  63.5    3e-08   Eucalyptus grandis [rose gum]
ref|XP_009137428.1|  PREDICTED: E3 ubiquitin-protein ligase NEURL...  60.5    3e-08   Brassica rapa
gb|KCW66317.1|  hypothetical protein EUGRSUZ_F00142                   63.2    3e-08   Eucalyptus grandis [rose gum]
ref|XP_010059869.1|  PREDICTED: uncharacterized protein LOC104447...  63.5    3e-08   Eucalyptus grandis [rose gum]
ref|XP_010059870.1|  PREDICTED: uncharacterized protein LOC104447...  63.5    3e-08   Eucalyptus grandis [rose gum]
ref|XP_010086625.1|  putative E3 ubiquitin-protein ligase XBOS34      63.5    4e-08   
ref|XP_008438514.1|  PREDICTED: putative E3 ubiquitin-protein lig...  63.2    4e-08   Cucumis melo [Oriental melon]
ref|XP_010679564.1|  PREDICTED: RNA-binding protein MEX3B             60.5    5e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009777213.1|  PREDICTED: uncharacterized protein LOC104226...  62.8    5e-08   Nicotiana sylvestris
gb|KHN04458.1|  Apoptosis 1 inhibitor                                 62.8    5e-08   Glycine soja [wild soybean]
ref|XP_008438510.1|  PREDICTED: putative E3 ubiquitin-protein lig...  62.8    5e-08   Cucumis melo [Oriental melon]
ref|XP_006578043.1|  PREDICTED: uncharacterized protein LOC100777...  62.8    5e-08   Glycine max [soybeans]
ref|XP_009360243.1|  PREDICTED: uncharacterized protein LOC103950...  62.8    5e-08   
ref|XP_008377991.1|  PREDICTED: uncharacterized protein LOC103441...  62.8    5e-08   
ref|XP_009777212.1|  PREDICTED: uncharacterized protein LOC104226...  62.8    5e-08   Nicotiana sylvestris
ref|XP_006578044.1|  PREDICTED: uncharacterized protein LOC100777...  62.8    6e-08   Glycine max [soybeans]
ref|XP_003523614.2|  PREDICTED: uncharacterized protein LOC100777...  62.8    6e-08   Glycine max [soybeans]
gb|KHN45168.1|  Apoptosis 1 inhibitor                                 62.8    6e-08   Glycine soja [wild soybean]
ref|XP_009354132.1|  PREDICTED: uncharacterized protein LOC103945...  62.4    6e-08   Pyrus x bretschneideri [bai li]
ref|XP_004167338.1|  PREDICTED: putative E3 ubiquitin-protein lig...  62.8    6e-08   
ref|XP_006581252.1|  PREDICTED: uncharacterized protein LOC100794488  62.8    6e-08   Glycine max [soybeans]
ref|XP_011099345.1|  PREDICTED: RNA-binding protein MEX3B-like        60.1    6e-08   Sesamum indicum [beniseed]
ref|XP_009777211.1|  PREDICTED: uncharacterized protein LOC104226...  62.4    6e-08   Nicotiana sylvestris
ref|XP_004134060.1|  PREDICTED: putative E3 ubiquitin-protein lig...  62.8    6e-08   
ref|XP_009354130.1|  PREDICTED: uncharacterized protein LOC103945...  62.4    7e-08   
ref|XP_009354131.1|  PREDICTED: uncharacterized protein LOC103945...  62.4    7e-08   Pyrus x bretschneideri [bai li]
ref|XP_008377989.1|  PREDICTED: uncharacterized protein LOC103441...  62.4    8e-08   
ref|XP_008377990.1|  PREDICTED: uncharacterized protein LOC103441...  62.4    8e-08   
ref|XP_009360249.1|  PREDICTED: uncharacterized protein LOC103950...  62.4    8e-08   Pyrus x bretschneideri [bai li]
gb|KFK28983.1|  hypothetical protein AALP_AA7G073300                  61.6    9e-08   Arabis alpina [alpine rockcress]
ref|XP_008351980.1|  PREDICTED: uncharacterized protein LOC103415...  61.6    1e-07   
ref|XP_009834277.1|  hypothetical protein H257_09679                  62.0    1e-07   Aphanomyces astaci
ref|NP_001119039.1|  RING-finger domain-containing protein            59.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010227782.1|  PREDICTED: RNA-binding protein MEX3B             58.9    1e-07   
ref|NP_001119040.1|  RING-finger domain-containing protein            59.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351979.1|  PREDICTED: uncharacterized protein LOC103415...  61.6    1e-07   
ref|XP_008393760.1|  PREDICTED: uncharacterized protein LOC103455926  61.6    1e-07   
gb|ABK28118.1|  unknown                                               58.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001119038.1|  RING-finger domain-containing protein            58.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|EYU41897.1|  hypothetical protein MIMGU_mgv1a012839mg              60.1    2e-07   Erythranthe guttata [common monkey flower]
emb|CEG80583.1|  hypothetical protein RMATCC62417_14895               60.8    2e-07   Rhizopus microsporus
ref|XP_008238535.1|  PREDICTED: E3 ubiquitin-protein ligase NEURL...  59.3    2e-07   Prunus mume [ume]
ref|XP_006406051.1|  hypothetical protein EUTSA_v10020731mg           61.2    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_647025.1|  hypothetical protein DDB_G0268864                   60.8    2e-07   Dictyostelium discoideum AX4
ref|XP_002115775.1|  hypothetical protein TRIADDRAFT_59820            59.7    3e-07   Trichoplax adhaerens
ref|XP_005112901.1|  PREDICTED: probable E3 ubiquitin-protein lig...  57.0    3e-07   
ref|XP_007206737.1|  hypothetical protein PRUPE_ppa025017mg           58.9    3e-07   
ref|XP_002901808.1|  conserved hypothetical protein                   60.5    3e-07   Phytophthora infestans T30-4
ref|XP_009834332.1|  hypothetical protein H257_09715                  60.5    3e-07   Aphanomyces astaci
ref|XP_002413290.1|  RING finger protein, putative                    56.6    4e-07   Ixodes scapularis [blacklegged tick]
ref|XP_001771059.1|  predicted protein                                60.5    4e-07   
gb|KHG28017.1|  putative E3 ubiquitin-protein ligase XBOS34           60.1    5e-07   Gossypium arboreum [tree cotton]
emb|CDX85079.1|  BnaC07g08270D                                        59.7    5e-07   
ref|XP_009102639.1|  PREDICTED: putative E3 ubiquitin-protein lig...  59.7    5e-07   Brassica rapa
ref|XP_009102638.1|  PREDICTED: putative E3 ubiquitin-protein lig...  59.7    6e-07   Brassica rapa
gb|ESA19403.1|  hypothetical protein GLOINDRAFT_19619                 57.4    7e-07   
ref|XP_007050280.1|  XB3 in, putative isoform 1                       59.3    8e-07   
ref|XP_001776905.1|  predicted protein                                59.3    8e-07   
gb|EPB90055.1|  hypothetical protein HMPREF1544_03167                 58.9    9e-07   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_009376980.1|  PREDICTED: putative E3 ubiquitin-protein lig...  58.5    9e-07   Pyrus x bretschneideri [bai li]
gb|KJB29436.1|  hypothetical protein B456_005G100500                  58.9    1e-06   Gossypium raimondii
ref|XP_009365984.1|  PREDICTED: putative E3 ubiquitin-protein lig...  59.3    1e-06   Pyrus x bretschneideri [bai li]
gb|KDO60480.1|  hypothetical protein CISIN_1g010439mg                 59.3    1e-06   
ref|XP_009365983.1|  PREDICTED: putative E3 ubiquitin-protein lig...  59.3    1e-06   
gb|KDO19228.1|  hypothetical protein SPRG_21526                       59.3    1e-06   
gb|KDO60479.1|  hypothetical protein CISIN_1g010439mg                 58.9    1e-06   
ref|XP_006443829.1|  hypothetical protein CICLE_v10024413mg           58.9    1e-06   
ref|XP_010939667.1|  PREDICTED: uncharacterized protein LOC105058426  58.9    1e-06   
emb|CDX85082.1|  BnaC07g08240D                                        58.9    1e-06   
ref|XP_008193068.1|  PREDICTED: protein neuralized-like               58.2    1e-06   
gb|KDO60477.1|  hypothetical protein CISIN_1g010439mg                 58.9    1e-06   
gb|KDO60478.1|  hypothetical protein CISIN_1g010439mg                 58.9    1e-06   
ref|XP_007050281.1|  XB3 in, putative isoform 2                       58.9    1e-06   
dbj|GAN10109.1|  E3 ubiquitin-protein ligase rififylin isoform X15    58.5    1e-06   
ref|XP_008780920.1|  PREDICTED: uncharacterized protein LOC103700820  58.9    1e-06   
emb|CDY62836.1|  BnaC05g50910D                                        58.5    1e-06   
gb|EPS57172.1|  hypothetical protein M569_17649                       58.2    2e-06   
ref|NP_510819.3|  Protein F10D7.5, isoform c                          58.2    2e-06   
pir||T16028  hypothetical protein F10D7.5 - Caenorhabditis elegans    58.5    2e-06
ref|XP_002532035.1|  conserved hypothetical protein                   57.4    2e-06   
ref|XP_002901809.1|  conserved hypothetical protein                   58.2    2e-06   
ref|XP_010679336.1|  PREDICTED: probable E3 ubiquitin-protein lig...  58.2    2e-06   
dbj|BAJ95728.1|  predicted protein                                    58.2    2e-06   
ref|NP_510818.3|  Protein F10D7.5, isoform a                          58.5    2e-06   
ref|XP_006285527.1|  hypothetical protein CARUB_v10006969mg           55.8    2e-06   
ref|XP_654259.2|  zinc finger domain containing protein               55.5    3e-06   
ref|XP_008863390.1|  hypothetical protein H310_01852                  57.8    3e-06   
gb|KDO29627.1|  hypothetical protein SPRG_05580                       57.4    3e-06   
ref|XP_010466651.1|  PREDICTED: putative E3 ubiquitin-protein lig...  57.8    3e-06   
gb|EAS00127.2|  zinc finger, C3HC4 type (RING finger) protein         57.8    3e-06   
ref|XP_008366256.1|  PREDICTED: putative E3 ubiquitin-protein lig...  57.8    3e-06   
gb|EYE90747.1|  hypothetical protein EURHEDRAFT_518956                57.8    3e-06   
gb|ETO78926.1|  hypothetical protein F444_06277                       57.4    3e-06   
gb|ETI50203.1|  hypothetical protein F443_06211                       57.4    4e-06   
ref|XP_008891655.1|  hypothetical protein PPTG_02341                  57.4    4e-06   
ref|XP_010466650.1|  PREDICTED: putative E3 ubiquitin-protein lig...  57.4    4e-06   
ref|XP_009102643.1|  PREDICTED: putative E3 ubiquitin-protein lig...  57.4    4e-06   
ref|XP_010512292.1|  PREDICTED: putative E3 ubiquitin-protein lig...  57.4    4e-06   
ref|XP_011462271.1|  PREDICTED: putative E3 ubiquitin-protein lig...  57.4    4e-06   
ref|XP_002274072.1|  PREDICTED: putative E3 ubiquitin-protein lig...  57.4    4e-06   
ref|XP_008382397.1|  PREDICTED: probable E3 ubiquitin-protein lig...  56.6    4e-06   
ref|XP_011462270.1|  PREDICTED: putative E3 ubiquitin-protein lig...  57.4    4e-06   
ref|XP_011064729.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...  57.0    4e-06   
ref|XP_003730074.1|  PREDICTED: probable 3-hydroxybutyryl-CoA deh...  57.0    4e-06   
ref|XP_001763413.1|  predicted protein                                57.4    4e-06   
ref|XP_010512284.1|  PREDICTED: putative E3 ubiquitin-protein lig...  57.4    4e-06   
gb|KFK39617.1|  hypothetical protein AALP_AA3G267100                  57.4    4e-06   
emb|CDX77533.1|  BnaA07g06710D                                        57.0    4e-06   
ref|XP_006857296.1|  hypothetical protein AMTR_s00067p00047970        57.0    5e-06   
emb|CCA16210.1|  conserved hypothetical protein                       57.0    5e-06   
gb|KJB42275.1|  hypothetical protein B456_007G146700                  57.0    5e-06   
gb|KFK39616.1|  hypothetical protein AALP_AA3G267100                  57.0    5e-06   
gb|KIX07530.1|  hypothetical protein Z518_02183                       57.4    5e-06   
ref|XP_010556424.1|  PREDICTED: RNA-binding E3 ubiquitin-protein ...  55.1    5e-06   
gb|KEH42761.1|  E3 ubiquitin-protein ligase XBAT35, putative          56.6    6e-06   
ref|XP_007035132.1|  XB3 in, putative isoform 1                       56.6    6e-06   
ref|XP_007035133.1|  XB3 in, putative isoform 2                       56.6    6e-06   
ref|XP_002131654.1|  PREDICTED: baculoviral IAP repeat-containing...  56.6    7e-06   
gb|KEH42762.1|  E3 ubiquitin-protein ligase XBAT35, putative          56.6    7e-06   
ref|XP_006365899.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.6    7e-06   
gb|EXX57049.1|  Vps27p                                                56.6    7e-06   
gb|KDO22372.1|  hypothetical protein SPRG_11324                       56.6    7e-06   
ref|XP_009789557.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.6    7e-06   
gb|EGI59108.1|  E3 ubiquitin-protein ligase rififylin                 56.2    7e-06   
ref|XP_003106628.1|  hypothetical protein CRE_16814                   56.6    8e-06   
ref|YP_473308.1|  IAP3                                                55.8    8e-06   
ref|XP_011064728.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...  56.2    8e-06   
ref|XP_001024764.1|  hypothetical protein TTHERM_00237340             56.6    8e-06   
ref|XP_006829291.1|  hypothetical protein AMTR_s00001p00273000        56.2    8e-06   
emb|CDY35522.1|  BnaA01g23900D                                        56.6    8e-06   
gb|KDP26523.1|  hypothetical protein JCGZ_17681                       56.2    9e-06   
ref|XP_009519361.1|  hypothetical protein PHYSODRAFT_349825           56.2    9e-06   
ref|XP_009789559.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.2    9e-06   
ref|XP_010527401.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.2    9e-06   
ref|XP_008607657.1|  hypothetical protein SDRG_03791                  56.2    9e-06   
ref|XP_006299555.1|  hypothetical protein CARUB_v10015729mg           56.2    9e-06   
ref|XP_003385858.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  55.8    9e-06   
ref|XP_009789556.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.2    1e-05   
ref|XP_009628305.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.2    1e-05   
ref|XP_009628304.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.2    1e-05   
ref|XP_008199898.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  55.8    1e-05   
ref|XP_010104756.1|  Putative E3 ubiquitin-protein ligase XBAT35      55.8    1e-05   
ref|XP_004147147.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.2    1e-05   
ref|XP_004240501.1|  PREDICTED: putative E3 ubiquitin-protein lig...  56.2    1e-05   
ref|XP_004160586.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.8    1e-05   
emb|CDQ70600.1|  unnamed protein product                              55.1    1e-05   
emb|CDS10859.1|  hypothetical protein LRAMOSA11345                    55.5    1e-05   
gb|ERG84040.1|  protein neuralized                                    55.8    1e-05   
ref|XP_002306855.1|  hypothetical protein POPTR_0005s24690g           54.7    2e-05   
ref|XP_003744443.1|  PREDICTED: E3 ubiquitin-protein ligase IAP-3...  55.5    2e-05   
emb|CAN68429.1|  hypothetical protein VITISV_012133                   55.8    2e-05   
gb|EJW73140.1|  hypothetical protein WUBG_15954                       53.1    2e-05   
gb|ETL43482.1|  hypothetical protein L916_06029                       55.5    2e-05   
gb|ETM49810.1|  hypothetical protein L914_06031                       55.5    2e-05   
gb|ETO78925.1|  hypothetical protein F444_06276                       55.5    2e-05   
gb|ETL96665.1|  hypothetical protein L917_05907                       55.5    2e-05   
ref|XP_008891654.1|  hypothetical protein PPTG_02340                  55.5    2e-05   
gb|ETI50202.1|  hypothetical protein F443_06210                       55.5    2e-05   
ref|XP_008860232.1|  zinc finger domain containing protein            53.1    2e-05   
gb|EMS62354.1|  hypothetical protein TRIUR3_18567                     55.1    2e-05   
emb|CDQ57075.1|  unnamed protein product                              55.5    2e-05   
ref|XP_010783763.1|  PREDICTED: mitochondrial ubiquitin ligase ac...  55.1    2e-05   
gb|KGB41987.1|  E3 ubiquitin-protein ligase rififylin                 54.7    2e-05   
ref|XP_009826084.1|  hypothetical protein H257_03612                  55.5    2e-05   
gb|ETK90085.1|  hypothetical protein L915_06091                       55.1    2e-05   
emb|CBY07841.1|  unnamed protein product                              55.1    2e-05   
gb|KHN79292.1|  Protein neuralized                                    55.5    2e-05   
gb|EAS05303.2|  zinc finger, C3HC4 type (RING finger) protein         55.5    2e-05   
ref|XP_002883418.1|  zinc finger family protein                       55.1    2e-05   
gb|KHG19957.1|  Putative E3 ubiquitin-protein ligase XBAT35 -like...  55.1    2e-05   
ref|NP_850628.1|  putative E3 ubiquitin-protein ligase XBAT35         55.1    2e-05   
ref|XP_001651536.1|  AAEL015303-PA                                    52.0    2e-05   
gb|KJB72370.1|  hypothetical protein B456_011G174600                  55.1    2e-05   
ref|XP_011313386.1|  PREDICTED: uncharacterized protein LOC105272851  55.5    2e-05   
gb|KJB72373.1|  hypothetical protein B456_011G174600                  55.1    2e-05   
emb|CCD81996.1|  putative zinc finger protein                         54.3    2e-05   
gb|KJB72371.1|  hypothetical protein B456_011G174600                  55.1    2e-05   
ref|XP_010671019.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.1    2e-05   
gb|KJB72369.1|  hypothetical protein B456_011G174600                  55.1    2e-05   
ref|XP_009603581.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.1    2e-05   
gb|AAM65682.1|  unknown                                               55.1    2e-05   
ref|XP_010671020.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.1    2e-05   
gb|ABG37641.1|  auxin-regulated protein-like protein                  55.1    2e-05   
gb|KDO22371.1|  hypothetical protein SPRG_11323                       55.1    2e-05   
gb|EYU32559.1|  hypothetical protein MIMGU_mgv1a006594mg              55.1    2e-05   
emb|CDH58818.1|  cyclophilin b precursor                              55.1    2e-05   
ref|XP_009603580.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.1    3e-05   
gb|KJB72372.1|  hypothetical protein B456_011G174600                  55.1    3e-05   
ref|XP_010262327.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.1    3e-05   
gb|EAS04519.2|  zinc finger, C3HC4 type (RING finger) protein         54.3    3e-05   
ref|NP_566724.1|  putative E3 ubiquitin-protein ligase XBAT35         55.1    3e-05   
ref|XP_008224346.1|  PREDICTED: putative E3 ubiquitin-protein lig...  55.1    3e-05   
ref|XP_008224345.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.7    3e-05   
ref|XP_009764908.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.7    3e-05   
ref|XP_001025548.1|  hypothetical protein TTHERM_01020710             55.1    3e-05   
ref|XP_009396978.1|  PREDICTED: probable E3 ubiquitin-protein lig...  54.7    3e-05   
ref|XP_009764907.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.7    3e-05   
dbj|BAA95741.1|  unnamed protein product                              54.7    3e-05   
ref|XP_010778414.1|  PREDICTED: E3 ubiquitin-protein ligase NEURL...  54.7    3e-05   
ref|XP_002963644.1|  hypothetical protein SELMODRAFT_141633           54.7    3e-05   
ref|XP_010679337.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.7    3e-05   
ref|XP_008863344.1|  hypothetical protein H310_01815                  54.7    4e-05   
ref|XP_009390844.1|  PREDICTED: uncharacterized protein LOC103977...  54.3    4e-05   
ref|XP_002324376.2|  hypothetical protein POPTR_0018s03330g           53.9    4e-05   
ref|XP_001650378.1|  AAEL005126-PA                                    54.7    4e-05   
ref|XP_002974733.1|  hypothetical protein SELMODRAFT_102072           54.3    4e-05   
ref|XP_009390842.1|  PREDICTED: uncharacterized protein LOC103977...  54.3    4e-05   
ref|XP_009390843.1|  PREDICTED: uncharacterized protein LOC103977...  54.3    4e-05   
ref|XP_004356735.1|  3-hydroxyacyl-CoA dehydrogenase, NAD binding...  54.3    4e-05   
ref|XP_011057776.1|  PREDICTED: putative inhibitor of apoptosis       53.9    4e-05   
ref|XP_011073533.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.3    4e-05   
ref|XP_011073534.1|  PREDICTED: putative E3 ubiquitin-protein lig...  54.3    4e-05   
emb|CDY08997.1|  BnaC01g30940D                                        53.9    4e-05   
ref|XP_003141695.1|  hypothetical protein LOAG_06111                  54.3    5e-05   
gb|EKC20607.1|  E3 ubiquitin-protein ligase LINCR                     52.8    5e-05   
emb|CDQ73705.1|  unnamed protein product                              53.9    5e-05   
gb|EFZ09893.1|  hypothetical protein SINV_01950                       53.9    5e-05   
emb|CDP94645.1|  Protein Bm3265, isoform f                            54.3    5e-05   
ref|XP_010650096.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.9    5e-05   
ref|XP_011471546.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.9    5e-05   
gb|EFO22374.2|  hypothetical protein LOAG_06111                       54.3    5e-05   
ref|XP_006640289.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...  53.9    5e-05   
gb|EJY88708.1|  putative RING zinc finger protein                     53.5    5e-05   
ref|XP_011004046.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.9    5e-05   
ref|XP_001899198.1|  Neuralized family protein                        54.3    5e-05   
ref|XP_006489720.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.9    5e-05   
ref|NP_001086842.1|  MGC83329 protein                                 53.5    5e-05   
ref|XP_010896808.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.5    6e-05   
ref|XP_006489719.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.9    6e-05   
ref|XP_005093504.1|  PREDICTED: protein neuralized-like               53.9    6e-05   
ref|XP_006489718.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.9    6e-05   
ref|XP_010650095.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.9    6e-05   
emb|CAG02179.1|  unnamed protein product                              53.5    6e-05   
ref|XP_010896807.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.5    6e-05   
ref|XP_008870987.1|  hypothetical protein H310_07378                  53.9    6e-05   
ref|NP_567428.1|  putative E3 ubiquitin-protein ligase XBAT34         53.5    6e-05   
ref|XP_007143864.1|  hypothetical protein PHAVU_007G108300g           53.5    7e-05   
gb|KDP21507.1|  hypothetical protein JCGZ_21978                       53.5    7e-05   
emb|CDQ60954.1|  unnamed protein product                              53.5    7e-05   
ref|XP_011172324.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34     53.5    7e-05   
ref|XP_011426571.1|  PREDICTED: E3 ubiquitin-protein ligase cblA-...  53.1    7e-05   
ref|XP_008870985.1|  hypothetical protein H310_07376                  53.5    7e-05   
ref|XP_002868287.1|  hypothetical protein ARALYDRAFT_493466           53.5    8e-05   
ref|XP_009782240.1|  PREDICTED: apoptosis 1 inhibitor-like            51.6    8e-05   
gb|EMP27737.1|  Endothelin-converting enzyme 2                        53.5    8e-05   
ref|XP_008621179.1|  hypothetical protein SDRG_16739                  53.5    8e-05   
ref|XP_008876017.1|  hypothetical protein H310_11213                  53.1    8e-05   
gb|AAT07644.1|  unknown protein                                       50.4    8e-05   
emb|CDO99242.1|  unnamed protein product                              53.5    8e-05   
gb|KHN05066.1|  Putative E3 ubiquitin-protein ligase XBAT35           53.5    9e-05   
ref|XP_010146367.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_006420249.1|  hypothetical protein CICLE_v10004847mg           53.5    9e-05   
ref|XP_010764216.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...  53.1    9e-05   
ref|XP_004231892.1|  PREDICTED: apoptosis 1 inhibitor                 51.6    9e-05   
ref|XP_009616362.1|  PREDICTED: apoptosis 1 inhibitor-like            51.6    9e-05   
ref|XP_006420248.1|  hypothetical protein CICLE_v10004847mg           53.5    9e-05   
ref|XP_009579289.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_009012790.1|  hypothetical protein HELRODRAFT_168671           53.5    9e-05   
ref|XP_006606389.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.1    9e-05   
ref|XP_008420461.1|  PREDICTED: E3 ubiquitin-protein ligase NEURL...  53.5    9e-05   
ref|XP_008420446.1|  PREDICTED: E3 ubiquitin-protein ligase NEURL...  53.5    9e-05   
ref|XP_008488916.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_006589266.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.1    9e-05   
ref|XP_010303606.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_009481909.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_009285299.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_001775781.1|  predicted protein                                53.1    9e-05   
emb|CDQ82280.1|  unnamed protein product                              53.1    9e-05   
ref|XP_009643421.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_009962126.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_010002111.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_010109926.1|  Protein neuralized                               53.5    9e-05   
ref|XP_009519362.1|  hypothetical protein PHYSODRAFT_250287           53.1    9e-05   
ref|XP_005154376.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
ref|XP_009695532.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    9e-05   
gb|AAM65242.1|  unknown                                               53.1    1e-04   
ref|XP_009834330.1|  hypothetical protein H257_09713                  53.1    1e-04   
ref|XP_009953513.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    1e-04   
ref|XP_011091307.1|  PREDICTED: putative E3 ubiquitin-protein lig...  53.1    1e-04   
ref|XP_009883437.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    1e-04   
ref|XP_009467189.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    1e-04   
ref|XP_010019865.1|  PREDICTED: E3 ubiquitin-protein ligase NEURL1    53.1    1e-04   
ref|XP_009910275.1|  PREDICTED: E3 ubiquitin-protein ligase rifif...  53.1    1e-04   



>emb|CDP06483.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 102/148 (69%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRIL------NNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    + +A          N    R +  +TGS R P+L +K DD  S GSSY
Sbjct  345  TYVVGIGGMTILMLVAFHFFIHLGCTNQDGSRIRFGETGSARTPLLENKDDDISSWGSSY  404

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+SQDDEDAEE  ++ +L+G   KD E  +++R LCAICFDAPRDC FLPCGHC++CF 
Sbjct  405  DSVSQDDEDAEEGQAAGSLEGISAKDGEYNNNIRRLCAICFDAPRDCFFLPCGHCVACFA  464

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AG CP+CRR MKKV+KI+TV
Sbjct  465  CGTRIAEAAGACPICRRNMKKVRKIFTV  492



>ref|XP_009796835.1| PREDICTED: uncharacterized protein LOC104243355 isoform X3 [Nicotiana 
sylvestris]
Length=376

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 100/148 (68%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNN---XHRRAQLEDTGS---ERVPMLSDKQDDNLSLGSSY  612
            TY LG+GG  F ++L    LNN    H+    +  GS   ++ P+LS K DD  S GSSY
Sbjct  229  TYLLGVGGMSFLIWLVFWYLNNMQSTHQEGTRDPVGSMESQQTPLLSRKDDDLTSWGSSY  288

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
              LSQDDE  E+    +   GK VKD E  S++R LCAICFDAPRDC FLPCGH  SCFE
Sbjct  289  DGLSQDDEYNEDGLDLTAPQGKQVKDGEYNSNIRRLCAICFDAPRDCFFLPCGHYASCFE  348

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCP+CRR MKKV+KIY+V
Sbjct  349  CGTRIAEAAGTCPICRRPMKKVRKIYSV  376



>gb|KJB55742.1| hypothetical protein B456_009G092000 [Gossypium raimondii]
 gb|KJB55743.1| hypothetical protein B456_009G092000 [Gossypium raimondii]
Length=329

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            +YF+G G     V +A R+     RR+ + + GS+R P+L+ K DD  S GSSY SLS +
Sbjct  184  SYFVGSGVMTVLVLIAFRLWKMKQRRSNVGEMGSQRAPLLAQKDDDIASWGSSYYSLS-N  242

Query  593  DEDAEEP----TSSSTLDGKPVKDSEQS--DMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            DED E+P     +++ L+GKP+ D E+S  + RHLC +CF +PRDC FLPCGHC +CF C
Sbjct  243  DEDEEDPETWQQAATCLEGKPLNDGERSSNNPRHLCVVCFGSPRDCFFLPCGHCATCFTC  302

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE AGTCP+CRR+MKKV+K++TV
Sbjct  303  GTRIAEEAGTCPICRRKMKKVRKVFTV  329



>ref|XP_009796833.1| PREDICTED: uncharacterized protein LOC104243355 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009796834.1| PREDICTED: uncharacterized protein LOC104243355 isoform X2 [Nicotiana 
sylvestris]
Length=384

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 100/148 (68%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNN---XHRRAQLEDTGS---ERVPMLSDKQDDNLSLGSSY  612
            TY LG+GG  F ++L    LNN    H+    +  GS   ++ P+LS K DD  S GSSY
Sbjct  237  TYLLGVGGMSFLIWLVFWYLNNMQSTHQEGTRDPVGSMESQQTPLLSRKDDDLTSWGSSY  296

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
              LSQDDE  E+    +   GK VKD E  S++R LCAICFDAPRDC FLPCGH  SCFE
Sbjct  297  DGLSQDDEYNEDGLDLTAPQGKQVKDGEYNSNIRRLCAICFDAPRDCFFLPCGHYASCFE  356

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCP+CRR MKKV+KIY+V
Sbjct  357  CGTRIAEAAGTCPICRRPMKKVRKIYSV  384



>gb|KJB55744.1| hypothetical protein B456_009G092000 [Gossypium raimondii]
Length=371

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            +YF+G G     V +A R+     RR+ + + GS+R P+L+ K DD  S GSSY SLS +
Sbjct  226  SYFVGSGVMTVLVLIAFRLWKMKQRRSNVGEMGSQRAPLLAQKDDDIASWGSSYYSLS-N  284

Query  593  DEDAEEP----TSSSTLDGKPVKDSEQS--DMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            DED E+P     +++ L+GKP+ D E+S  + RHLC +CF +PRDC FLPCGHC +CF C
Sbjct  285  DEDEEDPETWQQAATCLEGKPLNDGERSSNNPRHLCVVCFGSPRDCFFLPCGHCATCFTC  344

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE AGTCP+CRR+MKKV+K++TV
Sbjct  345  GTRIAEEAGTCPICRRKMKKVRKVFTV  371



>gb|KHG10598.1| putative E3 ubiquitin-protein ligase XBOS34 [Gossypium arboreum]
Length=458

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 106/147 (72%), Gaps = 7/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            TYF+G G     + +A R+     RR+ + + GS+R P+L++K DD  S GSSY SLS +
Sbjct  313  TYFVGSGVMTVLILIAFRLWKMKQRRSNVGEMGSQRAPLLAEKDDDIASWGSSYYSLS-N  371

Query  593  DEDAEEP----TSSSTLDGKPVKDSEQS--DMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            DED E+P     +++ L+GKP+ D E+S  + RHLC +CF +PRDC FLPCGHC +CF C
Sbjct  372  DEDEEDPETWQQAATCLEGKPLNDGERSSNNPRHLCVVCFGSPRDCFFLPCGHCATCFTC  431

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE AGTCP+CRR+MKKV+K++TV
Sbjct  432  GTRIAEEAGTCPICRRKMKKVRKVFTV  458



>gb|KJB55736.1| hypothetical protein B456_009G092000 [Gossypium raimondii]
Length=394

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            +YF+G G     V +A R+     RR+ + + GS+R P+L+ K DD  S GSSY SLS +
Sbjct  249  SYFVGSGVMTVLVLIAFRLWKMKQRRSNVGEMGSQRAPLLAQKDDDIASWGSSYYSLS-N  307

Query  593  DEDAEEP----TSSSTLDGKPVKDSEQS--DMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            DED E+P     +++ L+GKP+ D E+S  + RHLC +CF +PRDC FLPCGHC +CF C
Sbjct  308  DEDEEDPETWQQAATCLEGKPLNDGERSSNNPRHLCVVCFGSPRDCFFLPCGHCATCFTC  367

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE AGTCP+CRR+MKKV+K++TV
Sbjct  368  GTRIAEEAGTCPICRRKMKKVRKVFTV  394



>ref|XP_009796832.1| PREDICTED: uncharacterized protein LOC104243355 isoform X1 [Nicotiana 
sylvestris]
Length=460

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 100/148 (68%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNN---XHRRAQLEDTGS---ERVPMLSDKQDDNLSLGSSY  612
            TY LG+GG  F ++L    LNN    H+    +  GS   ++ P+LS K DD  S GSSY
Sbjct  313  TYLLGVGGMSFLIWLVFWYLNNMQSTHQEGTRDPVGSMESQQTPLLSRKDDDLTSWGSSY  372

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
              LSQDDE  E+    +   GK VKD E  S++R LCAICFDAPRDC FLPCGH  SCFE
Sbjct  373  DGLSQDDEYNEDGLDLTAPQGKQVKDGEYNSNIRRLCAICFDAPRDCFFLPCGHYASCFE  432

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCP+CRR MKKV+KIY+V
Sbjct  433  CGTRIAEAAGTCPICRRPMKKVRKIYSV  460



>ref|XP_006365595.1| PREDICTED: uncharacterized protein LOC102603607 [Solanum tuberosum]
Length=466

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 100/148 (68%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNN---XHRRAQLEDTG---SERVPMLSDKQDDNLSLGSSY  612
            TY LG+GG  F ++L  R LNN    H     +  G   SE+ P++S K DD  S GSSY
Sbjct  319  TYLLGVGGMSFLIWLVFRYLNNMQSTHLEGIRDPVGPMESEQTPLISRKDDDIASWGSSY  378

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
              LSQDDE  E     + + G+ VKD E  S++R LCAICFDAPRDC FLPCGH  SCFE
Sbjct  379  DGLSQDDEYNEGVLDLTAVQGRQVKDGEYNSNIRRLCAICFDAPRDCFFLPCGHHASCFE  438

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCP+CRR +KKV+KIYTV
Sbjct  439  CGTRIAEVAGTCPICRRPIKKVRKIYTV  466



>gb|KJB55738.1| hypothetical protein B456_009G092000 [Gossypium raimondii]
Length=475

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            +YF+G G     V +A R+     RR+ + + GS+R P+L+ K DD  S GSSY SLS +
Sbjct  330  SYFVGSGVMTVLVLIAFRLWKMKQRRSNVGEMGSQRAPLLAQKDDDIASWGSSYYSLS-N  388

Query  593  DEDAEEP----TSSSTLDGKPVKDSEQS--DMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            DED E+P     +++ L+GKP+ D E+S  + RHLC +CF +PRDC FLPCGHC +CF C
Sbjct  389  DEDEEDPETWQQAATCLEGKPLNDGERSSNNPRHLCVVCFGSPRDCFFLPCGHCATCFTC  448

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE AGTCP+CRR+MKKV+K++TV
Sbjct  449  GTRIAEEAGTCPICRRKMKKVRKVFTV  475



>gb|KJB55737.1| hypothetical protein B456_009G092000 [Gossypium raimondii]
Length=466

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            +YF+G G     V +A R+     RR+ + + GS+R P+L+ K DD  S GSSY SLS +
Sbjct  321  SYFVGSGVMTVLVLIAFRLWKMKQRRSNVGEMGSQRAPLLAQKDDDIASWGSSYYSLS-N  379

Query  593  DEDAEEP----TSSSTLDGKPVKDSEQS--DMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            DED E+P     +++ L+GKP+ D E+S  + RHLC +CF +PRDC FLPCGHC +CF C
Sbjct  380  DEDEEDPETWQQAATCLEGKPLNDGERSSNNPRHLCVVCFGSPRDCFFLPCGHCATCFTC  439

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE AGTCP+CRR+MKKV+K++TV
Sbjct  440  GTRIAEEAGTCPICRRKMKKVRKVFTV  466



>gb|KJB55741.1| hypothetical protein B456_009G092000 [Gossypium raimondii]
Length=517

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            +YF+G G     V +A R+     RR+ + + GS+R P+L+ K DD  S GSSY SLS +
Sbjct  372  SYFVGSGVMTVLVLIAFRLWKMKQRRSNVGEMGSQRAPLLAQKDDDIASWGSSYYSLS-N  430

Query  593  DEDAEEP----TSSSTLDGKPVKDSEQS--DMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            DED E+P     +++ L+GKP+ D E+S  + RHLC +CF +PRDC FLPCGHC +CF C
Sbjct  431  DEDEEDPETWQQAATCLEGKPLNDGERSSNNPRHLCVVCFGSPRDCFFLPCGHCATCFTC  490

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE AGTCP+CRR+MKKV+K++TV
Sbjct  491  GTRIAEEAGTCPICRRKMKKVRKVFTV  517



>ref|XP_009598981.1| PREDICTED: uncharacterized protein LOC104094705 isoform X2 [Nicotiana 
tomentosiformis]
Length=387

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 97/148 (66%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHR------RAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY LG+GG  F ++L    LNN         R  +    S++ P+LS K DD  S GSSY
Sbjct  240  TYLLGVGGMSFLIWLVFWYLNNMQSTRQEGTRNPVGPMESQQTPLLSRKDDDLASWGSSY  299

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
              LSQDDE  E+    +   GK  KD E  S++R LCAICFDAPRDC FLPCGH  SCFE
Sbjct  300  DGLSQDDEYNEDGLDLTAPQGKQFKDGEYNSNIRRLCAICFDAPRDCFFLPCGHYASCFE  359

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCP+CRR MKKV+KIY+V
Sbjct  360  CGTRIAEAAGTCPICRRPMKKVRKIYSV  387



>gb|KJB55740.1| hypothetical protein B456_009G092000 [Gossypium raimondii]
Length=516

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 105/147 (71%), Gaps = 7/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            +YF+G G     V +A R+     RR+ + + GS+R P+L+ K DD  S GSSY SLS +
Sbjct  371  SYFVGSGVMTVLVLIAFRLWKMKQRRSNVGEMGSQRAPLLAQKDDDIASWGSSYYSLS-N  429

Query  593  DEDAEEP----TSSSTLDGKPVKDSEQS--DMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            DED E+P     +++ L+GKP+ D E+S  + RHLC +CF +PRDC FLPCGHC +CF C
Sbjct  430  DEDEEDPETWQQAATCLEGKPLNDGERSSNNPRHLCVVCFGSPRDCFFLPCGHCATCFTC  489

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE AGTCP+CRR+MKKV+K++TV
Sbjct  490  GTRIAEEAGTCPICRRKMKKVRKVFTV  516



>ref|XP_008243700.1| PREDICTED: uncharacterized protein LOC103341919 isoform X3 [Prunus 
mume]
 ref|XP_008243709.1| PREDICTED: uncharacterized protein LOC103341919 isoform X3 [Prunus 
mume]
 ref|XP_008243717.1| PREDICTED: uncharacterized protein LOC103341919 isoform X4 [Prunus 
mume]
Length=371

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 100/147 (68%), Gaps = 6/147 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            +Y +GIGG    + +A   LN          RAQ ED  SER P+LS K +D  S GS Y
Sbjct  225  SYIVGIGGMTVLMLVAFNFLNKFRCTNEDGIRAQQEDFRSERAPLLSYKDEDQSSWGSLY  284

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S S D+ D E+  ++ +L+GK V+D E ++ R LCAICFDAPRDC FLPCGHC++CF+C
Sbjct  285  DSASNDEGDLEDFLAAGSLEGKSVRDGESNNTRRLCAICFDAPRDCFFLPCGHCVACFDC  344

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
             T+IAE A TCP+CRR +KKV+KI+TV
Sbjct  345  ATRIAEAAATCPICRRNIKKVRKIFTV  371



>ref|XP_009598980.1| PREDICTED: uncharacterized protein LOC104094705 isoform X1 [Nicotiana 
tomentosiformis]
Length=466

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 97/148 (66%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHR------RAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY LG+GG  F ++L    LNN         R  +    S++ P+LS K DD  S GSSY
Sbjct  319  TYLLGVGGMSFLIWLVFWYLNNMQSTRQEGTRNPVGPMESQQTPLLSRKDDDLASWGSSY  378

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
              LSQDDE  E+    +   GK  KD E  S++R LCAICFDAPRDC FLPCGH  SCFE
Sbjct  379  DGLSQDDEYNEDGLDLTAPQGKQFKDGEYNSNIRRLCAICFDAPRDCFFLPCGHYASCFE  438

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCP+CRR MKKV+KIY+V
Sbjct  439  CGTRIAEAAGTCPICRRPMKKVRKIYSV  466



>ref|XP_008243696.1| PREDICTED: uncharacterized protein LOC103341919 isoform X2 [Prunus 
mume]
Length=456

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 100/147 (68%), Gaps = 6/147 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            +Y +GIGG    + +A   LN          RAQ ED  SER P+LS K +D  S GS Y
Sbjct  310  SYIVGIGGMTVLMLVAFNFLNKFRCTNEDGIRAQQEDFRSERAPLLSYKDEDQSSWGSLY  369

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S S D+ D E+  ++ +L+GK V+D E ++ R LCAICFDAPRDC FLPCGHC++CF+C
Sbjct  370  DSASNDEGDLEDFLAAGSLEGKSVRDGESNNTRRLCAICFDAPRDCFFLPCGHCVACFDC  429

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
             T+IAE A TCP+CRR +KKV+KI+TV
Sbjct  430  ATRIAEAAATCPICRRNIKKVRKIFTV  456



>ref|XP_008243690.1| PREDICTED: uncharacterized protein LOC103341919 isoform X1 [Prunus 
mume]
Length=471

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 100/147 (68%), Gaps = 6/147 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            +Y +GIGG    + +A   LN          RAQ ED  SER P+LS K +D  S GS Y
Sbjct  325  SYIVGIGGMTVLMLVAFNFLNKFRCTNEDGIRAQQEDFRSERAPLLSYKDEDQSSWGSLY  384

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S S D+ D E+  ++ +L+GK V+D E ++ R LCAICFDAPRDC FLPCGHC++CF+C
Sbjct  385  DSASNDEGDLEDFLAAGSLEGKSVRDGESNNTRRLCAICFDAPRDCFFLPCGHCVACFDC  444

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
             T+IAE A TCP+CRR +KKV+KI+TV
Sbjct  445  ATRIAEAAATCPICRRNIKKVRKIFTV  471



>gb|KHN46943.1| Putative E3 ubiquitin-protein ligase XBAT34 [Glycine soja]
Length=395

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 98/148 (66%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH----RRAQL--EDTGSERVPMLSDKQDDNLSLGSSY  612
            TY  GIGG    VF A   LN        RA +  E T  +R P+LS+K DD  S GSSY
Sbjct  249  TYIFGIGGLTLLVFGAFNFLNQLQCAHEDRAGVRSEGTSPQRAPLLSNKDDDLSSWGSSY  308

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             SL QD+ED +       +DGK + D E S+  R LCAICFDAPRDC FLPCGHC++CF 
Sbjct  309  ESLPQDEEDIDF-LPGGPIDGKILGDGETSNNTRRLCAICFDAPRDCFFLPCGHCVACFA  367

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCPVCRR MKKV+KI+TV
Sbjct  368  CGTRIAEAAGTCPVCRRNMKKVRKIFTV  395



>ref|XP_008351211.1| PREDICTED: uncharacterized protein LOC103414623, partial [Malus 
domestica]
Length=253

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 6/144 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHR---RAQLEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
            TY +GIGG    +FLA   LN  +    R + ++  SER P+LS K DD  S GSSY S 
Sbjct  113  TYIVGIGGMTVLMFLAFNFLNKCNEDGIRVRHDEFRSERAPLLSYKDDDQSSWGSSYDSA  172

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            S D+ D E+  +    +GK  +D E ++ R LCAICFDAPRDC FLPCGHC++CFEC T+
Sbjct  173  SNDEGDLEDLLAG---EGKMSRDGESNNTRRLCAICFDAPRDCFFLPCGHCVACFECATR  229

Query  422  IAETAGTCPVCRRRMKKVKKIYTV  351
            IAE A TCP+CRR +KKV+KI+TV
Sbjct  230  IAEAAATCPICRRNIKKVRKIFTV  253



>ref|XP_006602668.1| PREDICTED: uncharacterized protein LOC100791057 [Glycine max]
Length=440

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 98/148 (66%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH----RRAQL--EDTGSERVPMLSDKQDDNLSLGSSY  612
            TY  GIGG    VF A   LN        RA +  E T  +R P+LS+K DD  S GSSY
Sbjct  294  TYIFGIGGLTLLVFGAFNFLNQLQCAHEDRAGVRSEGTSPQRAPLLSNKDDDLSSWGSSY  353

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             SL QD+ED +       +DGK + D E S+  R LCAICFDAPRDC FLPCGHC++CF 
Sbjct  354  ESLPQDEEDIDF-LPGGPIDGKILGDGETSNNTRRLCAICFDAPRDCFFLPCGHCVACFA  412

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCPVCRR MKKV+KI+TV
Sbjct  413  CGTRIAEAAGTCPVCRRNMKKVRKIFTV  440



>ref|XP_007205144.1| hypothetical protein PRUPE_ppa005237mg [Prunus persica]
 gb|EMJ06343.1| hypothetical protein PRUPE_ppa005237mg [Prunus persica]
Length=471

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 99/147 (67%), Gaps = 6/147 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    + +A   LN          R Q ED  SER P+LS K +D  S GSSY
Sbjct  325  TYIVGIGGMTVLMLVAFNFLNKFRCTNEDGIRVQQEDFRSERGPLLSYKDEDQSSWGSSY  384

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S S D+   E+  ++ +L+GK V+D E ++ R LCAICFDAPRDC FLPCGHC++CF+C
Sbjct  385  DSASNDEGGLEDFLAAGSLEGKSVRDGESNNTRRLCAICFDAPRDCFFLPCGHCVACFDC  444

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
             T+IAE A TCP+CRR +KKV+KI+TV
Sbjct  445  ATRIAEAAATCPICRRNIKKVRKIFTV  471



>ref|XP_006583657.1| PREDICTED: uncharacterized protein LOC100777141 isoform X2 [Glycine 
max]
Length=373

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 96/148 (65%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH----RRAQLEDTGSER--VPMLSDKQDDNLSLGSSY  612
            TY  GIGG    VF A   LN        RA +   G+ER   P+L  K DD  S GSSY
Sbjct  227  TYIFGIGGLTLLVFGAFNFLNKLQCAHEDRAGVRSEGTERQRAPLLPHKDDDLSSWGSSY  286

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             SL QD++D         +DGK + D E S+  RHLCAICFDAPRDC FLPCGHC++CF 
Sbjct  287  ESLPQDEKDLGF-LPGGPIDGKTLVDGETSNNTRHLCAICFDAPRDCFFLPCGHCVACFA  345

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCPVCRR MKKV+KI+TV
Sbjct  346  CGTRIAEAAGTCPVCRRNMKKVRKIFTV  373



>gb|KHN36429.1| Putative E3 ubiquitin-protein ligase XBAT35 [Glycine soja]
Length=402

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 96/148 (65%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH----RRAQLEDTGSER--VPMLSDKQDDNLSLGSSY  612
            TY  GIGG    VF A   LN        RA +   G+ER   P+L  K DD  S GSSY
Sbjct  256  TYIFGIGGLTLLVFGAFNFLNKLQCAHEDRAGVRSEGTERQRAPLLPHKDDDLSSWGSSY  315

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             SL QD++D         +DGK + D E S+  RHLCAICFDAPRDC FLPCGHC++CF 
Sbjct  316  ESLPQDEKDLGF-LPGGPIDGKTLVDGETSNNTRHLCAICFDAPRDCFFLPCGHCVACFA  374

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCPVCRR MKKV+KI+TV
Sbjct  375  CGTRIAEAAGTCPVCRRNMKKVRKIFTV  402



>ref|XP_010037700.1| PREDICTED: uncharacterized protein LOC104426377 [Eucalyptus grandis]
 gb|KCW49455.1| hypothetical protein EUGRSUZ_K02982 [Eucalyptus grandis]
Length=479

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 100/149 (67%), Gaps = 9/149 (6%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGS-------ERVPMLSDKQDDNLSLGSS  615
            TY +GIGG    + LA   LN   R ++ E TG+       +R P+LS K DD  S GSS
Sbjct  332  TYVVGIGGMTVLMLLAFNFLNK-FRWSREEATGATYGQMEAQRAPLLSYKDDDLSSWGSS  390

Query  614  YCSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLSCF  438
            Y S S D+ED EE  ++   +GK  +D E  ++ R LC ICFDAPRDC FLPCGHC++CF
Sbjct  391  YDSNSHDEEDIEELLAAGAPEGKLSRDGENGNNTRRLCGICFDAPRDCFFLPCGHCVACF  450

Query  437  ECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            ECG +IAE AGTCP+CRR MKKV+KI+TV
Sbjct  451  ECGQRIAEAAGTCPICRRNMKKVRKIFTV  479



>ref|XP_006583656.1| PREDICTED: uncharacterized protein LOC100777141 isoform X1 [Glycine 
max]
Length=439

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 96/148 (65%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH----RRAQLEDTGSER--VPMLSDKQDDNLSLGSSY  612
            TY  GIGG    VF A   LN        RA +   G+ER   P+L  K DD  S GSSY
Sbjct  293  TYIFGIGGLTLLVFGAFNFLNKLQCAHEDRAGVRSEGTERQRAPLLPHKDDDLSSWGSSY  352

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             SL QD++D         +DGK + D E S+  RHLCAICFDAPRDC FLPCGHC++CF 
Sbjct  353  ESLPQDEKDLGF-LPGGPIDGKTLVDGETSNNTRHLCAICFDAPRDCFFLPCGHCVACFA  411

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCPVCRR MKKV+KI+TV
Sbjct  412  CGTRIAEAAGTCPVCRRNMKKVRKIFTV  439



>ref|XP_007207438.1| hypothetical protein PRUPE_ppa005117mg [Prunus persica]
 gb|EMJ08637.1| hypothetical protein PRUPE_ppa005117mg [Prunus persica]
Length=476

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 95/146 (65%), Gaps = 6/146 (4%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            YFLG G     + +A R  N            Q  +  SER P+LS K DD LS GSSY 
Sbjct  331  YFLGSGVMTVLLLMALRFCNVFQNSGEDRIEFQAGEAESERTPLLSPKDDDVLSWGSSYE  390

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
            S+S ++ED EE    S+L GK + + + ++ + LC ICFD PRDC FLPCGHC +CF CG
Sbjct  391  SVSNNEEDLEESLEVSSLVGKSINEGDSNNTQRLCVICFDGPRDCFFLPCGHCAACFTCG  450

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+IAE AGTCP+CRRRMKKV+KI+TV
Sbjct  451  TRIAEEAGTCPICRRRMKKVRKIFTV  476



>ref|XP_010253903.1| PREDICTED: uncharacterized protein LOC104595042 isoform X4 [Nelumbo 
nucifera]
Length=375

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 95/148 (64%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRI------LNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +  GG    + LA ++              Q  +  SER P+L+DK DD  S GSSY
Sbjct  228  TYLVASGGMTLVMLLASKVCIQFQSTTGDETGYQTVEVRSERTPLLTDKDDDLSSWGSSY  287

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ED EE     +L+ KP+ D E  S+ R LC ICFDAPRDC FLPCGHC +CF 
Sbjct  288  ESVSHDEEDFEECIRVGSLEAKPLNDGENNSNPRRLCVICFDAPRDCFFLPCGHCAACFT  347

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AG CP+CRR+MKKVKKI+TV
Sbjct  348  CGTRIAEEAGICPICRRKMKKVKKIFTV  375



>ref|XP_010253902.1| PREDICTED: uncharacterized protein LOC104595042 isoform X3 [Nelumbo 
nucifera]
Length=390

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 95/148 (64%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRI------LNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +  GG    + LA ++              Q  +  SER P+L+DK DD  S GSSY
Sbjct  243  TYLVASGGMTLVMLLASKVCIQFQSTTGDETGYQTVEVRSERTPLLTDKDDDLSSWGSSY  302

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ED EE     +L+ KP+ D E  S+ R LC ICFDAPRDC FLPCGHC +CF 
Sbjct  303  ESVSHDEEDFEECIRVGSLEAKPLNDGENNSNPRRLCVICFDAPRDCFFLPCGHCAACFT  362

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AG CP+CRR+MKKVKKI+TV
Sbjct  363  CGTRIAEEAGICPICRRKMKKVKKIFTV  390



>ref|XP_007140331.1| hypothetical protein PHAVU_008G103400g [Phaseolus vulgaris]
 gb|ESW12325.1| hypothetical protein PHAVU_008G103400g [Phaseolus vulgaris]
Length=461

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 96/148 (65%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHR----RAQLEDTGSE--RVPMLSDKQDDNLSLGSSY  612
            TY  GIGG    VF    +LNN       RA +   G+E  R P+LS K DD  S GSSY
Sbjct  315  TYIFGIGGLTLLVFWTFNLLNNLQSAHVDRAVVITGGTEPQRAPLLSHKDDDLSSWGSSY  374

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             SL QD+ED +       +DGK   D E S+  R LCAICFDAPRDC FLPCGHC++CF 
Sbjct  375  DSLPQDEEDLDF-LPGGPIDGKLSGDGETSNNTRRLCAICFDAPRDCFFLPCGHCVACFA  433

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE +GTCPVCRR MKKV+KI+ V
Sbjct  434  CGTRIAEASGTCPVCRRNMKKVRKIFNV  461



>ref|XP_006429392.1| hypothetical protein CICLE_v100136621mg, partial [Citrus clementina]
 gb|ESR42632.1| hypothetical protein CICLE_v100136621mg, partial [Citrus clementina]
Length=221

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 100/148 (68%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNX--HRRA----QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            +Y +GI G    +  A   LN     R      Q  D  S R P+LS K DD  S GSSY
Sbjct  74   SYVVGICGMTMIMLAAFNFLNKFLCEREGGIGFQHGDVESARAPLLSHKDDDLSSWGSSY  133

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ + EE  ++S+L+GK ++D E S+  R LCAICFDAPRDC FLPCGHC++CF+
Sbjct  134  DSISTDEGNLEEFLTASSLEGKLLRDGEDSNNTRRLCAICFDAPRDCFFLPCGHCVACFK  193

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE A TCPVCRR+MKKV+KI+TV
Sbjct  194  CGTRIAEVASTCPVCRRKMKKVRKIFTV  221



>ref|XP_008390694.1| PREDICTED: uncharacterized protein LOC103452949 [Malus domestica]
Length=489

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 6/144 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHR---RAQLEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
            TY +GIGG    +FLA   LN  +    R + ++  SER P+LS K DD  S GSSY S 
Sbjct  349  TYIVGIGGMTVLMFLAFNFLNKCNEDGIRVRHDEFRSERAPLLSYKDDDQSSWGSSYDSA  408

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            S D+ D E+  +    +GK  +D E ++ R LCAICFDAPRDC FLPCGHC++CFEC T+
Sbjct  409  SNDEGDLEDLLAG---EGKMSRDGESNNTRRLCAICFDAPRDCFFLPCGHCVACFECATR  465

Query  422  IAETAGTCPVCRRRMKKVKKIYTV  351
            IAE A TCP+CRR +KKV+KI+TV
Sbjct  466  IAEAAATCPICRRNIKKVRKIFTV  489



>ref|XP_010095238.1| Putative E3 ubiquitin-protein ligase XBAT35 [Morus notabilis]
 gb|EXB59006.1| Putative E3 ubiquitin-protein ligase XBAT35 [Morus notabilis]
Length=262

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 96/147 (65%), Gaps = 7/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH-----RRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            TY +GIGG    +  A   LN             E   SER P+LS+K DD  S GSSY 
Sbjct  117  TYIIGIGGLSLLMLFAFNFLNKFQCARNETGGHHEQRRSERAPLLSNK-DDLSSWGSSYD  175

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            S S D+ED E   +  +L+GK + + E S+  R LCAICFDAPRDC FLPCGHC++CF C
Sbjct  176  SASNDEEDLENFLAVGSLEGKSLGEGENSNNTRRLCAICFDAPRDCFFLPCGHCVACFAC  235

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE  GTCP+CRR+MKKV++I+TV
Sbjct  236  GTRIAEADGTCPICRRKMKKVRRIFTV  262



>ref|XP_008220824.1| PREDICTED: uncharacterized protein LOC103320859 [Prunus mume]
Length=481

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLE------DTGSERVPMLSDKQDDNLSLGSSYC  609
            YFLG G     + +A R  N     +++       +  SE+ P+LS K DD LS GSSY 
Sbjct  336  YFLGSGVMTVLLLMAFRFCNMFQNPSEVRTEFQAGEAESEQTPLLSPKDDDVLSWGSSYE  395

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
            S+S ++ED EE    S+L GK + + + ++ + LC ICFD PRDC FLPCGHC +CF CG
Sbjct  396  SVSNNEEDLEESLEVSSLVGKSINEGDNNNTQRLCVICFDGPRDCFFLPCGHCAACFTCG  455

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+IAE AGTCP+CRRRMKKV+KI+TV
Sbjct  456  TRIAEEAGTCPICRRRMKKVRKIFTV  481



>ref|XP_010253900.1| PREDICTED: uncharacterized protein LOC104595042 isoform X1 [Nelumbo 
nucifera]
Length=470

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 95/148 (64%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRI------LNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +  GG    + LA ++              Q  +  SER P+L+DK DD  S GSSY
Sbjct  323  TYLVASGGMTLVMLLASKVCIQFQSTTGDETGYQTVEVRSERTPLLTDKDDDLSSWGSSY  382

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ED EE     +L+ KP+ D E  S+ R LC ICFDAPRDC FLPCGHC +CF 
Sbjct  383  ESVSHDEEDFEECIRVGSLEAKPLNDGENNSNPRRLCVICFDAPRDCFFLPCGHCAACFT  442

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AG CP+CRR+MKKVKKI+TV
Sbjct  443  CGTRIAEEAGICPICRRKMKKVKKIFTV  470



>ref|XP_010253901.1| PREDICTED: uncharacterized protein LOC104595042 isoform X2 [Nelumbo 
nucifera]
Length=469

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 95/148 (64%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRI------LNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +  GG    + LA ++              Q  +  SER P+L+DK DD  S GSSY
Sbjct  322  TYLVASGGMTLVMLLASKVCIQFQSTTGDETGYQTVEVRSERTPLLTDKDDDLSSWGSSY  381

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ED EE     +L+ KP+ D E  S+ R LC ICFDAPRDC FLPCGHC +CF 
Sbjct  382  ESVSHDEEDFEECIRVGSLEAKPLNDGENNSNPRRLCVICFDAPRDCFFLPCGHCAACFT  441

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AG CP+CRR+MKKVKKI+TV
Sbjct  442  CGTRIAEEAGICPICRRKMKKVKKIFTV  469



>ref|XP_008370095.1| PREDICTED: uncharacterized protein LOC103433605 [Malus domestica]
Length=481

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 96/147 (65%), Gaps = 9/147 (6%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    + LA   LN          R Q ++  SER P+LS K DD  S GSSY
Sbjct  338  TYIVGIGGMTVLMLLAFNFLNKYRFTNEDGIRVQHDEFRSERAPLLSYKDDDQSSWGSSY  397

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S S D+ D E+  +    +GK  +D E ++ R LCAICFDAPRDC FLPCGHC++CFEC
Sbjct  398  DSASNDEGDLEDFLAG---EGKSSRDGESNNTRRLCAICFDAPRDCFFLPCGHCVACFEC  454

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
             T+IAE A TCPVCRR +KKV+KI+TV
Sbjct  455  ATRIAEAAATCPVCRRNIKKVRKIFTV  481



>ref|XP_010326076.1| PREDICTED: uncharacterized protein LOC101252808 isoform X2 [Solanum 
lycopersicum]
Length=454

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 98/148 (66%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNX---HRRAQLEDTG---SERVPMLSDKQDDNLSLGSSY  612
            TY LG+GG  F ++L  R LNN    H+    +  G   S++ P+LS K +D  S GSSY
Sbjct  307  TYLLGVGGMSFLIWLVFRYLNNMQSIHQEGSRDPVGLMESDQTPLLSRKDNDIGSWGSSY  366

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
              LSQ+DE  E+    +   G+ +KD E   ++  LCAICFD PRDC FLPCGH  SCFE
Sbjct  367  DGLSQNDEYNEDVLDLTAAQGRQLKDGECNDNICRLCAICFDTPRDCFFLPCGHHASCFE  426

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCP+CRR +KKVKKIYTV
Sbjct  427  CGTRIAEVAGTCPICRRPIKKVKKIYTV  454



>ref|XP_004246765.1| PREDICTED: uncharacterized protein LOC101252808 isoform X1 [Solanum 
lycopersicum]
Length=466

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 98/148 (66%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNX---HRRAQLEDTG---SERVPMLSDKQDDNLSLGSSY  612
            TY LG+GG  F ++L  R LNN    H+    +  G   S++ P+LS K +D  S GSSY
Sbjct  319  TYLLGVGGMSFLIWLVFRYLNNMQSIHQEGSRDPVGLMESDQTPLLSRKDNDIGSWGSSY  378

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
              LSQ+DE  E+    +   G+ +KD E   ++  LCAICFD PRDC FLPCGH  SCFE
Sbjct  379  DGLSQNDEYNEDVLDLTAAQGRQLKDGECNDNICRLCAICFDTPRDCFFLPCGHHASCFE  438

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE AGTCP+CRR +KKVKKIYTV
Sbjct  439  CGTRIAEVAGTCPICRRPIKKVKKIYTV  466



>gb|KDP24449.1| hypothetical protein JCGZ_25013 [Jatropha curcas]
Length=481

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 99/149 (66%), Gaps = 9/149 (6%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTG-------SERVPMLSDKQDDNLSLGSS  615
            TY +GI      +  A   LN   R  + E+TG        ER P+LS K DD  S GSS
Sbjct  334  TYIVGIAAMTALMLGAFNFLNK-FRCIREEETGVRYGELEPERTPLLSHKDDDLSSWGSS  392

Query  614  YCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCF  438
            Y S+S D+ED EE  +S +++G  ++D E S+  R LCAICFDAPRDC FLPCGHC++CF
Sbjct  393  YDSVSNDEEDLEEFLASGSMEGASLRDGENSNSTRRLCAICFDAPRDCFFLPCGHCVACF  452

Query  437  ECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
             CGT+I E AGTCP+CRR MKKV+KI+TV
Sbjct  453  ACGTRIVEAAGTCPICRRNMKKVRKIFTV  481



>ref|XP_011006557.1| PREDICTED: uncharacterized protein LOC105112530 [Populus euphratica]
Length=470

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 93/147 (63%), Gaps = 6/147 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY LGIGG    +  A   LN          R Q       R P+LS K DD  S GSSY
Sbjct  324  TYILGIGGMTVIMMAAFNFLNKFQCGHEDGTRLQFGVVEPGRAPLLSRKDDDLASWGSSY  383

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S S D+ED E+  ++S+L+GK       ++ R LCAICFDAPRDC FLPCGHC++CF C
Sbjct  384  DSASNDEEDLEDLLAASSLEGKSRDGENGNNTRRLCAICFDAPRDCFFLPCGHCVACFAC  443

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE  GTCP+CRR M+KV+KI+TV
Sbjct  444  GTRIAEADGTCPICRRNMRKVRKIFTV  470



>ref|XP_006481039.1| PREDICTED: uncharacterized protein LOC102608051 [Citrus sinensis]
Length=476

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = -2

Query  758  IGGTCFFVFLAQRILNNX--HRRA----QLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQ  597
            +GG    +  A   LN     R      Q  D  S R P+LS K DD  S GSSY S+S 
Sbjct  334  VGGMTMIMLAAFNFLNKFLCEREGGIGFQHGDVESARAPLLSHKDDDLSSWGSSYDSIST  393

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI  420
            D+ + EE  ++S+L+GK ++D E S+  R LCAICFDAPRDC FLPCGHC++CF+CGT+I
Sbjct  394  DEGNLEEFLTASSLEGKSLRDGEDSNNTRRLCAICFDAPRDCFFLPCGHCVACFKCGTRI  453

Query  419  AETAGTCPVCRRRMKKVKKIYTV  351
            AE AGTCPVCRR+MKKV+KI+TV
Sbjct  454  AEVAGTCPVCRRKMKKVRKIFTV  476



>ref|XP_007026702.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY07204.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma 
cacao]
Length=491

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 97/147 (66%), Gaps = 7/147 (5%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            Y +GIGG    + +A   LN               +  S R P+LS+K DD  S GSSY 
Sbjct  345  YIVGIGGMTAIMLVAFNFLNKFQFTRGGETNLHYGENASARAPLLSNKDDDISSWGSSYD  404

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            S+S D+ D E+  ++ +++G  +++ E S+  R LCAICFDAPRDC FLPCGHC++CF C
Sbjct  405  SVSSDEADLEDFLAAGSVEGTSIREGENSNNTRRLCAICFDAPRDCFFLPCGHCVACFAC  464

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            G++IAE AGTCP+CRR MKKV+KI+TV
Sbjct  465  GSRIAEAAGTCPICRRNMKKVRKIFTV  491



>ref|XP_007026701.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07203.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=488

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 97/147 (66%), Gaps = 7/147 (5%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            Y +GIGG    + +A   LN               +  S R P+LS+K DD  S GSSY 
Sbjct  342  YIVGIGGMTAIMLVAFNFLNKFQFTRGGETNLHYGENASARAPLLSNKDDDISSWGSSYD  401

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            S+S D+ D E+  ++ +++G  +++ E S+  R LCAICFDAPRDC FLPCGHC++CF C
Sbjct  402  SVSSDEADLEDFLAAGSVEGTSIREGENSNNTRRLCAICFDAPRDCFFLPCGHCVACFAC  461

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            G++IAE AGTCP+CRR MKKV+KI+TV
Sbjct  462  GSRIAEAAGTCPICRRNMKKVRKIFTV  488



>ref|XP_004514227.1| PREDICTED: uncharacterized protein LOC101489056 [Cicer arietinum]
Length=464

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 94/145 (65%), Gaps = 8/145 (6%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRR------AQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY  GIGG    +F A   LN           ++ E TG ER P+LS K DD  S GSSY
Sbjct  307  TYIFGIGGLTVLMFWACNFLNKVRSSHEDRVGSRAEGTGPERAPLLSRKDDDLSSWGSSY  366

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             SLSQDD+D +     ST DGK + D E S+  + LCAICFDAPRDC FLPCGHC++CF 
Sbjct  367  DSLSQDDQDLDFLAGGST-DGKFLGDGETSNNTQRLCAICFDAPRDCFFLPCGHCVACFA  425

Query  434  CGTKIAETAGTCPVCRRRMKKVKKI  360
            CGT+IAE AGTCPVCRR MKK + I
Sbjct  426  CGTRIAEAAGTCPVCRRNMKKGQSI  450



>ref|XP_010923286.1| PREDICTED: uncharacterized protein LOC105046404 [Elaeis guineensis]
Length=452

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 97/147 (66%), Gaps = 10/147 (7%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TYF G G     + LA +I  N    +      Q  +  +ER P+L +K DDNLSLGSSY
Sbjct  310  TYFAGSGVMTVVILLAFKIFTNLQFSSGDGANRQNANGSTERSPLLPNKDDDNLSLGSSY  369

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S+S DDED EE   ++ +    + + E ++ RHLCA+C DA RDC FLPCGHC +CF C
Sbjct  370  DSVSHDDEDMEEWLGTTPM----LPEGEANNTRHLCALCCDAQRDCFFLPCGHCAACFTC  425

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+I + AGTCPVCRR+MKKV+KI+TV
Sbjct  426  GTRILDEAGTCPVCRRKMKKVRKIFTV  452



>ref|XP_010262861.1| PREDICTED: uncharacterized protein LOC104601271 [Nelumbo nucifera]
Length=469

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 93/147 (63%), Gaps = 12/147 (8%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TYF+G GG    + +A ++ N+           Q     SER P+L++K DD LS GSSY
Sbjct  329  TYFVGSGGMTLIILVALKVCNHFQSTTGDGTGLQTVQVDSERAPLLTNKDDDLLSWGSSY  388

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S+S D++D EE        G        ++ R LCAICFDAPRDC FLPCGHC +CF C
Sbjct  389  DSVSHDEDDLEEWI------GVGSSGENNNNPRRLCAICFDAPRDCFFLPCGHCAACFTC  442

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE  GTCP+CRRRMKKV+KI+TV
Sbjct  443  GTRIAEEVGTCPICRRRMKKVRKIFTV  469



>ref|XP_009347262.1| PREDICTED: uncharacterized protein LOC103938936 [Pyrus x bretschneideri]
Length=460

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHR------RAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            YFL  G     +  A +  N            Q E+  S + P+LS K DD LS GSSY 
Sbjct  315  YFLVAGVVTLLLVTAFKYYNKFQNSNEDTTEFQAEEGQSVQTPLLSPKDDDTLSWGSSYE  374

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
             +S ++ED +E  + S+L+G+   + + ++ RHLC ICFD PRDC FLPCGHC +CF CG
Sbjct  375  FISNNEEDLDECLAVSSLEGRLTNEGDSNNTRHLCVICFDGPRDCFFLPCGHCAACFSCG  434

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+IAE AGTCP+CRRRMKKV++I+TV
Sbjct  435  TRIAEEAGTCPICRRRMKKVRRIFTV  460



>ref|XP_008791206.1| PREDICTED: uncharacterized protein LOC103708175 isoform X1 [Phoenix 
dactylifera]
Length=438

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 95/147 (65%), Gaps = 10/147 (7%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TYF+G G     + LA  I  N    +      Q  D G+ R P+L +K DDNLSLGSSY
Sbjct  296  TYFVGSGVMTAVILLAFNIFTNLQFSSGDGASHQNADGGTARSPLLPNKDDDNLSLGSSY  355

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S+S DDED EE   ++ L    + + E ++ RHLC IC DA RDC FLPCGHC +CF C
Sbjct  356  DSVSHDDEDLEEWLGTTPL----LPEGEANNTRHLCTICCDAQRDCFFLPCGHCTTCFTC  411

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+I + AGTCPVCRR+ KKV+KI+TV
Sbjct  412  GTRILDEAGTCPVCRRKTKKVRKIFTV  438



>ref|XP_009377761.1| PREDICTED: uncharacterized protein LOC103966331 [Pyrus x bretschneideri]
Length=481

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 94/147 (64%), Gaps = 9/147 (6%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    + LA   LN          R Q ++  SER P+L+ K DD  S GSSY
Sbjct  338  TYIVGIGGMTVLMLLAFNFLNKYRCTNEDGIRVQHDEFRSERAPLLAYKDDDQSSWGSSY  397

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S S D+ D E+       +GK  +D E ++ R LCAICFDAPRDC FLPCGHC++C EC
Sbjct  398  DSASNDEGDLEDFLGG---EGKSSRDGESNNTRRLCAICFDAPRDCFFLPCGHCVACSEC  454

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
             T+IAE A TCPVCRR +KKV+KI+TV
Sbjct  455  ATRIAEAAATCPVCRRNIKKVRKIFTV  481



>ref|XP_008791207.1| PREDICTED: uncharacterized protein LOC103708175 isoform X2 [Phoenix 
dactylifera]
Length=437

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 95/147 (65%), Gaps = 10/147 (7%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TYF+G G     + LA  I  N    +      Q  D G+ R P+L +K DDNLSLGSSY
Sbjct  295  TYFVGSGVMTAVILLAFNIFTNLQFSSGDGASHQNADGGTARSPLLPNKDDDNLSLGSSY  354

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S+S DDED EE   ++ L    + + E ++ RHLC IC DA RDC FLPCGHC +CF C
Sbjct  355  DSVSHDDEDLEEWLGTTPL----LPEGEANNTRHLCTICCDAQRDCFFLPCGHCTTCFTC  410

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+I + AGTCPVCRR+ KKV+KI+TV
Sbjct  411  GTRILDEAGTCPVCRRKTKKVRKIFTV  437



>ref|XP_011019119.1| PREDICTED: uncharacterized protein LOC105121941 isoform X2 [Populus 
euphratica]
Length=403

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 97/148 (66%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    +  A   LN          R    +  ++R P+LS K DD  S GSSY
Sbjct  257  TYIVGIGGMTVLILAALNFLNKFQCIREDGTRLLFGEVEAQRAPLLSCKDDDLSSWGSSY  316

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRH-LCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ED E+  ++ +++GK  +D E  +  H LCAICFDAPR+C FLPCGHC++CF 
Sbjct  317  DSVSNDEEDLEDFLAAGSIEGKS-RDGENGNNTHRLCAICFDAPRECFFLPCGHCVACFA  375

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTCP+CRR +KKV+KI+TV
Sbjct  376  CGTRIAEADGTCPICRRNLKKVRKIFTV  403



>ref|XP_002322980.2| hypothetical protein POPTR_0016s12360g [Populus trichocarpa]
 gb|EEF04741.2| hypothetical protein POPTR_0016s12360g [Populus trichocarpa]
Length=454

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 92/147 (63%), Gaps = 6/147 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY LGI G    +  A   LN          R Q  +    R P+LS K DD  S GSSY
Sbjct  308  TYILGIVGMTVIMMAAFNFLNKFQCVHEDGNRLQFGEVEPGRAPLLSRKDDDLASWGSSY  367

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S S D+E  E+  ++S+L+GK       ++ R LCAICFDAPRDC FLPCGHC++CF C
Sbjct  368  DSASNDEEGLEDFLAASSLEGKSRDGENGNNTRRLCAICFDAPRDCFFLPCGHCVACFAC  427

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE  GTCP+CRR M+KV+KI+TV
Sbjct  428  GTRIAEADGTCPICRRSMRKVRKIFTV  454



>ref|XP_011019118.1| PREDICTED: uncharacterized protein LOC105121941 isoform X1 [Populus 
euphratica]
Length=466

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 97/148 (66%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    +  A   LN          R    +  ++R P+LS K DD  S GSSY
Sbjct  320  TYIVGIGGMTVLILAALNFLNKFQCIREDGTRLLFGEVEAQRAPLLSCKDDDLSSWGSSY  379

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRH-LCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ED E+  ++ +++GK  +D E  +  H LCAICFDAPR+C FLPCGHC++CF 
Sbjct  380  DSVSNDEEDLEDFLAAGSIEGKS-RDGENGNNTHRLCAICFDAPRECFFLPCGHCVACFA  438

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTCP+CRR +KKV+KI+TV
Sbjct  439  CGTRIAEADGTCPICRRNLKKVRKIFTV  466



>ref|XP_002528092.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF34271.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=460

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 92/148 (62%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GI      + +    LN            Q  +   ER P+LS K DD  S GSSY
Sbjct  313  TYVVGIAVMTVLMLVVFNFLNKFRCMREEGTGVQYGEVEPERAPLLSSKDDDLSSWGSSY  372

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ED E   +S +L+GK   D E  ++ + LCAICFDAPRDC FLPCGHC++CFE
Sbjct  373  DSVSNDEEDLEHLLASGSLEGKLSGDGENVNNTQRLCAICFDAPRDCFFLPCGHCIACFE  432

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+I E  GTCPVC + MKKV+KI+TV
Sbjct  433  CGTRIVEAGGTCPVCHKNMKKVRKIFTV  460



>ref|XP_004302551.1| PREDICTED: uncharacterized protein LOC101309361 [Fragaria vesca 
subsp. vesca]
Length=470

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 92/147 (63%), Gaps = 12/147 (8%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIG     + LA   LN          R Q  +   ER P+LS K DD  S GSSY
Sbjct  330  TYIIGIGAMTVLMLLAFNFLNKFRCNNEDGIRVQHPEFRPERAPLLSYKDDDQSSWGSSY  389

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S S D+ D E+  ++ +LDG      E ++ R LCAICFDAPRDC FLPCGHC +CF+C
Sbjct  390  DSASNDEGDLEDLMTAGSLDG------ESNNTRRLCAICFDAPRDCFFLPCGHCAACFDC  443

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
             T+IAE A TCP+CRR +KKV+KI+TV
Sbjct  444  ATRIAEAAATCPICRRNIKKVRKIFTV  470



>gb|KJB17073.1| hypothetical protein B456_002G263500 [Gossypium raimondii]
Length=476

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 96/148 (65%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHR------RAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    + +A   LN          R +  +  S R P+LS K DD  S GSSY
Sbjct  330  TYIVGIGGMTGIMLVAFNFLNKFQYTREDEARLRNGELASARAPLLSRKADDLSSRGSSY  389

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQS-DMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ D E+  + S L+G  + D E S + R LCAICFDAPRDC FLPCGHC++CF 
Sbjct  390  DSVSSDEADLEDFLAVS-LEGTSIGDGENSSNTRRLCAICFDAPRDCFFLPCGHCVACFA  448

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTCP+CRR MKKV+KI+TV
Sbjct  449  CGTRIAEADGTCPICRRSMKKVRKIFTV  476



>gb|KJB17074.1| hypothetical protein B456_002G263500 [Gossypium raimondii]
Length=475

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 96/148 (65%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHR------RAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    + +A   LN          R +  +  S R P+LS K DD  S GSSY
Sbjct  329  TYIVGIGGMTGIMLVAFNFLNKFQYTREDEARLRNGELASARAPLLSRKADDLSSRGSSY  388

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQS-DMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ D E+  + S L+G  + D E S + R LCAICFDAPRDC FLPCGHC++CF 
Sbjct  389  DSVSSDEADLEDFLAVS-LEGTSIGDGENSSNTRRLCAICFDAPRDCFFLPCGHCVACFA  447

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTCP+CRR MKKV+KI+TV
Sbjct  448  CGTRIAEADGTCPICRRSMKKVRKIFTV  475



>gb|KJB17075.1| hypothetical protein B456_002G263500 [Gossypium raimondii]
Length=479

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 96/148 (65%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHR------RAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    + +A   LN          R +  +  S R P+LS K DD  S GSSY
Sbjct  333  TYIVGIGGMTGIMLVAFNFLNKFQYTREDEARLRNGELASARAPLLSRKADDLSSRGSSY  392

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQS-DMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ D E+  + S L+G  + D E S + R LCAICFDAPRDC FLPCGHC++CF 
Sbjct  393  DSVSSDEADLEDFLAVS-LEGTSIGDGENSSNTRRLCAICFDAPRDCFFLPCGHCVACFA  451

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTCP+CRR MKKV+KI+TV
Sbjct  452  CGTRIAEADGTCPICRRSMKKVRKIFTV  479



>ref|XP_002308218.2| hypothetical protein POPTR_0006s10120g [Populus trichocarpa]
 gb|EEE91741.2| hypothetical protein POPTR_0006s10120g [Populus trichocarpa]
Length=471

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 94/147 (64%), Gaps = 6/147 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    +  A   LN          R    +  +ER P+LS K DD  S GSSY
Sbjct  325  TYIVGIGGMTVLILAAFNFLNMFQCIREDGTRILFGEVEAERAPLLSCKDDDLSSWGSSY  384

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S+S D+ED E+  ++ +L+GK       ++ R LCAICFDAPR+C FLPCGH ++CF C
Sbjct  385  DSVSNDEEDLEDFLAAGSLEGKSRDGENGNNTRRLCAICFDAPRECFFLPCGHRVACFAC  444

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE  GTCP+CRR +KKV+KI+TV
Sbjct  445  GTRIAEADGTCPICRRNLKKVRKIFTV  471



>ref|XP_010676738.1| PREDICTED: uncharacterized protein LOC104892488 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 90/147 (61%), Gaps = 20/147 (14%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TYFLGIGG    +      LN   R        Q  D G ER P+LS K D+  SLGSSY
Sbjct  316  TYFLGIGGLTSIMLWTFNYLNRVRRNMEDTAENQSGDLGPERAPLLSQKDDEVSSLGSSY  375

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
             S SQ+DE+ +E             D E+   R LC ICFDAP+DC F+PCGHC SCF C
Sbjct  376  DSGSQNDEETQE-------------DLEEG-CRRLCVICFDAPKDCFFIPCGHCASCFTC  421

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            G +IAE AGTCP+CRR+MKKV++IYTV
Sbjct  422  GIRIAEAAGTCPICRRKMKKVRRIYTV  448



>ref|XP_007016101.1| Ubiquitin-protein ligase, putative isoform 2 [Theobroma cacao]
 gb|EOY33720.1| Ubiquitin-protein ligase, putative isoform 2 [Theobroma cacao]
Length=354

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 94/145 (65%), Gaps = 5/145 (3%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRI--LNNXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCS  606
            TYF+G G     + LA RI  +        L   G  SER P+L  K DD  S GSSY S
Sbjct  211  TYFVGSGVMTILILLAFRISKIFQSIDGIGLHAGGMESERAPLLPAKDDDISSWGSSYDS  270

Query  605  LSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
            +S D+E  EE  + +  +GKP  + E ++ R LC +CFDAPRDC FLPCGHC +CF CGT
Sbjct  271  VSHDEEVLEEWLAKTFPEGKPSNEGESNNTR-LCVVCFDAPRDCFFLPCGHCATCFTCGT  329

Query  425  KIAETAGTCPVCRRRMKKVKKIYTV  351
            +IAE AG+CP+CRR+MKKV+ I+TV
Sbjct  330  RIAEDAGSCPICRRKMKKVRMIFTV  354



>ref|XP_007026703.1| RING/U-box superfamily protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY07205.1| RING/U-box superfamily protein, putative isoform 4 [Theobroma 
cacao]
Length=484

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = -2

Query  683  DTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHL  507
            +  S R P+LS+K DD  S GSSY S+S D+ D E+  ++ +++G  +++ E S+  R L
Sbjct  373  ENASARAPLLSNKDDDISSWGSSYDSVSSDEADLEDFLAAGSVEGTSIREGENSNNTRRL  432

Query  506  CAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CAICFDAPRDC FLPCGHC++CF CG++IAE AGTCP+CRR MKKV+KI+TV
Sbjct  433  CAICFDAPRDCFFLPCGHCVACFACGSRIAEAAGTCPICRRNMKKVRKIFTV  484



>gb|KHG23614.1| Putative E3 ubiquitin-protein ligase XBAT35 [Gossypium arboreum]
Length=458

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 95/148 (64%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLE------DTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    + +A   LN      + E      +  S R P+LS K DD  S GSSY
Sbjct  312  TYIVGIGGMTGIMLVAFNFLNKFQYTPEDEVRLHNGELASARAPLLSRKADDLSSRGSSY  371

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ D E+  + S L+G    D E S+  R LCAICFDAPRDC FLPCGHC++CF 
Sbjct  372  DSVSSDEADLEDFLAGS-LEGTSKGDGENSNNTRRLCAICFDAPRDCFFLPCGHCVACFA  430

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTCP+CRR MKKV+KI+TV
Sbjct  431  CGTRIAEADGTCPICRRSMKKVRKIFTV  458



>ref|XP_007026700.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07202.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=556

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 10/157 (6%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            Y +GIGG    + +A   LN               +  S R P+LS+K DD  S GSSY 
Sbjct  342  YIVGIGGMTAIMLVAFNFLNKFQFTRGGETNLHYGENASARAPLLSNKDDDISSWGSSYD  401

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            S+S D+ D E+  ++ +++G  +++ E S+  R LCAICFDAPRDC FLPCGHC++CF C
Sbjct  402  SVSSDEADLEDFLAAGSVEGTSIREGENSNNTRRLCAICFDAPRDCFFLPCGHCVACFAC  461

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV*TSLMDLPPL  321
            G++IAE AGTCP+CRR MKK +++    T ++ LP L
Sbjct  462  GSRIAEAAGTCPICRRNMKKAQQLQ---TEILYLPVL  495



>gb|KHG23613.1| Putative E3 ubiquitin-protein ligase XBAT35 [Gossypium arboreum]
Length=481

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 95/148 (64%), Gaps = 8/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLE------DTGSERVPMLSDKQDDNLSLGSSY  612
            TY +GIGG    + +A   LN      + E      +  S R P+LS K DD  S GSSY
Sbjct  335  TYIVGIGGMTGIMLVAFNFLNKFQYTPEDEVRLHNGELASARAPLLSRKADDLSSRGSSY  394

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+ D E+  + S L+G    D E S+  R LCAICFDAPRDC FLPCGHC++CF 
Sbjct  395  DSVSSDEADLEDFLAGS-LEGTSKGDGENSNNTRRLCAICFDAPRDCFFLPCGHCVACFA  453

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTCP+CRR MKKV+KI+TV
Sbjct  454  CGTRIAEADGTCPICRRSMKKVRKIFTV  481



>ref|XP_010033005.1| PREDICTED: uncharacterized protein LOC104422386 isoform X1 [Eucalyptus 
grandis]
Length=492

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 97/151 (64%), Gaps = 13/151 (9%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRI---------LNNXHRRAQLEDTGSERVPMLSDKQDDNLSLG  621
            TYF G       + LA R           +  H   Q+E   +ER P+LS K+DD  S G
Sbjct  345  TYFAGSAVMTILLLLALRFCKLFQSSSEESTGHEPGQME---TERAPLLSPKEDDLSSWG  401

Query  620  SSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLS  444
            SSY S+S D+ED EE  + S+L+GKP  + E  S+ R+LC ICFDAPRDC F+PCGH  +
Sbjct  402  SSYDSVSHDEEDLEEQLAVSSLEGKPFGEGENPSNTRNLCIICFDAPRDCFFIPCGHFAT  461

Query  443  CFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            C+ CG++I E  G+CP+CRR+MKKV+KI+TV
Sbjct  462  CYACGSRIVEEDGSCPLCRRKMKKVRKIFTV  492



>ref|XP_010033006.1| PREDICTED: uncharacterized protein LOC104422386 isoform X2 [Eucalyptus 
grandis]
 gb|KCW52520.1| hypothetical protein EUGRSUZ_J01909 [Eucalyptus grandis]
Length=491

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 97/151 (64%), Gaps = 13/151 (9%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRI---------LNNXHRRAQLEDTGSERVPMLSDKQDDNLSLG  621
            TYF G       + LA R           +  H   Q+E   +ER P+LS K+DD  S G
Sbjct  344  TYFAGSAVMTILLLLALRFCKLFQSSSEESTGHEPGQME---TERAPLLSPKEDDLSSWG  400

Query  620  SSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLS  444
            SSY S+S D+ED EE  + S+L+GKP  + E  S+ R+LC ICFDAPRDC F+PCGH  +
Sbjct  401  SSYDSVSHDEEDLEEQLAVSSLEGKPFGEGENPSNTRNLCIICFDAPRDCFFIPCGHFAT  460

Query  443  CFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            C+ CG++I E  G+CP+CRR+MKKV+KI+TV
Sbjct  461  CYACGSRIVEEDGSCPLCRRKMKKVRKIFTV  491



>ref|XP_002279069.2| PREDICTED: uncharacterized protein LOC100258653 [Vitis vinifera]
 emb|CBI15953.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 95/150 (63%), Gaps = 9/150 (6%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH--------RRAQLEDTGSERVPMLSDKQDDNLSLGS  618
            TYF+G G     + LA R  N            +    +T  ER P+L  K DD  S GS
Sbjct  336  TYFVGSGAMTVLILLAFRACNTFQTIIGDGTGYQVGTGETEPERAPLLLPKDDDASSWGS  395

Query  617  SYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQS-DMRHLCAICFDAPRDCXFLPCGHCLSC  441
            SY S+S D+ED EE  + S+L+G   K+ E + + R LC IC DAPRDC FLPCGHC +C
Sbjct  396  SYDSISHDEEDLEEWLAVSSLEGNISKEGENNGNPRRLCVICCDAPRDCFFLPCGHCAAC  455

Query  440  FECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            F CGT+I+E AG+CP+CR++MKKV+KI+TV
Sbjct  456  FTCGTRISEEAGSCPICRKKMKKVRKIFTV  485



>gb|KDP46493.1| hypothetical protein JCGZ_08465 [Jatropha curcas]
Length=472

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 96/145 (66%), Gaps = 6/145 (4%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILN----NXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCS  606
            TY +G G     + L  +  N    +     Q  +  SER+P+L+ K DD  S GSSY S
Sbjct  330  TYIVGSGIMTLLMMLTLKFCNAFQASDQDSNQPGEMRSERIPLLTPKDDDISSRGSSYDS  389

Query  605  LSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
            +SQD  D +E  ++++L+GKP+ + E  +++ LC ICFDAPRDC FLPCGHC +CF C +
Sbjct  390  ISQDGRDVDELLAANSLEGKPLPEGE--NLQSLCVICFDAPRDCFFLPCGHCAACFACAS  447

Query  425  KIAETAGTCPVCRRRMKKVKKIYTV  351
            +IAE  GTCP+CRR MKKV+KI+TV
Sbjct  448  RIAEEPGTCPICRRSMKKVRKIFTV  472



>ref|XP_007016100.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY33719.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=512

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 94/145 (65%), Gaps = 5/145 (3%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRI--LNNXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCS  606
            TYF+G G     + LA RI  +        L   G  SER P+L  K DD  S GSSY S
Sbjct  369  TYFVGSGVMTILILLAFRISKIFQSIDGIGLHAGGMESERAPLLPAKDDDISSWGSSYDS  428

Query  605  LSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
            +S D+E  EE  + +  +GKP  + E ++ R LC +CFDAPRDC FLPCGHC +CF CGT
Sbjct  429  VSHDEEVLEEWLAKTFPEGKPSNEGESNNTR-LCVVCFDAPRDCFFLPCGHCATCFTCGT  487

Query  425  KIAETAGTCPVCRRRMKKVKKIYTV  351
            +IAE AG+CP+CRR+MKKV+ I+TV
Sbjct  488  RIAEDAGSCPICRRKMKKVRMIFTV  512



>ref|XP_011095012.1| PREDICTED: uncharacterized protein LOC105174567 isoform X2 [Sesamum 
indicum]
Length=460

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 90/146 (62%), Gaps = 10/146 (7%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHR------RAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            Y  G GG  F + L    LN+  R      R QL D  SER P+LS K DDNLS   S  
Sbjct  319  YLFGTGGLAFLLLLINYFLNHFRRTEQDTRRDQLGDVESERNPLLSHK-DDNLSSSGSSY  377

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
            +   DD D  +    +   GKPVKD E  D R LCAICFDAP+DC FLPCGHC++CF C 
Sbjct  378  ASVSDD-DEHDAQGGAVQSGKPVKDDE--DSRRLCAICFDAPKDCFFLPCGHCVACFACA  434

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+I E +G CP+CRRR K+V+KIYTV
Sbjct  435  TRIVEASGACPICRRRTKRVRKIYTV  460



>ref|XP_011095011.1| PREDICTED: uncharacterized protein LOC105174567 isoform X1 [Sesamum 
indicum]
Length=461

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 90/146 (62%), Gaps = 10/146 (7%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHR------RAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            Y  G GG  F + L    LN+  R      R QL D  SER P+LS K DDNLS   S  
Sbjct  320  YLFGTGGLAFLLLLINYFLNHFRRTEQDTRRDQLGDVESERNPLLSHK-DDNLSSSGSSY  378

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
            +   DD D  +    +   GKPVKD E  D R LCAICFDAP+DC FLPCGHC++CF C 
Sbjct  379  ASVSDD-DEHDAQGGAVQSGKPVKDDE--DSRRLCAICFDAPKDCFFLPCGHCVACFACA  435

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+I E +G CP+CRRR K+V+KIYTV
Sbjct  436  TRIVEASGACPICRRRTKRVRKIYTV  461



>ref|XP_008349667.1| PREDICTED: uncharacterized protein LOC103412941, partial [Malus 
domestica]
Length=347

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            YFL  G     +  A +I       +      Q E+  SE+ P+L  K DD LS GSSY 
Sbjct  202  YFLVAGVMTLLLLTAFKIYYKFQNSSEDTTEFQAEEEESEQTPLLPPKDDDVLSWGSSYE  261

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
            S+S  +ED +E  ++S+L+G    +++ ++ R LC ICFD PRDC FLPCGHC  CF CG
Sbjct  262  SVSNTEEDLDECLAASSLEGGLTSEADSNNTRRLCVICFDGPRDCFFLPCGHCAVCFTCG  321

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+IAE AGTCP+CRRRMKKV+KI+TV
Sbjct  322  TRIAEEAGTCPICRRRMKKVRKIFTV  347



>ref|XP_009397537.1| PREDICTED: uncharacterized protein LOC103982352 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=447

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 97/151 (64%), Gaps = 17/151 (11%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRIL---------NNXHRRAQLEDTGSERVPMLSDKQDDNLSLG  621
            TYF G G     +F+A +I          N  H+ A++    +ER P+L++K DD+ SLG
Sbjct  304  TYFAGSGLMTLMIFMAFQIFSSLRCDTQENTTHQTAEVT---TERRPLLANKDDDSQSLG  360

Query  620  SSYCSLSQDDEDAEE-PTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLS  444
            SSY S+S D+ED EE P +   L    +KD E ++ + LCAIC DAPRDC FLPCGHC  
Sbjct  361  SSYESVSHDEEDIEEQPATGPEL----LKDGEINNSQELCAICCDAPRDCFFLPCGHCAM  416

Query  443  CFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CF CGT+I   AG CP+CRR+MKKV+KI+ V
Sbjct  417  CFTCGTRILGEAGICPICRRKMKKVRKIFAV  447



>ref|XP_009397538.1| PREDICTED: uncharacterized protein LOC103982352 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=444

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 97/151 (64%), Gaps = 17/151 (11%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRIL---------NNXHRRAQLEDTGSERVPMLSDKQDDNLSLG  621
            TYF G G     +F+A +I          N  H+ A++    +ER P+L++K DD+ SLG
Sbjct  301  TYFAGSGLMTLMIFMAFQIFSSLRCDTQENTTHQTAEVT---TERRPLLANKDDDSQSLG  357

Query  620  SSYCSLSQDDEDAEE-PTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLS  444
            SSY S+S D+ED EE P +   L    +KD E ++ + LCAIC DAPRDC FLPCGHC  
Sbjct  358  SSYESVSHDEEDIEEQPATGPEL----LKDGEINNSQELCAICCDAPRDCFFLPCGHCAM  413

Query  443  CFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CF CGT+I   AG CP+CRR+MKKV+KI+ V
Sbjct  414  CFTCGTRILGEAGICPICRRKMKKVRKIFAV  444



>gb|KCW52521.1| hypothetical protein EUGRSUZ_J01909 [Eucalyptus grandis]
Length=518

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 4/119 (3%)
 Frame = -2

Query  704  HRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQ  525
            H   Q+E   +ER P+LS K+DD  S GSSY S+S D+ED EE  + S+L+GKP  + E 
Sbjct  403  HEPGQME---TERAPLLSPKEDDLSSWGSSYDSVSHDEEDLEEQLAVSSLEGKPFGEGEN  459

Query  524  -SDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
             S+ R+LC ICFDAPRDC F+PCGH  +C+ CG++I E  G+CP+CRR+MKKV+KI+TV
Sbjct  460  PSNTRNLCIICFDAPRDCFFIPCGHFATCYACGSRIVEEDGSCPLCRRKMKKVRKIFTV  518



>ref|XP_011460950.1| PREDICTED: uncharacterized protein LOC101291029 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=360

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 90/146 (62%), Gaps = 6/146 (4%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQR---ILNNX---HRRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            YFLG G     + +A R   I  N        Q  +    R P+L  K DD LS GSSY 
Sbjct  215  YFLGSGVMTVLLLMAFRFCSIFQNAGEDRTDFQGREASPVRTPLLLPKDDDALSWGSSYE  274

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
             +S D+ED EE    S+L+GK +   + ++   LC ICFD PRDC FLPCGHC +CF CG
Sbjct  275  CISNDEEDFEEFLGVSSLEGKSINGGDDNNTLRLCVICFDGPRDCFFLPCGHCATCFTCG  334

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+I+E AGTCP+CR +MKKV+KI++V
Sbjct  335  TRISEEAGTCPICRMKMKKVRKIFSV  360



>ref|XP_008384801.1| PREDICTED: uncharacterized protein LOC103447392 [Malus domestica]
Length=467

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            YFL  G     +  A +I       +      Q E+  SE+ P+L  K DD LS GSSY 
Sbjct  322  YFLVAGVMTLLLLTAFKIYYKFQNSSEDTTEFQAEEEESEQTPLLPPKDDDVLSWGSSYE  381

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
            S+S  +ED +E  ++S+L+G    +++ ++ R LC ICFD PRDC FLPCGHC  CF CG
Sbjct  382  SVSNTEEDLDECLAASSLEGGLTSEADSNNTRRLCVICFDGPRDCFFLPCGHCAVCFTCG  441

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+IAE AGTCP+CRRRMKKV+KI+TV
Sbjct  442  TRIAEEAGTCPICRRRMKKVRKIFTV  467



>ref|XP_011460948.1| PREDICTED: uncharacterized protein LOC101291029 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=452

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 90/146 (62%), Gaps = 6/146 (4%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQR---ILNNX---HRRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            YFLG G     + +A R   I  N        Q  +    R P+L  K DD LS GSSY 
Sbjct  307  YFLGSGVMTVLLLMAFRFCSIFQNAGEDRTDFQGREASPVRTPLLLPKDDDALSWGSSYE  366

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
             +S D+ED EE    S+L+GK +   + ++   LC ICFD PRDC FLPCGHC +CF CG
Sbjct  367  CISNDEEDFEEFLGVSSLEGKSINGGDDNNTLRLCVICFDGPRDCFFLPCGHCATCFTCG  426

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+I+E AGTCP+CR +MKKV+KI++V
Sbjct  427  TRISEEAGTCPICRMKMKKVRKIFSV  452



>ref|XP_011460949.1| PREDICTED: uncharacterized protein LOC101291029 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=449

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 90/146 (62%), Gaps = 6/146 (4%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQR---ILNNX---HRRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            YFLG G     + +A R   I  N        Q  +    R P+L  K DD LS GSSY 
Sbjct  304  YFLGSGVMTVLLLMAFRFCSIFQNAGEDRTDFQGREASPVRTPLLLPKDDDALSWGSSYE  363

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
             +S D+ED EE    S+L+GK +   + ++   LC ICFD PRDC FLPCGHC +CF CG
Sbjct  364  CISNDEEDFEEFLGVSSLEGKSINGGDDNNTLRLCVICFDGPRDCFFLPCGHCATCFTCG  423

Query  428  TKIAETAGTCPVCRRRMKKVKKIYTV  351
            T+I+E AGTCP+CR +MKKV+KI++V
Sbjct  424  TRISEEAGTCPICRMKMKKVRKIFSV  449



>gb|KEH23171.1| ubiquitin-protein ligase, putative [Medicago truncatula]
Length=447

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -2

Query  686  EDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRH  510
            E TG +R P LS K  D+LS GSSY SL +DDED       ST DGK + D E S+  + 
Sbjct  338  EGTGPDRAPFLSRK--DDLSRGSSYDSLPEDDEDLNFVAGGST-DGKILGDGETSNNTQR  394

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            LCAICFDAPRDC FLPCGHC++CF CG++IAE AG CPVCRR MKKV++I+TV
Sbjct  395  LCAICFDAPRDCFFLPCGHCVACFACGSRIAEAAGICPVCRRNMKKVRRIFTV  447



>ref|XP_008355058.1| PREDICTED: uncharacterized protein LOC103418723 [Malus domestica]
Length=460

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 92/147 (63%), Gaps = 9/147 (6%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRA-------QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            YFL + G    + L   I  N  + +       Q E+  S + P+LS K DD LS GSSY
Sbjct  316  YFL-VAGVMTLLLLTAFIFYNKFQNSSEDTTXFQAEEGQSVQTPLLSPKDDDTLSWGSSY  374

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
              +S ++ED +E  + S+L+G    + + +    LC ICFD PRDC FLPCGHC +CF C
Sbjct  375  EFIS-NEEDLDECLAVSSLEGSLTNEGDSNXTGRLCVICFDGPRDCFFLPCGHCAACFTC  433

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
             T+IAE AGTCP+CRRRMKKV+KI+TV
Sbjct  434  XTRIAEEAGTCPICRRRMKKVRKIFTV  460



>ref|XP_002525648.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF36766.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=502

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 91/147 (62%), Gaps = 8/147 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRA-----QLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            TYF+G G     +    R        +     + ++  SER P+L  K DD  S GSSY 
Sbjct  358  TYFIGSGFMTLLILFTLRYCKMFQASSGDGIQEGDNLRSERAPLLLPKDDDVSSWGSSYG  417

Query  608  SLSQDD-EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            S SQ++ ED +E  + ++  GK +  SE  ++  LC ICFDAPRDC FLPCGHC +CF C
Sbjct  418  STSQEEHEDLDELLAMNSGAGKQL--SEGENLNRLCVICFDAPRDCFFLPCGHCAACFTC  475

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GT+IAE  GTCP+CRR MKKV+KI+TV
Sbjct  476  GTRIAEEPGTCPICRRSMKKVRKIFTV  502



>ref|XP_002264526.1| PREDICTED: uncharacterized protein LOC100247198 isoform X1 [Vitis 
vinifera]
 emb|CBI22791.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 91/148 (61%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLE------DTGSERVPMLSDKQDDNLSLGSSY  612
            TY +G+GG    + L    LN      QL        T  E  P+L DK DD  S  SSY
Sbjct  332  TYIVGVGGMTVLMLLVFNFLNKFQFNRQLRIGVPLGGTQPETSPLLPDKDDDLSSWDSSY  391

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S S D+EDA++      LDGKP KD E  S+ + LC ICFDAPRDC FLPCGHC++CF 
Sbjct  392  DSASHDEEDAQDKLGVGGLDGKPKKDGENNSNPKRLCTICFDAPRDCFFLPCGHCVACFT  451

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+I E  GTCP+C R MKKV+KI+TV
Sbjct  452  CGTRILEEDGTCPICSRNMKKVRKIFTV  479



>ref|XP_006848229.1| hypothetical protein AMTR_s00029p00246370 [Amborella trichopoda]
 gb|ERN09810.1| hypothetical protein AMTR_s00029p00246370 [Amborella trichopoda]
Length=475

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 98/147 (67%), Gaps = 7/147 (5%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILN-NXHRRAQLE---DTGSERVPMLSDKQDDNLSLGSSYCS-  606
            YF+G GG    ++L  + ++ +  R A+ +   +   ER+P+L+ K DDN S  SS+ S 
Sbjct  329  YFIGSGGMTILIYLTFKSMSGSLSRVAEFQASREVAPERMPLLAPKDDDNSSCCSSFGSF  388

Query  605  LSQDDEDAEEPTSSSTLDGKPVKDS-EQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
            LS D+E+ E   ++   +G   ++  E S++R LC ICFDAPRDC FLPCGHC +CF CG
Sbjct  389  LSHDEEEYEGKVAAGLGEGNHSQEGGETSNLRRLCVICFDAPRDCFFLPCGHCAACFTCG  448

Query  428  TK-IAETAGTCPVCRRRMKKVKKIYTV  351
            ++ I E  GTCP+CRR+MK+V+KI+TV
Sbjct  449  SRIIGEEPGTCPICRRKMKRVRKIFTV  475



>gb|KDO66889.1| hypothetical protein CISIN_1g0435821mg, partial [Citrus sinensis]
Length=215

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 94/148 (64%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TYF G+G     +FLA R  N     +      Q  D GS+  P+LS K D   S GSSY
Sbjct  68   TYFAGLGAMTILMFLAFRYCNMCRTTSGDGTGFQATDRGSQSPPLLSHKDDGLSSWGSSY  127

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D++D E+    ++L+G  + + E  S+ RHL  IC DAPRDC FLPCGHC  CF 
Sbjct  128  DSVSHDEQDLEDWLPVNSLEGTSLNEGEINSNPRHLQVICCDAPRDCFFLPCGHCAGCFT  187

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTCP+CR+++KKV+KI+TV
Sbjct  188  CGTRIAEEGGTCPICRKKIKKVRKIFTV  215



>emb|CDY07747.1| BnaA03g17640D [Brassica napus]
Length=435

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  773  TYFLGIG-GTCFFVF---LAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCS  606
            +Y +G G  TCF +    L +R+  +     Q ++  S R  +L +K +D  S+GSS  S
Sbjct  300  SYVVGTGLVTCFMLVAIQLWKRLQCDGEEIDQTQND-SARTRLLVNKDEDGSSMGSSNES  358

Query  605  LSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
             + DD D E+ T +        +    +  R LCAICFDA RDC FLPCGHC+SC++CGT
Sbjct  359  FAADDADLEDFTGN--------EGEASNSTRRLCAICFDAKRDCFFLPCGHCVSCYQCGT  410

Query  425  KIAETAGTCPVCRRRMKKVKKIYTV  351
            KIAE AG+CPVCRR MKKVK+IYTV
Sbjct  411  KIAEAAGSCPVCRRTMKKVKRIYTV  435



>ref|XP_009133239.1| PREDICTED: uncharacterized protein LOC103857765 isoform X2 [Brassica 
rapa]
Length=407

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  773  TYFLGIG-GTCFFVF---LAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCS  606
            +Y +G G  TCF +    L +R+  +     Q ++  S R  +L +K +D  S+GSS  S
Sbjct  272  SYVVGTGLVTCFMLVAIQLWKRLQCDGEEIDQTQND-SARTRLLVNKDEDGSSMGSSNES  330

Query  605  LSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
             + DD D E+ T +        +    +  R LCAICFDA RDC FLPCGHC+SC++CGT
Sbjct  331  FAADDADLEDFTGN--------EGEASNSTRRLCAICFDARRDCFFLPCGHCVSCYQCGT  382

Query  425  KIAETAGTCPVCRRRMKKVKKIYTV  351
            KIAE AG+CPVCRR MKKVK+IYTV
Sbjct  383  KIAEAAGSCPVCRRTMKKVKRIYTV  407



>ref|XP_009133237.1| PREDICTED: uncharacterized protein LOC103857765 isoform X1 [Brassica 
rapa]
 ref|XP_009133238.1| PREDICTED: uncharacterized protein LOC103857765 isoform X1 [Brassica 
rapa]
Length=434

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 13/145 (9%)
 Frame = -2

Query  773  TYFLGIG-GTCFFVF---LAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCS  606
            +Y +G G  TCF +    L +R+  +     Q ++  S R  +L +K +D  S+GSS  S
Sbjct  299  SYVVGTGLVTCFMLVAIQLWKRLQCDGEEIDQTQND-SARTRLLVNKDEDGSSMGSSNES  357

Query  605  LSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
             + DD D E+ T +        +    +  R LCAICFDA RDC FLPCGHC+SC++CGT
Sbjct  358  FAADDADLEDFTGN--------EGEASNSTRRLCAICFDARRDCFFLPCGHCVSCYQCGT  409

Query  425  KIAETAGTCPVCRRRMKKVKKIYTV  351
            KIAE AG+CPVCRR MKKVK+IYTV
Sbjct  410  KIAEAAGSCPVCRRTMKKVKRIYTV  434



>ref|XP_006425068.1| hypothetical protein CICLE_v10030173mg [Citrus clementina]
 gb|ESR38308.1| hypothetical protein CICLE_v10030173mg [Citrus clementina]
Length=449

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 93/148 (63%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TYF G+G     V LA R  N     +      Q  D GS+  P+LS K D   S GSSY
Sbjct  302  TYFAGLGAMTILVLLAFRYCNMCRTTSGDGTGFQATDRGSQSAPLLSHKDDGLSSWGSSY  361

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D++D E+    ++L+G  + + E  S+ RHL  IC DAPRDC FLPCGHC  CF 
Sbjct  362  DSVSHDEQDLEDWLPVNSLEGTSLNEGEINSNPRHLQVICCDAPRDCFFLPCGHCAGCFT  421

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTCP+CR+++KKV+KI+TV
Sbjct  422  CGTRIAEEGGTCPICRKKIKKVRKIFTV  449



>ref|NP_973632.1| protein ABERRANT POLLEN DEVELOPMENT 1 [Arabidopsis thaliana]
 gb|AEC09505.1| protein ABERRANT POLLEN DEVELOPMENT 1 [Arabidopsis thaliana]
Length=346

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 84/144 (58%), Gaps = 11/144 (8%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH---RRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
             Y +G G    F+ +A +  N          L +  S R  +L+DK DD  S+GS   S 
Sbjct  211  AYVIGTGVVICFMLVAIQFCNRFQCSGGEGHLTEDDSARTRLLADKDDDGSSMGSCDDSY  270

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            + DD D EE   +   DG+    S     R LCAICFD PRDC FLPCGH +SC+ECGT 
Sbjct  271  ANDDADLEEFMGN---DGEASNRS-----RRLCAICFDVPRDCFFLPCGHSVSCYECGTT  322

Query  422  IAETAGTCPVCRRRMKKVKKIYTV  351
            + E  G+CP+CRR+MKKVK+IYTV
Sbjct  323  MQEADGSCPICRRKMKKVKRIYTV  346



>gb|KJB55739.1| hypothetical protein B456_009G092000 [Gossypium raimondii]
Length=494

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 82/123 (67%), Gaps = 7/123 (6%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            +YF+G G     V +A R+     RR+ + + GS+R P+L+ K DD  S GSSY SLS +
Sbjct  371  SYFVGSGVMTVLVLIAFRLWKMKQRRSNVGEMGSQRAPLLAQKDDDIASWGSSYYSLS-N  429

Query  593  DEDAEEP----TSSSTLDGKPVKDSEQS--DMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            DED E+P     +++ L+GKP+ D E+S  + RHLC +CF +PRDC FLPCGHC +CF C
Sbjct  430  DEDEEDPETWQQAATCLEGKPLNDGERSSNNPRHLCVVCFGSPRDCFFLPCGHCATCFTC  489

Query  431  GTK  423
            GT+
Sbjct  490  GTR  492



>ref|XP_002879731.1| hypothetical protein ARALYDRAFT_321523 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55990.1| hypothetical protein ARALYDRAFT_321523 [Arabidopsis lyrata subsp. 
lyrata]
Length=829

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 95/169 (56%), Gaps = 12/169 (7%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH---RRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
             Y +G G    F+ +A +  N          L +  S R  +L +K DD  S+GS   S 
Sbjct  300  AYVIGTGVVICFMLVAIQFCNRLQCYGGEGYLTENDSARTRLLENKDDDGSSMGSCNDSF  359

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            + DD D EE   +   DG+    S     R LCAICFDAPRDC FLPCGH +SC+ECGT 
Sbjct  360  ANDDADLEEFMEN---DGEASNRS-----RRLCAICFDAPRDCFFLPCGHSVSCYECGTT  411

Query  422  IAETAGTCPVCRRRMKKVKKIYTV*TSLMDLPPLSPXCXVYTVCIIVFL  276
            + E  G+CP+CRR+MKKVK+I+TV + L    P SP     ++ + +FL
Sbjct  412  MQEDDGSCPICRRKMKKVKRIFTVQSPLQHTQP-SPMDTFLSLSLDIFL  459


 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = -2

Query  539  KDSEQSDM-RHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKK  363
             D E S+  R +CAICFDAPRDC   PCGHC+SC++CGTKI    G CP+CR++M  VK+
Sbjct  766  NDGEASNRSRCVCAICFDAPRDCFIFPCGHCVSCYQCGTKIKRAKGRCPICRKKMMLVKR  825

Query  362  IYTV  351
            IYTV
Sbjct  826  IYTV  829



>ref|NP_973633.2| protein ABERRANT POLLEN DEVELOPMENT 1 [Arabidopsis thaliana]
 gb|AEC09506.1| protein ABERRANT POLLEN DEVELOPMENT 1 [Arabidopsis thaliana]
Length=447

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 84/144 (58%), Gaps = 11/144 (8%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH---RRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
             Y +G G    F+ +A +  N          L +  S R  +L+DK DD  S+GS   S 
Sbjct  312  AYVIGTGVVICFMLVAIQFCNRFQCSGGEGHLTEDDSARTRLLADKDDDGSSMGSCDDSY  371

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            + DD D EE   +   DG+    S     R LCAICFD PRDC FLPCGH +SC+ECGT 
Sbjct  372  ANDDADLEEFMGN---DGEASNRS-----RRLCAICFDVPRDCFFLPCGHSVSCYECGTT  423

Query  422  IAETAGTCPVCRRRMKKVKKIYTV  351
            + E  G+CP+CRR+MKKVK+IYTV
Sbjct  424  MQEADGSCPICRRKMKKVKRIYTV  447



>ref|NP_565884.2| protein ABERRANT POLLEN DEVELOPMENT 1 [Arabidopsis thaliana]
 ref|NP_973631.1| protein ABERRANT POLLEN DEVELOPMENT 1 [Arabidopsis thaliana]
 dbj|BAF00093.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09503.1| protein ABERRANT POLLEN DEVELOPMENT 1 [Arabidopsis thaliana]
 gb|AEC09504.1| protein ABERRANT POLLEN DEVELOPMENT 1 [Arabidopsis thaliana]
Length=441

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 84/144 (58%), Gaps = 11/144 (8%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH---RRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
             Y +G G    F+ +A +  N          L +  S R  +L+DK DD  S+GS   S 
Sbjct  306  AYVIGTGVVICFMLVAIQFCNRFQCSGGEGHLTEDDSARTRLLADKDDDGSSMGSCDDSY  365

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            + DD D EE   +   DG+    S     R LCAICFD PRDC FLPCGH +SC+ECGT 
Sbjct  366  ANDDADLEEFMGN---DGEASNRS-----RRLCAICFDVPRDCFFLPCGHSVSCYECGTT  417

Query  422  IAETAGTCPVCRRRMKKVKKIYTV  351
            + E  G+CP+CRR+MKKVK+IYTV
Sbjct  418  MQEADGSCPICRRKMKKVKRIYTV  441



>gb|AAC27168.1| unknown protein [Arabidopsis thaliana]
 gb|AAP88337.1| At2g38190 [Arabidopsis thaliana]
Length=124

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 8/115 (7%)
 Frame = -2

Query  695  AQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDM  516
              L +  S R  +L+DK DD  S+GS   S + DD D EE   +   DG+    S     
Sbjct  18   GHLTEDDSARTRLLADKDDDGSSMGSCDDSYANDDADLEEFMGN---DGEASNRS-----  69

Query  515  RHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            R LCAICFD PRDC FLPCGH +SC+ECGT + E  G+CP+CRR+MKKVK+IYTV
Sbjct  70   RRLCAICFDVPRDCFFLPCGHSVSCYECGTTMQEADGSCPICRRKMKKVKRIYTV  124



>ref|XP_010685553.1| PREDICTED: uncharacterized protein LOC104899956 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 91/147 (62%), Gaps = 12/147 (8%)
 Frame = -2

Query  755  GGTCF---FVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
            GG+C     +F+  R  N     +      Q+  T + R P+LS+K +D+ S  SSY S+
Sbjct  332  GGSCIVAAMIFVLYRCYNQLQPNSGDEVGNQVNATIAGREPLLSNKNNDHSSWDSSYDSI  391

Query  602  SQD-DEDAEEPTSSSTLDGKPVKDSE--QSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
              D D+  +E     +L+G+  ++ E    D   LCAIC D+PRDC FLPCGH  +CF C
Sbjct  392  PSDGDQGLQEKILEGSLEGEVSREGEIHSPDTCRLCAICLDSPRDCFFLPCGHSAACFSC  451

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            G++IAE AGTCP+CRR+MKKV+KI++V
Sbjct  452  GSRIAEEAGTCPICRRKMKKVRKIFSV  478



>ref|XP_002299808.2| hypothetical protein POPTR_0001s25890g, partial [Populus trichocarpa]
 gb|EEE84613.2| hypothetical protein POPTR_0001s25890g, partial [Populus trichocarpa]
Length=372

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = -2

Query  692  QLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMR  513
            Q  +  SER P+LS K DD+ S GSSY S S ++ED E+  + + ++GK V + E  ++R
Sbjct  261  QAGEIESERTPLLSQKDDDSSSWGSSYDSNSHEEEDLEKWLAVNCIEGKSVAEGE--NLR  318

Query  512  HLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
             LC ICFDAPRDC FLPCGHC +CF CGT+IAE  G CP+CRR +KKV+KI+TV
Sbjct  319  RLCVICFDAPRDCFFLPCGHCAACFTCGTRIAEEVGVCPICRRSLKKVRKIFTV  372



>ref|XP_006488687.1| PREDICTED: uncharacterized protein LOC102622796 [Citrus sinensis]
Length=449

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 7/148 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRA------QLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TYF G+G     + LA R  N     +      Q  + GS+R P+LS K DD  S GSSY
Sbjct  302  TYFAGLGVMTILMLLAFRYCNMCRTTSGDGTGFQATERGSQRAPLLSHKDDDLSSWGSSY  361

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSE-QSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D++D E+    ++L+G  + + E   + RHL  IC DAPRDC FLPCGHC +CF 
Sbjct  362  DSVSHDEQDLEDRLPVNSLEGTSLNEGEINRNHRHLRVICCDAPRDCFFLPCGHCAACFA  421

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CGT+IAE  GTC +CR+++KKV+KI+TV
Sbjct  422  CGTRIAEEGGTCSICRKKIKKVRKIFTV  449



>ref|XP_010685554.1| PREDICTED: uncharacterized protein LOC104899956 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=475

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = -2

Query  692  QLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD-DEDAEEPTSSSTLDGKPVKDSE--QS  522
            Q+  T + R P+LS+K +D+ S  SSY S+  D D+  +E     +L+G+  ++ E    
Sbjct  359  QVNATIAGREPLLSNKNNDHSSWDSSYDSIPSDGDQGLQEKILEGSLEGEVSREGEIHSP  418

Query  521  DMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            D   LCAIC D+PRDC FLPCGH  +CF CG++IAE AGTCP+CRR+MKKV+KI++V
Sbjct  419  DTCRLCAICLDSPRDCFFLPCGHSAACFSCGSRIAEEAGTCPICRRKMKKVRKIFSV  475



>ref|XP_011043774.1| PREDICTED: uncharacterized protein LOC105139138 isoform X2 [Populus 
euphratica]
Length=353

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = -2

Query  692  QLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMR  513
            Q  +   ER P+LS K DD+ S GSSY S S ++ED E+  + + L+GK V + E  ++R
Sbjct  242  QAGEIEPERTPLLSQKDDDSSSWGSSYDSNSHEEEDLEKWLAVNCLEGKSVAEGE--NLR  299

Query  512  HLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
             LC ICFDA RDC FLPCGHC +CF CGT+IAE  G CP+CRR +KKV+KI+TV
Sbjct  300  RLCVICFDALRDCFFLPCGHCAACFTCGTRIAEEVGACPICRRNLKKVRKIFTV  353



>ref|XP_011043773.1| PREDICTED: uncharacterized protein LOC105139138 isoform X1 [Populus 
euphratica]
Length=481

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = -2

Query  692  QLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMR  513
            Q  +   ER P+LS K DD+ S GSSY S S ++ED E+  + + L+GK V + E  ++R
Sbjct  370  QAGEIEPERTPLLSQKDDDSSSWGSSYDSNSHEEEDLEKWLAVNCLEGKSVAEGE--NLR  427

Query  512  HLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
             LC ICFDA RDC FLPCGHC +CF CGT+IAE  G CP+CRR +KKV+KI+TV
Sbjct  428  RLCVICFDALRDCFFLPCGHCAACFTCGTRIAEEVGACPICRRNLKKVRKIFTV  481



>ref|XP_010505434.1| PREDICTED: uncharacterized protein LOC104782255 isoform X1 [Camelina 
sativa]
 ref|XP_010505435.1| PREDICTED: uncharacterized protein LOC104782255 isoform X1 [Camelina 
sativa]
 ref|XP_010505436.1| PREDICTED: uncharacterized protein LOC104782255 isoform X1 [Camelina 
sativa]
Length=467

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 68/106 (64%), Gaps = 8/106 (8%)
 Frame = -2

Query  668  RVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFD  489
            R  +  +K DD  S+GS     + DD D E        D     D   +  R LCAICFD
Sbjct  353  RAFLRENKDDDVSSIGSCNEPFANDDADLE--------DNMGQVDEASNQTRRLCAICFD  404

Query  488  APRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            APRDC FLPCGHC+SC+ECGTK+AE  G CP+C+++MKKVK+IYTV
Sbjct  405  APRDCFFLPCGHCVSCYECGTKMAEAGGNCPICQKKMKKVKRIYTV  450



>ref|XP_010505437.1| PREDICTED: uncharacterized protein LOC104782255 isoform X2 [Camelina 
sativa]
Length=450

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 68/106 (64%), Gaps = 8/106 (8%)
 Frame = -2

Query  668  RVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFD  489
            R  +  +K DD  S+GS     + DD D E        D     D   +  R LCAICFD
Sbjct  353  RAFLRENKDDDVSSIGSCNEPFANDDADLE--------DNMGQVDEASNQTRRLCAICFD  404

Query  488  APRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            APRDC FLPCGHC+SC+ECGTK+AE  G CP+C+++MKKVK+IYTV
Sbjct  405  APRDCFFLPCGHCVSCYECGTKMAEAGGNCPICQKKMKKVKRIYTV  450



>emb|CDP09192.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 86/148 (58%), Gaps = 10/148 (7%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQ------RILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            +Y +G       + +A       RI        Q   T SER P+LS K DD+LS   S 
Sbjct  324  SYLVGSASMTVLLIVATKICFSFRITGEYETGFQAGMTASERAPLLSQK-DDDLSSWGSV  382

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQ-SDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
             S+S D+E+  +  S +T DGK +K+ +   D R LC +C DA RDC FLPCGHC +CF 
Sbjct  383  DSMSHDEEELND--SIATPDGKQLKEGDGLKDHRQLCILCSDAFRDCFFLPCGHCAACFT  440

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CG +  E AG CP+CR+ MKKV+KI++V
Sbjct  441  CGKRAMEEAGKCPICRKTMKKVRKIFSV  468



>ref|XP_006411024.1| hypothetical protein EUTSA_v10016735mg [Eutrema salsugineum]
 gb|ESQ52477.1| hypothetical protein EUTSA_v10016735mg [Eutrema salsugineum]
Length=408

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 84/144 (58%), Gaps = 16/144 (11%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH---RRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
             Y +G G    F+ +A ++            L +  S R  +L++K DD  S GSS+ + 
Sbjct  276  AYVIGTGLVTCFMLVAIQLWKRLPCLVGERYLTENDSARTRLLANKDDDGSSTGSSFAA-  334

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
              DD + E+   S         + E S+  R LCAIC D+ RDC FLPCGHC+SC++CGT
Sbjct  335  --DDAEFEDFIGS---------EGEASNGTRRLCAICLDSQRDCFFLPCGHCVSCYQCGT  383

Query  425  KIAETAGTCPVCRRRMKKVKKIYT  354
             IA+ AG CP+CRR+MKKVK+IYT
Sbjct  384  MIAQAAGNCPICRRKMKKVKRIYT  407



>ref|XP_006294282.1| hypothetical protein CARUB_v10023281mg [Capsella rubella]
 gb|EOA27180.1| hypothetical protein CARUB_v10023281mg [Capsella rubella]
Length=423

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 10/87 (11%)
 Frame = -2

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            S + DD D EE   S         + E S+  R LCAICFD PRDC FLPCGHC+SC++C
Sbjct  346  SFTNDDADLEELMGS---------NGETSNRTRCLCAICFDTPRDCFFLPCGHCVSCYQC  396

Query  431  GTKIAETAGTCPVCRRRMKKVKKIYTV  351
            GTK+AE AG+CP+CRR+MKKVK+IYTV
Sbjct  397  GTKMAEAAGSCPICRRKMKKVKRIYTV  423



>emb|CDY11200.1| BnaA03g00360D [Brassica napus]
Length=444

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 86/144 (60%), Gaps = 15/144 (10%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRA-QLEDTGSER---VPMLSDKQDDNLSLGSSYCSL  603
            Y + +G     + +   + N   +   + E+T  E     P++  K DDN S  SSY S+
Sbjct  312  YIVCMGVVTALLLILSSVFNKRQQAVPENEETADENDDVAPLIPGKDDDNSSWCSSYSSI  371

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
                E+ E     +  DG       QS  R+LCAICFDAPRDC FL CGHC++CF+CGT+
Sbjct  372  LTSTEELE----GAHGDG-------QSSTRYLCAICFDAPRDCFFLSCGHCVACFQCGTR  420

Query  422  IAETAGTCPVCRRRMKKVKKIYTV  351
            IAET+G CPVCRR+++KVKKI+ V
Sbjct  421  IAETSGFCPVCRRKIRKVKKIFNV  444



>emb|CDX80772.1| BnaC03g00260D [Brassica napus]
Length=445

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 83/136 (61%), Gaps = 14/136 (10%)
 Frame = -2

Query  749  TCFFVFLAQRILNNXHRRAQLEDTGSER---VPMLSDKQDDNLSLGSSYCSLSQDDEDAE  579
            T   + L+          ++ E+T  E     P++  K DDN S  SSY S+        
Sbjct  321  TALLLILSSVFNKRQQAVSENEETADENDDVAPLIPGKDDDNSSWCSSYSSIL-------  373

Query  578  EPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTC  399
              TS+  L+G   +   QS  R+LCAICFDAPRDC FL CGHC++CF+CGT+IAET+G C
Sbjct  374  --TSTEELEGA--QGDGQSSTRYLCAICFDAPRDCFFLSCGHCVACFQCGTRIAETSGFC  429

Query  398  PVCRRRMKKVKKIYTV  351
            PVCRR+++KVKKI+ V
Sbjct  430  PVCRRKIRKVKKIFNV  445



>ref|XP_010517108.1| PREDICTED: uncharacterized protein LOC104792617 [Camelina sativa]
Length=448

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 71/106 (67%), Gaps = 8/106 (8%)
 Frame = -2

Query  668  RVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFD  489
            R  ++ +K DD  S+GS     + DD D E+       + + V ++  +  R LCAIC D
Sbjct  351  RAYLIGNKDDDVSSIGSCNEPFANDDADLED-------NMRHVGEA-SNQTRRLCAICLD  402

Query  488  APRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            APRDC FLPCGHC+SC+ECGTK+AE   +CP+C+R MKKVK+IYTV
Sbjct  403  APRDCFFLPCGHCVSCYECGTKMAEAGVSCPICQRNMKKVKRIYTV  448



>ref|XP_007026704.1| RING/U-box superfamily protein, putative isoform 5 [Theobroma 
cacao]
 gb|EOY07206.1| RING/U-box superfamily protein, putative isoform 5 [Theobroma 
cacao]
Length=464

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 7/123 (6%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXH------RRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            Y +GIGG    + +A   LN               +  S R P+LS+K DD  S GSSY 
Sbjct  342  YIVGIGGMTAIMLVAFNFLNKFQFTRGGETNLHYGENASARAPLLSNKDDDISSWGSSYD  401

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSD-MRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
            S+S D+ D E+  ++ +++G  +++ E S+  R LCAICFDAPRDC FLPCGHC++CF C
Sbjct  402  SVSSDEADLEDFLAAGSVEGTSIREGENSNNTRRLCAICFDAPRDCFFLPCGHCVACFAC  461

Query  431  GTK  423
            G++
Sbjct  462  GSR  464



>ref|XP_009130651.1| PREDICTED: uncharacterized protein LOC103855419 [Brassica rapa]
Length=444

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 11/111 (10%)
 Frame = -2

Query  683  DTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLC  504
            D   +  P++  K DDN S  SSY S+    E+ E     +  DG       QS  R+LC
Sbjct  345  DENDDVAPLIPGKDDDNSSWCSSYSSILTSTEELE----GAHGDG-------QSSTRYLC  393

Query  503  AICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            AICFDAPRDC FL CGHC++CF+CGT+IAET+G CPVCRR+++KVKKI+ V
Sbjct  394  AICFDAPRDCFFLSCGHCVACFQCGTRIAETSGFCPVCRRKIRKVKKIFNV  444



>ref|XP_006288261.1| hypothetical protein CARUB_v10001505mg [Capsella rubella]
 gb|EOA21159.1| hypothetical protein CARUB_v10001505mg [Capsella rubella]
Length=314

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 13/142 (9%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLE--DTGSERVPMLSDKQDDNLSLGSSYCSLSQ  597
            Y + +G     + +   + N     ++ E  D   +  P++  K DDN S  SSY S+  
Sbjct  184  YMVCMGVVTALLLIVSSLFNKRQAVSEDEIVDENDDVAPLIPGKDDDNSSWCSSYSSIL-  242

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
                    TS+  L+G        S  R+LCAIC+DAPRDC FL CGHC++CF+CGT+IA
Sbjct  243  --------TSTEELEG--AHGEGHSSTRYLCAICYDAPRDCFFLSCGHCVACFQCGTRIA  292

Query  416  ETAGTCPVCRRRMKKVKKIYTV  351
            ET+G CPVCRR+++KVKKI+ V
Sbjct  293  ETSGFCPVCRRKIRKVKKIFNV  314



>emb|CDY14482.1| BnaC03g21130D [Brassica napus]
Length=415

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 83/145 (57%), Gaps = 32/145 (22%)
 Frame = -2

Query  773  TYFLGIG-GTCFFVF---LAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCS  606
            +Y +G G  TCF +    L +R+  +   R Q ++  S R  +L +K +D+ +       
Sbjct  299  SYVVGTGLVTCFMLVAIQLWKRLQCDGEERDQTQN-DSARTRLLVNKDEDDFT-------  350

Query  605  LSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
                    E   S+ST              R LCAICFDA RDC FLPCGHC+SC++CGT
Sbjct  351  ------GNEGEASNST--------------RRLCAICFDAKRDCFFLPCGHCVSCYQCGT  390

Query  425  KIAETAGTCPVCRRRMKKVKKIYTV  351
            KIAE AG+CPVCRR MKKVK+IYTV
Sbjct  391  KIAEAAGSCPVCRRTMKKVKRIYTV  415



>ref|XP_010451984.1| PREDICTED: uncharacterized protein LOC104734158 [Camelina sativa]
Length=448

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 13/142 (9%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLE--DTGSERVPMLSDKQDDNLSLGSSYCSLSQ  597
            Y + +G     + +   + N     ++ E  D   +  P++  K DDN S  SSY S+  
Sbjct  318  YMVCMGVVTALLLIVSSLFNKRQPVSEDETADENDDVAPLIPGKDDDNSSWCSSYSSIL-  376

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
                    TS+  L+G        S  R+LCAIC+DAPRDC FL CGHC++CF+CGT+IA
Sbjct  377  --------TSTEELEG--AHGEGHSSTRYLCAICYDAPRDCFFLSCGHCVACFQCGTRIA  426

Query  416  ETAGTCPVCRRRMKKVKKIYTV  351
            ET+G CPVCRR+++KVKKI+ V
Sbjct  427  ETSGFCPVCRRKIRKVKKIFNV  448



>ref|XP_010423955.1| PREDICTED: uncharacterized protein LOC104708994 [Camelina sativa]
Length=445

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 13/142 (9%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLE--DTGSERVPMLSDKQDDNLSLGSSYCSLSQ  597
            Y + +G     + +   + N     ++ E  D   +  P++  K DDN S  SSY S+  
Sbjct  315  YLVCMGVVTALLLIVSGLFNKRQPVSEDEAVDENDDVAPLIPGKDDDNSSWCSSYSSIL-  373

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
                    TS+  L+G        S  R+LCAIC+DAPRDC FL CGHC++CF+CGT+IA
Sbjct  374  --------TSTEELEGA--HGEGHSSTRYLCAICYDAPRDCFFLSCGHCVACFQCGTRIA  423

Query  416  ETAGTCPVCRRRMKKVKKIYTV  351
            ET+G CPVCRR+++KVKKI+ V
Sbjct  424  ETSGFCPVCRRKIRKVKKIFNV  445



>ref|XP_010490564.1| PREDICTED: uncharacterized protein LOC104768319 [Camelina sativa]
Length=443

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 13/142 (9%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLE--DTGSERVPMLSDKQDDNLSLGSSYCSLSQ  597
            Y + +G     + +   + N     ++ E  D   +  P++  K DDN S  SSY S+  
Sbjct  313  YMVCMGVVTALLLIVSSLFNKRQPDSEDEAVDENDDVAPLVPGKDDDNSSWCSSYSSIL-  371

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
                    TS+  L+G        S  R+LCAIC+DAPRDC FL CGHC++CF+CGT+IA
Sbjct  372  --------TSTEELEG--AHGEGHSSTRYLCAICYDAPRDCFFLSCGHCVACFQCGTRIA  421

Query  416  ETAGTCPVCRRRMKKVKKIYTV  351
            ET+G CPVCRR+++KVKKI+ V
Sbjct  422  ETSGFCPVCRRKIRKVKKIFNV  443



>ref|XP_010509210.1| PREDICTED: uncharacterized protein LOC104785655 [Camelina sativa]
 ref|XP_010509211.1| PREDICTED: uncharacterized protein LOC104785655 [Camelina sativa]
Length=451

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = -2

Query  668  RVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFD  489
            R  +L +K DD  ++ S     + DD D E+        G   + S Q+  R LCAIC D
Sbjct  354  RAFLLENKDDDVSTVCSFNEPFANDDADLEDNM------GHVGEASNQT--RRLCAICLD  405

Query  488  APRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            AP+DC F+PCGHC+SC+ECGTK+AE  G CP+C++ MKKVK+IYTV
Sbjct  406  APKDCFFIPCGHCVSCYECGTKMAEAGGNCPICQKNMKKVKRIYTV  451



>ref|XP_009143409.1| PREDICTED: uncharacterized protein LOC103867127 isoform X2 [Brassica 
rapa]
Length=397

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 81/144 (56%), Gaps = 11/144 (8%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQ---LEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
            +Y +  G    F+ +A  +     R  +   + D  S    +L  K DD  S+ S   S 
Sbjct  262  SYAIVTGLVICFLLVALELYKRFERAGEDRHVMDDDSSITSILVHKDDDVSSMCSWSESF  321

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            +  D D E+        G   + S  +  R  CAICFDA RDC FLPCGHC++C++CGTK
Sbjct  322  AAYDADRED------FSGNEGEASYGTKTR--CAICFDAKRDCFFLPCGHCVACYQCGTK  373

Query  422  IAETAGTCPVCRRRMKKVKKIYTV  351
            I E AG+CP+CR+++KKVK+IYTV
Sbjct  374  ITEAAGSCPICRKKIKKVKQIYTV  397



>ref|XP_009143410.1| PREDICTED: uncharacterized protein LOC103867127 isoform X3 [Brassica 
rapa]
Length=379

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 81/144 (56%), Gaps = 11/144 (8%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQ---LEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
            +Y +  G    F+ +A  +     R  +   + D  S    +L  K DD  S+ S   S 
Sbjct  244  SYAIVTGLVICFLLVALELYKRFERAGEDRHVMDDDSSITSILVHKDDDVSSMCSWSESF  303

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            +  D D E+        G   + S  +  R  CAICFDA RDC FLPCGHC++C++CGTK
Sbjct  304  AAYDADRED------FSGNEGEASYGTKTR--CAICFDAKRDCFFLPCGHCVACYQCGTK  355

Query  422  IAETAGTCPVCRRRMKKVKKIYTV  351
            I E AG+CP+CR+++KKVK+IYTV
Sbjct  356  ITEAAGSCPICRKKIKKVKQIYTV  379



>ref|XP_009143408.1| PREDICTED: uncharacterized protein LOC103867127 isoform X1 [Brassica 
rapa]
Length=399

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 81/144 (56%), Gaps = 11/144 (8%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQ---LEDTGSERVPMLSDKQDDNLSLGSSYCSL  603
            +Y +  G    F+ +A  +     R  +   + D  S    +L  K DD  S+ S   S 
Sbjct  264  SYAIVTGLVICFLLVALELYKRFERAGEDRHVMDDDSSITSILVHKDDDVSSMCSWSESF  323

Query  602  SQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            +  D D E+        G   + S  +  R  CAICFDA RDC FLPCGHC++C++CGTK
Sbjct  324  AAYDADRED------FSGNEGEASYGTKTR--CAICFDAKRDCFFLPCGHCVACYQCGTK  375

Query  422  IAETAGTCPVCRRRMKKVKKIYTV  351
            I E AG+CP+CR+++KKVK+IYTV
Sbjct  376  ITEAAGSCPICRKKIKKVKQIYTV  399



>emb|CAN70836.1| hypothetical protein VITISV_015872 [Vitis vinifera]
Length=922

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXH--------RRAQLEDTGSERVPMLSDKQDDNLSLGS  618
            TYF+G G     + LA R  N            +    +T  ER P+L  K DD  S GS
Sbjct  337  TYFVGSGAMTVLILLAFRACNTFQTIIGDGTGYQVGTGETEPERAPLLLPKDDDASSWGS  396

Query  617  SYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQS-DMRHLCAICFDAPRDCXFLPCGHCLSC  441
            SY S+S D+ED EE  + S+L+G   K+ E + + R LC IC DAPRDC FLPCGHC +C
Sbjct  397  SYDSISHDEEDLEEWLAVSSLEGNISKEGENNGNPRRLCVICCDAPRDCFFLPCGHCAAC  456

Query  440  FECGTKI  420
            F CGT++
Sbjct  457  FTCGTRL  463



>ref|XP_010517109.1| PREDICTED: uncharacterized protein LOC104792618 [Camelina sativa]
Length=386

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 75/137 (55%), Gaps = 25/137 (18%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            TY +  G    F+ +A +            D  S R P+L+DK DD    GS   +L  +
Sbjct  271  TYIIATGLVFCFILVATQCCGG---EGDPTDYDSPRTPLLADKDDD----GSLSTNLEGN  323

Query  593  DEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAE  414
            DE+A          GK        + R +C IC+DAPRDC FLPCGHC+SCF+CGTKI +
Sbjct  324  DEEA----------GK--------ESRCVCIICYDAPRDCFFLPCGHCVSCFQCGTKIKK  365

Query  413  TAGTCPVCRRRMKKVKK  363
              G CP+CR+RM KVK+
Sbjct  366  AGGRCPICRKRMMKVKR  382



>gb|KFK24649.1| hypothetical protein AALP_AA8G007200 [Arabis alpina]
Length=440

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 80/142 (56%), Gaps = 13/142 (9%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLE--DTGSERVPMLSDKQDDNLSLGSSYCSLSQ  597
            Y + +G     + +   + N     ++ E  D   +  P++  K DDN S  SSY S+  
Sbjct  310  YIMCMGMVTVVLLIVSSLFNKRQPVSEDETNDENDDVAPLIPGKDDDNSSWCSSYSSIL-  368

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
                    TS+  L+G        S  R LCAIC DAPRD  FL CGHC++CF+CGT+IA
Sbjct  369  --------TSTEELEGG--HGEAYSSTRFLCAICCDAPRDSFFLSCGHCVACFQCGTRIA  418

Query  416  ETAGTCPVCRRRMKKVKKIYTV  351
            ET G CPVCRR+++KVKKI+ V
Sbjct  419  ETTGFCPVCRRKIRKVKKIFNV  440



>gb|KFK22532.1| hypothetical protein AALP_AAs66306U000100 [Arabis alpina]
Length=176

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = -2

Query  503  AICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            AICFDAPRDC FLPCGHC+SC++CGTKIAE +G+CP+CRR++KKVK+I+ +
Sbjct  126  AICFDAPRDCFFLPCGHCVSCYQCGTKIAEASGSCPICRRKLKKVKRIFRM  176



>emb|CDX74902.1| BnaA05g06480D [Brassica napus]
Length=379

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -2

Query  506  CAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            CAICFDA RDC FLPCGHC++C++CGTKI E AG+CP+CR+++KKVK+IYTV
Sbjct  328  CAICFDAKRDCFFLPCGHCVACYQCGTKITEAAGSCPICRKKIKKVKQIYTV  379



>ref|XP_010509207.1| PREDICTED: uncharacterized protein LOC104785650 [Camelina sativa]
Length=394

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 65/107 (61%), Gaps = 19/107 (18%)
 Frame = -2

Query  683  DTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLC  504
            D  S R P+L+DK D N    +   SL  +DE+A          GK        + R +C
Sbjct  303  DDDSPRKPLLADK-DGNAPFTNDDASLDGNDEEA----------GK--------ESRCVC  343

Query  503  AICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKK  363
             IC+DAPRDC FLPCGHC+SCF CGTKI + AG CP+CRRRM KVK+
Sbjct  344  TICYDAPRDCFFLPCGHCVSCFRCGTKIKKAAGRCPICRRRMMKVKR  390



>ref|XP_006411023.1| hypothetical protein EUTSA_v10017777mg [Eutrema salsugineum]
 gb|ESQ52476.1| hypothetical protein EUTSA_v10017777mg [Eutrema salsugineum]
Length=441

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = -2

Query  674  SERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAIC  495
            S R+ +L++K DD  S+GSS         D          D +    +E +  R LCAIC
Sbjct  343  SARIRLLANKDDDVSSMGSS---------DGSYAADDFFDDLEDFFGNEGNGTRRLCAIC  393

Query  494  FDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKI  360
            FD+PRD  FLPCGHC++C++CGT+I+E AG+C +C R MKKVK+I
Sbjct  394  FDSPRDSFFLPCGHCVACYQCGTEISEAAGSCLICGRNMKKVKRI  438



>ref|NP_181357.2| RING-finger domain-containing protein [Arabidopsis thaliana]
 gb|AEC09510.1| RING-finger domain-containing protein [Arabidopsis thaliana]
Length=404

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -2

Query  539  KDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKI  360
             D E S+ + LCAICFDAPRDC FLPCGHC+SC++CGTKI  T G CP+CR++M  VK+I
Sbjct  343  NDVEASN-KSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKMIHVKRI  401

Query  359  YT  354
            YT
Sbjct  402  YT  403



>ref|NP_001118467.1| protein ABERRANT POLLEN DEVELOPMENT 4 [Arabidopsis thaliana]
 gb|AEC09507.1| RING-finger domain-containing protein [Arabidopsis thaliana]
Length=326

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -2

Query  539  KDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKI  360
             D E S+ + LCAICFDAPRDC FLPCGHC+SC++CGTKI  T G CP+CR+++  VK+I
Sbjct  265  NDVEASN-KSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKIMHVKRI  323

Query  359  YT  354
            YT
Sbjct  324  YT  325



>gb|AAY82262.1| hypothetical protein At2g38185 [Arabidopsis thaliana]
Length=326

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 1/61 (2%)
 Frame = -2

Query  536  DSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIY  357
            D E S+ + LCAICFDAPRDC FLPCGHC+SC++CGTKI  T G CP+CR+++  VK+IY
Sbjct  266  DVEASN-KSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKIMHVKRIY  324

Query  356  T  354
            T
Sbjct  325  T  325



>gb|AAO86831.1| hypothetical protein [Arabidopsis thaliana]
Length=188

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -2

Query  539  KDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKI  360
             D E S+ + LCAICFDAPRDC FLPCGHC+SC++CGTKI  T G CP+CR+++  VK+I
Sbjct  127  NDVEASN-KSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKIMHVKRI  185

Query  359  YT  354
            YT
Sbjct  186  YT  187



>ref|NP_001118468.1| protein ABERRANT POLLEN DEVELOPMENT 4 [Arabidopsis thaliana]
 gb|AEC09508.1| RING-finger domain-containing protein [Arabidopsis thaliana]
Length=399

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -2

Query  539  KDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKI  360
             D E S+ + LCAICFDAPRDC FLPCGHC+SC++CGTKI  T G CP+CR+++  VK+I
Sbjct  338  NDVEASN-KSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKIMHVKRI  396

Query  359  YT  354
            YT
Sbjct  397  YT  398



>ref|XP_004963647.1| PREDICTED: uncharacterized protein LOC101757949 [Setaria italica]
Length=385

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 59/105 (56%), Gaps = 18/105 (17%)
 Frame = -2

Query  662  PMLS-DKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDA  486
            P+LS   +DD  SLGSSY S+S D  D  E                       C +C DA
Sbjct  298  PLLSGSNEDDGASLGSSYDSVSHDGSDGAEERGEGG-----------------CVLCCDA  340

Query  485  PRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            P+DC FLPCGH  +C+ CG +I E  G CP+CRR+MKKVK+IY V
Sbjct  341  PKDCFFLPCGHSATCYACGARILEGDGGCPICRRKMKKVKRIYAV  385



>ref|XP_002440099.1| hypothetical protein SORBIDRAFT_09g026010 [Sorghum bicolor]
 gb|EES18529.1| hypothetical protein SORBIDRAFT_09g026010 [Sorghum bicolor]
Length=339

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 13/106 (12%)
 Frame = -2

Query  668  RVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFD  489
            R P+L+ K+DD  SLGSSY S+S D  D               +  E+ +    C +C D
Sbjct  247  RRPLLAGKEDDGASLGSSYDSVSHDGSDDR-------------EPEERGEGGGGCVLCCD  293

Query  488  APRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            AP+DC FLPCGH  +C+ CG ++ E  G CP CRR++KKV++I+TV
Sbjct  294  APKDCFFLPCGHSATCYACGARVVEENGGCPFCRRKLKKVRRIFTV  339



>ref|XP_006654661.1| PREDICTED: uncharacterized protein LOC102709646 [Oryza brachyantha]
Length=370

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 7/112 (6%)
 Frame = -2

Query  680  TGSERVPMLS--DKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHL  507
             GS R P+LS   K++D+ SLGSSY S S D +  ++                  + RHL
Sbjct  264  AGSTRAPLLSPASKEEDSESLGSSYDSASHDGDGEDDDDVEEG-----GGRGGGGEGRHL  318

Query  506  CAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            C +C DA RDC FLPCGH  +C  CGT++AE  G+CP+CRR+++KV++I+TV
Sbjct  319  CVVCCDARRDCFFLPCGHSATCHSCGTRVAEEDGSCPLCRRKLRKVRRIFTV  370



>gb|EYU41896.1| hypothetical protein MIMGU_mgv1a012839mg [Erythranthe guttata]
Length=238

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 73/141 (52%), Gaps = 28/141 (20%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
            TY +G GG    + L     N+  RR  L +   ER  +LS +  D+ +           
Sbjct  126  TYLIGTGGITSLLLLMNYFSNHLRRRDPLGEIEPERNTLLSHEDGDSSAS----------  175

Query  593  DEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAE  414
                             + D ++   RH CAICF AP+DC FLPCGH ++CF+C T+I +
Sbjct  176  -----------------ISDDDEHRHRH-CAICFTAPKDCFFLPCGHSVACFQCATRIRK  217

Query  413  TAGTCPVCRRRMKKVKKIYTV  351
            ++  CP+CR+R +KVK+IYTV
Sbjct  218  SSAVCPICRQRTRKVKRIYTV  238



>ref|NP_195765.3| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAT71924.1| At5g01450 [Arabidopsis thaliana]
 gb|AAU94421.1| At5g01450 [Arabidopsis thaliana]
 dbj|BAF00891.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90346.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=444

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 13/129 (10%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLE--DTGSERVPMLSDKQDDNLSLGSSYCSLSQ  597
            Y + +G     + +   + N      + E  D   +  P++  K DDN S  SSY S+  
Sbjct  314  YIVCMGVVTALLLIVSSLFNKRQPVTEDETVDENDDVAPLIPGKDDDNSSWCSSYSSIL-  372

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
                    TS+  L+G        S  R+LCAIC+DAPRDC FL CGHC++CF+CGT+IA
Sbjct  373  --------TSTEELEGA--HGEGHSSTRYLCAICYDAPRDCFFLSCGHCVACFQCGTRIA  422

Query  416  ETAGTCPVC  390
            ET+G CPVC
Sbjct  423  ETSGFCPVC  431



>emb|CAB81928.1| putative protein [Arabidopsis thaliana]
Length=428

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 13/129 (10%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLE--DTGSERVPMLSDKQDDNLSLGSSYCSLSQ  597
            Y + +G     + +   + N      + E  D   +  P++  K DDN S  SSY S+  
Sbjct  298  YIVCMGVVTALLLIVSSLFNKRQPVTEDETVDENDDVAPLIPGKDDDNSSWCSSYSSIL-  356

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
                    TS+  L+G        S  R+LCAIC+DAPRDC FL CGHC++CF+CGT+IA
Sbjct  357  --------TSTEELEG--AHGEGHSSTRYLCAICYDAPRDCFFLSCGHCVACFQCGTRIA  406

Query  416  ETAGTCPVC  390
            ET+G CPVC
Sbjct  407  ETSGFCPVC  415



>ref|XP_010543205.1| PREDICTED: uncharacterized protein LOC104816193 [Tarenaya hassleriana]
Length=443

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 69/129 (53%), Gaps = 13/129 (10%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCSLSQ  597
            Y + IGG    + +   I        + E T    E  P++  K DD  S  SSY S+  
Sbjct  313  YIVCIGGVTALLVVLYSIFKKPQSNTEAEATAQNGETAPLVPGKDDDVSSWCSSYSSIM-  371

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
                    TS+  ++G   +    S  R+LCAICFDAPRDC FL CGH ++CF+CGT+IA
Sbjct  372  --------TSTEEIEGH--EGENNSGTRYLCAICFDAPRDCFFLSCGHSVACFQCGTRIA  421

Query  416  ETAGTCPVC  390
            E +G CPVC
Sbjct  422  EASGNCPVC  430



>ref|NP_001174492.1| Os05g0520700 [Oryza sativa Japonica Group]
 dbj|BAH93220.1| Os05g0520700 [Oryza sativa Japonica Group]
Length=709

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -2

Query  647  KQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXF  468
            K++D+ SLGSSY S+S D +  ++                  + RHLC +C DA RDC F
Sbjct  615  KEEDDASLGSSYDSVSHDGDGEDDDDDVEER----GGGGGGGEGRHLCVVCCDARRDCFF  670

Query  467  LPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            LPCGH  +C  CGT++AE  G+CP+CRR++KKV++I++V
Sbjct  671  LPCGHSATCHACGTRVAEEDGSCPLCRRKLKKVRRIFSV  709



>ref|XP_002870915.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47174.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 70/129 (54%), Gaps = 13/129 (10%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLE--DTGSERVPMLSDKQDDNLSLGSSYCSLSQ  597
            Y + +G     + +   + N      + E  D   +  P++  K DDN S  SSY S+  
Sbjct  314  YIVCMGVVTALLLIVSSLFNKRQPVTEEETVDENDDVAPLIPGKDDDNSSWCSSYSSIL-  372

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
                      +ST + +       S  R+LCAIC+DAPRDC FL CGHC++CF+CGT+IA
Sbjct  373  ----------TSTEELEGGHGEGHSSTRYLCAICYDAPRDCFFLSCGHCVACFQCGTRIA  422

Query  416  ETAGTCPVC  390
            ET+G CPVC
Sbjct  423  ETSGFCPVC  431



>ref|XP_009627915.1| PREDICTED: uncharacterized protein LOC104118390 isoform X1 [Nicotiana 
tomentosiformis]
Length=366

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 68/138 (49%), Gaps = 14/138 (10%)
 Frame = -2

Query  767  FLGIGGTCFFVF-LAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            ++GI G    +     + L      +  E+T   R+   +D    +  LGS+Y + ++D 
Sbjct  238  YVGILGVAVIIICFILKSLGACDDESYAEETSVTRIITETDPMLPHKDLGSTYGTYAEDA  297

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAET  411
                  +S    DGK            +C IC+D PR+C F+PCGHC +C EC  +I + 
Sbjct  298  NSGRSSSSEDLYDGK------------ICVICYDNPRNCFFVPCGHCATCQECAQRIMDV  345

Query  410  -AGTCPVCRRRMKKVKKI  360
             +  CPVCRR + KV+K+
Sbjct  346  ESKVCPVCRRPIHKVRKL  363



>ref|XP_009627916.1| PREDICTED: uncharacterized protein LOC104118390 isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 68/138 (49%), Gaps = 14/138 (10%)
 Frame = -2

Query  767  FLGIGGTCFFVF-LAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            ++GI G    +     + L      +  E+T   R+   +D    +  LGS+Y + ++D 
Sbjct  237  YVGILGVAVIIICFILKSLGACDDESYAEETSVTRIITETDPMLPHKDLGSTYGTYAEDA  296

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAET  411
                  +S    DGK            +C IC+D PR+C F+PCGHC +C EC  +I + 
Sbjct  297  NSGRSSSSEDLYDGK------------ICVICYDNPRNCFFVPCGHCATCQECAQRIMDV  344

Query  410  -AGTCPVCRRRMKKVKKI  360
             +  CPVCRR + KV+K+
Sbjct  345  ESKVCPVCRRPIHKVRKL  362



>ref|XP_001768110.1| predicted protein [Physcomitrella patens]
 gb|EDQ66983.1| predicted protein [Physcomitrella patens]
Length=484

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 70/147 (48%), Gaps = 27/147 (18%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSL--------GS  618
            T+FL  G     +F+   +     R  +L     E +P+L+ + D  +          G+
Sbjct  355  TFFLIWGTIALGLFI---LCGAEARGVRLWRNNQEELPLLAPQNDQAVPSAVTSYSPSGT  411

Query  617  SYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCF  438
            ++  L   DE  E P+S                  HLC IC DAP+DC F PCGH  +CF
Sbjct  412  AHPPLGSLDELGESPSSD----------------HHLCNICLDAPKDCFFDPCGHRCTCF  455

Query  437  ECGTKIAETAGTCPVCRRRMKKVKKIY  357
             CG +I   + TCP+CR+ ++ V+KI+
Sbjct  456  TCGQRIQGNSSTCPICRQPIRAVRKIF  482



>ref|XP_009627917.1| PREDICTED: uncharacterized protein LOC104118390 isoform X3 [Nicotiana 
tomentosiformis]
Length=364

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 68/137 (50%), Gaps = 14/137 (10%)
 Frame = -2

Query  767  FLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDE  588
            ++GI       F+ +  L      +  E+T   R+   +D    +  LGS+Y + ++D  
Sbjct  238  YVGILAVIIICFILKS-LGACDDESYAEETSVTRIITETDPMLPHKDLGSTYGTYAEDAN  296

Query  587  DAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAET-  411
                 +S    DGK            +C IC+D PR+C F+PCGHC +C EC  +I +  
Sbjct  297  SGRSSSSEDLYDGK------------ICVICYDNPRNCFFVPCGHCATCQECAQRIMDVE  344

Query  410  AGTCPVCRRRMKKVKKI  360
            +  CPVCRR + KV+K+
Sbjct  345  SKVCPVCRRPIHKVRKL  361



>ref|XP_010233161.1| PREDICTED: uncharacterized protein LOC104583123 [Brachypodium 
distachyon]
Length=447

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 64/119 (54%), Gaps = 20/119 (17%)
 Frame = -2

Query  704  HRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQ  525
             RR  L   GS        K+ +  SLGSSY S+S D  +  E   +   +G        
Sbjct  348  QRRTSLLAAGS--------KEGEEASLGSSYDSVSDDGGEDVEGGGNYDEEG--------  391

Query  524  SDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETA-GTCPVCRRRMKKVKKIYTV  351
               R LC +C DA +DC FLPCGH  +C  CGT++ E   G+CP CRR++KKV++I+ V
Sbjct  392  ---RRLCVVCCDARKDCFFLPCGHSATCHACGTRVLEEGDGSCPFCRRKLKKVRRIFAV  447



>ref|XP_004966864.1| PREDICTED: E3 ubiquitin-protein ligase mind-bomb-like [Setaria 
italica]
Length=144

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (49%), Gaps = 20/131 (15%)
 Frame = -2

Query  743  FFVFLAQRI--LNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPT  570
            F+ FL Q        H   + +D  +     +  +++   S G++           E+P 
Sbjct  28   FYCFLKQLADDAGTEHEPIRRQDATARETEPILPRKEVFFSYGAT----------GEQPE  77

Query  569  SSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPV  393
            SS       V  +E SD   +C IC+DAPR C F+PCGHC +CF C  +I E     CP+
Sbjct  78   SS-------VCPAEDSDSDKMCKICYDAPRSCFFIPCGHCFTCFTCARRIVEEENKACPI  130

Query  392  CRRRMKKVKKI  360
            CRR + +VK++
Sbjct  131  CRRLIHRVKRV  141



>ref|XP_010530429.1| PREDICTED: uncharacterized protein LOC104807018 [Tarenaya hassleriana]
Length=483

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 57/90 (63%), Gaps = 8/90 (9%)
 Frame = -2

Query  686  EDTGSERVPMLSDKQDDNL-SLGSSYCSLSQD-DEDAEEPTSSSTLDGKPVKDSEQSDMR  513
            ++    R  +LS+K DD   S  SSY S+S D D D EE  +   ++G+    S   + R
Sbjct  365  QEESQRREALLSNKDDDGGGSTCSSYESISNDEDADLEELLA---MEGET---SSGGNTR  418

Query  512  HLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
             LCAICFDAPRDC FLPCGHC+SCF CGT+
Sbjct  419  RLCAICFDAPRDCFFLPCGHCVSCFHCGTR  448



>gb|EMT21657.1| E3 ubiquitin-protein ligase NEURL1B [Aegilops tauschii]
Length=362

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = -2

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDM---RHLCAICFDAPRDCXFLPCGHCLSCF  438
            SL +  E+ E  +  S+ +     D E  D    R LC +C DA RDC F+PCGH  +C 
Sbjct  273  SLLECKEEEEGGSRGSSFESVSSHDGEAGDEEEGRRLCVVCCDARRDCFFMPCGHSATCH  332

Query  437  ECGTKIAET-AGTCPVCRRRMKKVKKIYTV  351
             CGTKI E  A  CP CRR++KKV++I+ V
Sbjct  333  ACGTKIVEGDASCCPFCRRKLKKVRRIFCV  362



>ref|XP_002510132.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF52319.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=224

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 17/108 (16%)
 Frame = -2

Query  674  SERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAIC  495
            SE  P+L +K     S+  +Y     +DED +E       DG      +  D + LC IC
Sbjct  132  SETQPILPEK-----SIRYTY---GTNDEDNDE-------DGSSSSSEDLYDAK-LCVIC  175

Query  494  FDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            +D  R+C F+PCGHC +CF+C  +I E  G  CP+CRR + +V+K++T
Sbjct  176  YDEQRNCFFVPCGHCATCFDCAQRIIEGEGKMCPICRRLIHRVRKLFT  223



>ref|XP_006472255.1| PREDICTED: uncharacterized protein LOC102612248 [Citrus sinensis]
Length=334

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 71/140 (51%), Gaps = 10/140 (7%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            Y   +G     +FL  + L      +   D+ + R    +D       +  +Y + + D+
Sbjct  203  YIAILGFITLIIFLVSKYLGACDGNSDNTDSTAAREVTETDPLVPEKPVQCTYGTTNNDE  262

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA-E  414
            +D    +S+S+ D    K         LC IC+D  R+C F+PCGHC +C++CG +I  +
Sbjct  263  DDDAGSSSTSSEDLYDAK---------LCVICYDDQRNCFFVPCGHCATCYDCGQRIMKD  313

Query  413  TAGTCPVCRRRMKKVKKIYT  354
             +  CP+CRR + KV++++T
Sbjct  314  DSKVCPICRRLIHKVRRLFT  333



>ref|XP_006469474.1| PREDICTED: uncharacterized protein LOC102622120 [Citrus sinensis]
Length=376

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 71/140 (51%), Gaps = 10/140 (7%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            Y   +G     +FL  + L      +   D+ + R    +D       +  +Y + + D+
Sbjct  245  YIAILGFITLIIFLVSKYLGACDGNSDNTDSTAAREVTETDPLVPEKPVQCTYGTTNNDE  304

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA-E  414
            +D    +S+S+ D    K         LC IC+D  R+C F+PCGHC +C++CG +I  +
Sbjct  305  DDDAGSSSTSSEDLYDAK---------LCVICYDDQRNCFFVPCGHCATCYDCGQRIMKD  355

Query  413  TAGTCPVCRRRMKKVKKIYT  354
             +  CP+CRR + KV++++T
Sbjct  356  DSKVCPICRRLIHKVRRLFT  375



>ref|XP_002283899.1| PREDICTED: baculoviral IAP repeat-containing protein 7-A [Vitis 
vinifera]
Length=170

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 68/143 (48%), Gaps = 23/143 (16%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRA---QLEDTGSERVPMLSDKQDDNLSLGSSYCSLS  600
            Y   +G    F+FL  +   +        + E   +E  P+L  K+     +  +Y +  
Sbjct  42   YVSTLGLLVIFIFLILKYFGDFGSETTTFEEEVRETETNPLLPSKR-----VPFTYGACE  96

Query  599  QDDEDAEEPTSSS--TLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
            +D E  E    SS    DGK            +C ICFD PR+C F+PCGHC +C+ C  
Sbjct  97   EDLESGEGNGGSSQDLYDGK------------ICVICFDEPRNCFFVPCGHCATCYVCAQ  144

Query  425  KIAET-AGTCPVCRRRMKKVKKI  360
            +IA+     CPVCRR ++KV+K 
Sbjct  145  RIAKGDNSVCPVCRRFIRKVRKF  167



>ref|XP_010664531.1| PREDICTED: uncharacterized protein LOC100248821 isoform X2 [Vitis 
vinifera]
Length=343

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (47%), Gaps = 23/147 (16%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRIL------NNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY   +G     +FL  + L      N  H         +E  P++ +K    L+ G+  
Sbjct  212  TYVSILGFVVIIIFLVLKYLGACEGDNEVHVEEITPREVTETHPLMPEKLF-RLTYGTG-  269

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
                  +EDAE         G     SE      +C IC+D PR+C F+PCGHC +C++C
Sbjct  270  ------EEDAE--------SGMSSSSSEDLYDGKICTICYDEPRNCFFVPCGHCATCYDC  315

Query  431  GTKIAETAG-TCPVCRRRMKKVKKIYT  354
              +I E     CP+CRR + KV+K++T
Sbjct  316  AKRIIEGENKVCPICRRFIHKVRKLFT  342



>emb|CBI33738.3| unnamed protein product [Vitis vinifera]
Length=192

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 68/143 (48%), Gaps = 23/143 (16%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRA---QLEDTGSERVPMLSDKQDDNLSLGSSYCSLS  600
            Y   +G    F+FL  +   +        + E   +E  P+L  K+     +  +Y +  
Sbjct  64   YVSTLGLLVIFIFLILKYFGDFGSETTTFEEEVRETETNPLLPSKR-----VPFTYGACE  118

Query  599  QDDEDAEEPTSSS--TLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGT  426
            +D E  E    SS    DGK            +C ICFD PR+C F+PCGHC +C+ C  
Sbjct  119  EDLESGEGNGGSSQDLYDGK------------ICVICFDEPRNCFFVPCGHCATCYVCAQ  166

Query  425  KIAET-AGTCPVCRRRMKKVKKI  360
            +IA+     CPVCRR ++KV+K 
Sbjct  167  RIAKGDNSVCPVCRRFIRKVRKF  189



>ref|XP_002283216.2| PREDICTED: uncharacterized protein LOC100248821 isoform X1 [Vitis 
vinifera]
 emb|CBI19441.3| unnamed protein product [Vitis vinifera]
Length=388

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (47%), Gaps = 23/147 (16%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRIL------NNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSY  612
            TY   +G     +FL  + L      N  H         +E  P++ +K    L+ G+  
Sbjct  257  TYVSILGFVVIIIFLVLKYLGACEGDNEVHVEEITPREVTETHPLMPEKLF-RLTYGTG-  314

Query  611  CSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFEC  432
                  +EDAE         G     SE      +C IC+D PR+C F+PCGHC +C++C
Sbjct  315  ------EEDAE--------SGMSSSSSEDLYDGKICTICYDEPRNCFFVPCGHCATCYDC  360

Query  431  GTKIAETAG-TCPVCRRRMKKVKKIYT  354
              +I E     CP+CRR + KV+K++T
Sbjct  361  AKRIIEGENKVCPICRRFIHKVRKLFT  387



>ref|XP_008220290.1| PREDICTED: uncharacterized protein LOC103320390 isoform X2 [Prunus 
mume]
Length=343

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 75/145 (52%), Gaps = 21/145 (14%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRIL-----NNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            TY   +G     +FL  + L      +     ++E+  +E  P++  K     ++  +Y 
Sbjct  212  TYIAILGFIVVTIFLILKYLGACDGESSTLAERVEEEVNETYPIVPQK-----NIRRTYG  266

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
            +   ++ED E+P +SS+        SE+     LC IC+D  R+  F+PCGHC +C++C 
Sbjct  267  T---NEEDEEDPGASSS-------SSEELYDEKLCIICYDEQRNSFFVPCGHCATCYDCA  316

Query  428  TKIAETAG-TCPVCRRRMKKVKKIY  357
             +I +     CP+CRR + KVKK++
Sbjct  317  QRIMDGENKVCPICRRLIHKVKKLF  341



>ref|XP_006413462.1| hypothetical protein EUTSA_v10027110mg [Eutrema salsugineum]
 gb|ESQ54915.1| hypothetical protein EUTSA_v10027110mg [Eutrema salsugineum]
Length=154

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 69/138 (50%), Gaps = 14/138 (10%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            Y   +G   F +FL  + L+            +ER+P+++  +++ ++L +   +     
Sbjct  26   YITFLGTIMFIIFLILKFLSECDMEGD-----TERLPVVA--REEEVTLWTPLVN-----  73

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-AE  414
             ++ E TS   +       S+  D   LC ICF+  R+C F+PCGH  +C  C  KI +E
Sbjct  74   -ESSEVTSKGDVQTASFSSSDDVDYSTLCVICFEERRNCFFVPCGHSATCRGCAQKILSE  132

Query  413  TAGTCPVCRRRMKKVKKI  360
                CP+CRR ++K K++
Sbjct  133  ENKVCPICRRVIRKSKRL  150



>gb|EYU44457.1| hypothetical protein MIMGU_mgv1a015305mg [Erythranthe guttata]
Length=161

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (52%), Gaps = 6/133 (5%)
 Frame = -2

Query  743  FFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSS  564
              + L  ++L N +      +  +E   +LS K ++  SL SSY +  +D E      ++
Sbjct  29   MIIALIVKLLWNWNEDGGYGEEATESSGLLSYKDEE--SLYSSYGTSEEDLESCNNNINN  86

Query  563  STLDGKPVKDSEQSDMRH---LCAICFDAPRDCXFLPCGHCLSCFECGTK-IAETAGTCP  396
            ++        S   D  +   +CAIC+D  R C F+PCGHC++C+ C  + I+E   TCP
Sbjct  87   NSKGSCSSSYSSSGDDLYDGTICAICYDEQRSCFFVPCGHCITCYTCANRIISEEIKTCP  146

Query  395  VCRRRMKKVKKIY  357
            +CR  + K+ K++
Sbjct  147  ICRTSIIKIMKLH  159



>ref|XP_006374856.1| hypothetical protein POPTR_0014s02100g [Populus trichocarpa]
 gb|ERP52653.1| hypothetical protein POPTR_0014s02100g [Populus trichocarpa]
Length=386

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 71/149 (48%), Gaps = 27/149 (18%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILN--NXHRRAQLEDTG-------SERVPMLSDKQDDNLSLGS  618
            Y   +G     +FL  + L   +  +   L +T        SE  P++  K     S+  
Sbjct  254  YVAILGAIVIIIFLILKYLGACDTDQSTNLVETATWQASEPSETEPIMPAK-----SVRL  308

Query  617  SYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCF  438
            +Y +  +DDE +   +S    D K            LC IC+D  R+C F+PCGHC +C+
Sbjct  309  TYGTNEEDDEGSSCSSSEDLYDAK------------LCVICYDDQRNCFFVPCGHCATCY  356

Query  437  ECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            +C  +I E     CP+CRR + KV++++T
Sbjct  357  DCAQRIMEEDNKMCPICRRLIHKVRRLFT  385



>ref|XP_008220289.1| PREDICTED: uncharacterized protein LOC103320390 isoform X1 [Prunus 
mume]
Length=391

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 75/145 (52%), Gaps = 21/145 (14%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRIL-----NNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYC  609
            TY   +G     +FL  + L      +     ++E+  +E  P++  K     ++  +Y 
Sbjct  260  TYIAILGFIVVTIFLILKYLGACDGESSTLAERVEEEVNETYPIVPQK-----NIRRTYG  314

Query  608  SLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECG  429
            +   ++ED E+P +SS+        SE+     LC IC+D  R+  F+PCGHC +C++C 
Sbjct  315  T---NEEDEEDPGASSS-------SSEELYDEKLCIICYDEQRNSFFVPCGHCATCYDCA  364

Query  428  TKIAETAG-TCPVCRRRMKKVKKIY  357
             +I +     CP+CRR + KVKK++
Sbjct  365  QRIMDGENKVCPICRRLIHKVKKLF  389



>ref|XP_011029097.1| PREDICTED: uncharacterized protein LOC105128928 isoform X2 [Populus 
euphratica]
Length=344

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (46%), Gaps = 26/148 (18%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRIL--------NNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSS  615
            Y   +G     +FL  + L        N      +     SE  P++  K     S+  +
Sbjct  213  YVAILGAIVIIIFLILKYLGACDTESTNLVETATRQASETSETEPIMPAK-----SVRLT  267

Query  614  YCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
            Y +  +DDE +   +S    D K            LC IC+D  R+C F+PCGHC +C++
Sbjct  268  YGTNEEDDEGSSCSSSEDLYDAK------------LCVICYDDQRNCFFVPCGHCATCYD  315

Query  434  CGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            C  +I E     CP+CRR + KV++++T
Sbjct  316  CAQRIMEEDNKMCPICRRIIHKVRRLFT  343



>ref|XP_011029089.1| PREDICTED: uncharacterized protein LOC105128928 isoform X1 [Populus 
euphratica]
Length=390

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (46%), Gaps = 26/148 (18%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRIL--------NNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSS  615
            Y   +G     +FL  + L        N      +     SE  P++  K     S+  +
Sbjct  259  YVAILGAIVIIIFLILKYLGACDTESTNLVETATRQASETSETEPIMPAK-----SVRLT  313

Query  614  YCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
            Y +  +DDE +   +S    D K            LC IC+D  R+C F+PCGHC +C++
Sbjct  314  YGTNEEDDEGSSCSSSEDLYDAK------------LCVICYDDQRNCFFVPCGHCATCYD  361

Query  434  CGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            C  +I E     CP+CRR + KV++++T
Sbjct  362  CAQRIMEEDNKMCPICRRIIHKVRRLFT  389



>gb|KDO81585.1| hypothetical protein CISIN_1g036765mg [Citrus sinensis]
Length=350

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 70/140 (50%), Gaps = 10/140 (7%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            Y   +G     +FL  + L      +   D+ + R    +D       +  +Y + + D+
Sbjct  219  YIAILGFITLIIFLVSKYLGACDGNSDNTDSTAAREVTETDPLVHEKPVQFTYGTTNNDE  278

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA-E  414
            +D    +S+S+ D    K         LC IC+D  R+C F+PCGHC +C++CG +I  +
Sbjct  279  DDDAGFSSTSSDDLYDAK---------LCVICYDDQRNCFFVPCGHCATCYDCGQRIMKD  329

Query  413  TAGTCPVCRRRMKKVKKIYT  354
             +  CP+CR  + KV++++T
Sbjct  330  DSKVCPICRTLIHKVRRLFT  349



>ref|XP_009137784.1| PREDICTED: RNA-binding protein MEX3B [Brassica rapa]
Length=162

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 65/139 (47%), Gaps = 15/139 (11%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
             Y   +G   F +FL  + L++      +ED  +ER+P+++         G      +  
Sbjct  34   VYITFLGTIMFLIFLILKFLSD----CDMED-DTERLPVVA---------GEEVTGWTPL  79

Query  593  DEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-A  417
              +  E T    L+      +E  D    C ICF+  R+C F+PCGH  +C  C  KI +
Sbjct  80   VNETSEVTGKGDLETASFSSAEDVDYSTYCVICFEERRNCFFVPCGHSATCRGCAEKIMS  139

Query  416  ETAGTCPVCRRRMKKVKKI  360
            E    CP+CRR ++K K++
Sbjct  140  EENKVCPICRRVIRKSKRL  158



>gb|KJB29438.1| hypothetical protein B456_005G100500 [Gossypium raimondii]
Length=269

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 67/112 (60%), Gaps = 13/112 (12%)
 Frame = -2

Query  686  EDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHL  507
            E + +E  P+L +K     S+  +Y + ++DD D  E T SS+   + + D++      L
Sbjct  169  EISWTETDPILLEK-----SVRLTYGTTAEDDNDDAE-TGSSSSSSEDLYDAK------L  216

Query  506  CAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            C IC+D  R+C F+PCGHC +C++C  +I E     CP+CRR + KV+++++
Sbjct  217  CVICYDDQRNCFFVPCGHCATCYDCAQRIMEEDNKVCPICRRLIHKVRRLFS  268



>gb|KJB29433.1| hypothetical protein B456_005G100500 [Gossypium raimondii]
Length=292

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 67/112 (60%), Gaps = 13/112 (12%)
 Frame = -2

Query  686  EDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHL  507
            E + +E  P+L +K     S+  +Y + ++DD D  E T SS+   + + D++      L
Sbjct  192  EISWTETDPILLEK-----SVRLTYGTTAEDDNDDAE-TGSSSSSSEDLYDAK------L  239

Query  506  CAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            C IC+D  R+C F+PCGHC +C++C  +I E     CP+CRR + KV+++++
Sbjct  240  CVICYDDQRNCFFVPCGHCATCYDCAQRIMEEDNKVCPICRRLIHKVRRLFS  291



>ref|XP_002960269.1| hypothetical protein SELMODRAFT_74018, partial [Selaginella moellendorffii]
 gb|EFJ37808.1| hypothetical protein SELMODRAFT_74018, partial [Selaginella moellendorffii]
Length=81

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -2

Query  560  TLDGKPVKDSEQSDM-RHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-AETAGTCPVCR  387
            ++D +P + S  S     LCAIC DAP+D  F PCGHC +C+ CG +I A     CP+CR
Sbjct  10   SVDHRPAEGSHSSPGDEQLCAICLDAPKDSFFDPCGHCATCYACGERIKASGNAICPICR  69

Query  386  RRMKKVKKIYT  354
              ++ V++++ 
Sbjct  70   ENIRTVRRLFV  80



>ref|XP_010448595.1| PREDICTED: uncharacterized protein LOC104731038 [Camelina sativa]
Length=170

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 17/138 (12%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            Y   +G     VFL  + L+       +ED G E +P+++ +++  +   S         
Sbjct  44   YITVLGTIMTIVFLILKFLSE----CDMEDNGMESLPVVAVEEEVPIWTPSEV----TGK  95

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-AE  414
             D E  + SS+ D          D   LC ICF+  R+C F+PCGH  +C  C  KI +E
Sbjct  96   GDVENASFSSSDDN--------VDYSTLCVICFEERRNCFFVPCGHSATCRGCAQKILSE  147

Query  413  TAGTCPVCRRRMKKVKKI  360
             +  CP+CRR ++K K++
Sbjct  148  ESKVCPICRRVIRKAKRL  165



>ref|XP_006433589.1| hypothetical protein CICLE_v10003482mg [Citrus clementina]
 gb|ESR46829.1| hypothetical protein CICLE_v10003482mg [Citrus clementina]
Length=391

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 70/140 (50%), Gaps = 10/140 (7%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            Y   +G     +FL  + L      +   D+ + R    +D       +  +Y + + D+
Sbjct  260  YIAILGFITLIIFLVSKYLGACDGNSDNTDSTAAREVTETDPLVHEKPVQFTYGTTNNDE  319

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA-E  414
            +D    +S+S+ D    K         LC IC+D  R+C F+PCGHC +C++CG +I  +
Sbjct  320  DDDAGFSSTSSDDLYDAK---------LCVICYDDQRNCFFVPCGHCATCYDCGQRIMKD  370

Query  413  TAGTCPVCRRRMKKVKKIYT  354
             +  CP+CR  + KV++++T
Sbjct  371  DSKVCPICRTLIHKVRRLFT  390



>emb|CDY34265.1| BnaA01g13680D [Brassica napus]
Length=162

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 65/139 (47%), Gaps = 15/139 (11%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
             Y   +G   F +FL  + L++      +ED   ER+P+++         G      +  
Sbjct  34   VYITFLGTIMFLIFLILKFLSD----CDMED-DMERLPVVT---------GEEVTGWTPL  79

Query  593  DEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-A  417
              +  E T    L+      ++  D   LC ICF+  R+C F+PCGH  +C  C  KI +
Sbjct  80   VNETSEVTGKGDLERASFSSADDVDYSTLCVICFEERRNCFFVPCGHSATCRGCAEKIMS  139

Query  416  ETAGTCPVCRRRMKKVKKI  360
            E    CP+CRR ++K K++
Sbjct  140  EENKVCPICRRVIRKAKRL  158



>gb|KJB29431.1| hypothetical protein B456_005G100500 [Gossypium raimondii]
Length=397

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 67/112 (60%), Gaps = 13/112 (12%)
 Frame = -2

Query  686  EDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHL  507
            E + +E  P+L +K     S+  +Y + ++DD D  E T SS+   + + D++      L
Sbjct  297  EISWTETDPILLEK-----SVRLTYGTTAEDDNDDAE-TGSSSSSSEDLYDAK------L  344

Query  506  CAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            C IC+D  R+C F+PCGHC +C++C  +I E     CP+CRR + KV+++++
Sbjct  345  CVICYDDQRNCFFVPCGHCATCYDCAQRIMEEDNKVCPICRRLIHKVRRLFS  396



>gb|KJB29430.1| hypothetical protein B456_005G100500 [Gossypium raimondii]
Length=349

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 67/112 (60%), Gaps = 13/112 (12%)
 Frame = -2

Query  686  EDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHL  507
            E + +E  P+L +K     S+  +Y + ++DD D  E T SS+   + + D++      L
Sbjct  249  EISWTETDPILLEK-----SVRLTYGTTAEDDNDDAE-TGSSSSSSEDLYDAK------L  296

Query  506  CAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            C IC+D  R+C F+PCGHC +C++C  +I E     CP+CRR + KV+++++
Sbjct  297  CVICYDDQRNCFFVPCGHCATCYDCAQRIMEEDNKVCPICRRLIHKVRRLFS  348



>gb|KJB29434.1| hypothetical protein B456_005G100500 [Gossypium raimondii]
Length=349

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 67/112 (60%), Gaps = 13/112 (12%)
 Frame = -2

Query  686  EDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHL  507
            E + +E  P+L +K     S+  +Y + ++DD D  E T SS+   + + D++      L
Sbjct  249  EISWTETDPILLEK-----SVRLTYGTTAEDDNDDAE-TGSSSSSSEDLYDAK------L  296

Query  506  CAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            C IC+D  R+C F+PCGHC +C++C  +I E     CP+CRR + KV+++++
Sbjct  297  CVICYDDQRNCFFVPCGHCATCYDCAQRIMEEDNKVCPICRRLIHKVRRLFS  348



>ref|XP_007225736.1| hypothetical protein PRUPE_ppa010006mg [Prunus persica]
 gb|EMJ26935.1| hypothetical protein PRUPE_ppa010006mg [Prunus persica]
Length=268

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = -2

Query  596  DDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIA  417
            ++ED E+P +SS+        SE+     LC IC+D  R+  F+PCGHC +C++C  +I 
Sbjct  193  NEEDEEDPGASSS-------SSEELYDEKLCIICYDEQRNSFFVPCGHCATCYDCAQRIM  245

Query  416  ETAG-TCPVCRRRMKKVKKIY  357
            +     CP+CRR + KV+K++
Sbjct  246  DGENKVCPICRRLIHKVRKLF  266



>emb|CDY03476.1| BnaC01g16060D [Brassica napus]
Length=162

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 65/139 (47%), Gaps = 15/139 (11%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
             Y   +G   F +FL  + L++      +ED   ER+P+++         G      +  
Sbjct  34   VYITFLGTIMFLIFLILKFLSD----CDMED-DMERLPVVA---------GEEVTGWTPL  79

Query  593  DEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-A  417
              +  E T    L+      ++  D   LC ICF+  R+C F+PCGH  +C  C  KI +
Sbjct  80   VNETLEVTGKGDLERASFSSADDVDYSTLCVICFEERRNCFFVPCGHSATCRGCAEKIMS  139

Query  416  ETAGTCPVCRRRMKKVKKI  360
            E    CP+CRR ++K K++
Sbjct  140  EENKVCPICRRVIRKAKRL  158



>ref|XP_009372465.1| PREDICTED: RNA-binding protein MEX3B-like isoform X3 [Pyrus x 
bretschneideri]
 ref|XP_009346710.1| PREDICTED: RNA-binding protein MEX3B-like isoform X3 [Pyrus x 
bretschneideri]
Length=145

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 16/145 (11%)
 Frame = -2

Query  758  IGGTC---FFVFLAQRILN--NXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCSLS  600
            I  TC     V +A  IL   N +    +ED G  +E  P+    Q    ++ S+Y +  
Sbjct  4    INHTCNAALLVIVAFMILKYINEYEETSVEDVGDNAETDPL----QPAGKTMPSTYGTCD  59

Query  599  QDDEDAEEPTSSSTLDGKPVKDSEQSDMR--HLCAICFDAPRDCXFLPCGHCLSCFECGT  426
            + D ++   +SSS+     V  S   D+    +C IC+   RDC  +PCGHC +C++C  
Sbjct  60   EWDIESGNCSSSSSNSSNAVITSSSEDLHDGKICVICYTEQRDCFLVPCGHCATCYDCAQ  119

Query  425  KI--AETAGTCPVCRRRMKKVKKIY  357
            +I   ET  TCP+CRR ++KV++++
Sbjct  120  RIFYGETK-TCPICRRFIRKVRRLF  143



>gb|KJB17986.1| hypothetical protein B456_003G027700 [Gossypium raimondii]
Length=174

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIA-ETAGTCPVCRRRMKKVKKIY  357
            +C IC+D  R+C F+PCGHC +C+EC  +I  E    CPVCRR + KV+K++
Sbjct  121  ICVICYDEQRNCFFVPCGHCATCYECALRIYDEENKVCPVCRRIIGKVRKLF  172



>ref|XP_009372463.1| PREDICTED: RNA-binding protein MEX3B-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009346708.1| PREDICTED: RNA-binding protein MEX3B-like isoform X1 [Pyrus x 
bretschneideri]
Length=188

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 74/142 (52%), Gaps = 13/142 (9%)
 Frame = -2

Query  758  IGGTCFFVFLAQRILN--NXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            I      V +A  IL   N +    +ED G  +E  P+    Q    ++ S+Y +  + D
Sbjct  50   IAILTLLVIVAFMILKYINEYEETSVEDVGDNAETDPL----QPAGKTMPSTYGTCDEWD  105

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMR--HLCAICFDAPRDCXFLPCGHCLSCFECGTKI-  420
             ++   +SSS+     V  S   D+    +C IC+   RDC  +PCGHC +C++C  +I 
Sbjct  106  IESGNCSSSSSNSSNAVITSSSEDLHDGKICVICYTEQRDCFLVPCGHCATCYDCAQRIF  165

Query  419  -AETAGTCPVCRRRMKKVKKIY  357
              ET  TCP+CRR ++KV++++
Sbjct  166  YGETK-TCPICRRFIRKVRRLF  186



>ref|XP_009372464.1| PREDICTED: RNA-binding protein MEX3B-like isoform X2 [Pyrus x 
bretschneideri]
 ref|XP_009346709.1| PREDICTED: RNA-binding protein MEX3B-like isoform X2 [Pyrus x 
bretschneideri]
Length=179

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 16/145 (11%)
 Frame = -2

Query  758  IGGTC---FFVFLAQRILN--NXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCSLS  600
            I  TC     V +A  IL   N +    +ED G  +E  P+    Q    ++ S+Y +  
Sbjct  38   INHTCNAALLVIVAFMILKYINEYEETSVEDVGDNAETDPL----QPAGKTMPSTYGTCD  93

Query  599  QDDEDAEEPTSSSTLDGKPVKDSEQSDMR--HLCAICFDAPRDCXFLPCGHCLSCFECGT  426
            + D ++   +SSS+     V  S   D+    +C IC+   RDC  +PCGHC +C++C  
Sbjct  94   EWDIESGNCSSSSSNSSNAVITSSSEDLHDGKICVICYTEQRDCFLVPCGHCATCYDCAQ  153

Query  425  KI--AETAGTCPVCRRRMKKVKKIY  357
            +I   ET  TCP+CRR ++KV++++
Sbjct  154  RIFYGETK-TCPICRRFIRKVRRLF  177



>ref|XP_009336090.1| PREDICTED: RNA-binding protein MEX3B-like [Pyrus x bretschneideri]
 ref|XP_009336092.1| PREDICTED: RNA-binding protein MEX3B-like [Pyrus x bretschneideri]
Length=179

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 16/145 (11%)
 Frame = -2

Query  758  IGGTC---FFVFLAQRILN--NXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCSLS  600
            I  TC     V +A  IL   N +    +ED G  +E  P+    Q    ++ S+Y +  
Sbjct  38   INHTCNAALLVIVAFMILKYINEYEETSVEDVGDSAETDPL----QPAGKTMPSTYGTCD  93

Query  599  QDDEDAEEPTSSSTLDGKPVKDSEQSDMR--HLCAICFDAPRDCXFLPCGHCLSCFECGT  426
            + D ++   +SSS+     V  S   D+    +C IC+   RDC  +PCGHC +C++C  
Sbjct  94   EWDIESGNCSSSSSNSSNAVITSSSEDLHDGKICVICYTEQRDCFLVPCGHCATCYDCAQ  153

Query  425  KI--AETAGTCPVCRRRMKKVKKIY  357
            +I   ET  TCP+CRR ++KV++++
Sbjct  154  RIFYGETK-TCPICRRFIRKVRRLF  177



>ref|XP_010439071.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like 
[Camelina sativa]
Length=170

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 17/138 (12%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            Y   +G     VFL  + L+       +ED G E +P+++ +++  +   S         
Sbjct  44   YITVLGTIMTIVFLILKFLSE----CDMEDDGMESLPVVARQEEVPICTPSEV----TGK  95

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-AE  414
             D E  + SS+ D          D   LC ICF+  R+C F+PCGH  +C  C  KI +E
Sbjct  96   GDVETASFSSSDDN--------VDYSTLCVICFEERRNCFFVPCGHSATCRGCAQKILSE  147

Query  413  TAGTCPVCRRRMKKVKKI  360
             +  CP+CRR ++K K++
Sbjct  148  ESKVCPICRRVIRKSKRL  165



>gb|KDP41659.1| hypothetical protein JCGZ_16066 [Jatropha curcas]
Length=391

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            LC IC+D  R+C F+PCGHC +C++C  +I E     CP+CRR + KV++++T
Sbjct  338  LCVICYDEQRNCFFVPCGHCATCYDCAQRIMEGENKICPICRRLINKVRRLFT  390



>ref|XP_004499030.1| PREDICTED: uncharacterized protein LOC101496542 [Cicer arietinum]
Length=415

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKIY  357
            LC IC+D  R+C F+PCGHC +C++C  +I    +  CPVCRR + KV+K+Y
Sbjct  362  LCVICYDEQRNCFFVPCGHCATCYDCAQRIVVGESKVCPVCRRLIHKVRKLY  413



>ref|XP_010028145.1| PREDICTED: baculoviral IAP repeat-containing protein 7-B-like 
[Eucalyptus grandis]
 ref|XP_010028147.1| PREDICTED: baculoviral IAP repeat-containing protein 7-B-like 
[Eucalyptus grandis]
 gb|KCW54800.1| hypothetical protein EUGRSUZ_I00739 [Eucalyptus grandis]
Length=151

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            +C IC+D  R+C F+PCGHC +C++C  +I +  G  CPVCRR ++KV+K ++
Sbjct  98   ICVICYDEERNCFFVPCGHCATCYDCAQRIFDGEGKACPVCRRPIRKVRKWFS  150



>ref|XP_010433802.1| PREDICTED: RNA-binding E3 ubiquitin-protein ligase MEX3C-like 
[Camelina sativa]
Length=170

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 17/138 (12%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            Y   +G     VFL  + L+       +ED G E +P+++ +++  +   S         
Sbjct  44   YITVLGTIMTTVFLILKFLSE----CDMEDDGMESLPVVAGQEEVPICTPSEV----TGK  95

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-AE  414
             D E  + SS+ D          D   LC ICF+  R+C F+PCGH  +C  C  KI +E
Sbjct  96   GDVESASFSSSDDN--------VDYSTLCVICFEERRNCFFVPCGHSATCRGCAQKILSE  147

Query  413  TAGTCPVCRRRMKKVKKI  360
             +  CP+CRR ++K K++
Sbjct  148  ESKVCPICRRVIRKSKRL  165



>ref|XP_001772864.1| predicted protein [Physcomitrella patens]
 gb|EDQ62266.1| predicted protein [Physcomitrella patens]
Length=524

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 62/137 (45%), Gaps = 16/137 (12%)
 Frame = -2

Query  767  FLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDE  588
            ++   G      L  R     H R+Q+     E  P + +      +  S+Y  L  D+ 
Sbjct  402  YIFFWGLVAVGLLFTRAFELRHVRSQVP-LSQEHAPTVPEDASHYPAQASAYSLLQADET  460

Query  587  DAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETA  408
            ++E+ +                  RH C IC DAP+D  F PCGH  +C+ CG +I   +
Sbjct  461  NSEKASVHEN--------------RH-CTICLDAPKDSFFDPCGHRCTCYSCGMRIRGDS  505

Query  407  GTCPVCRRRMKKVKKIY  357
              CP+CR+ ++ V++IY
Sbjct  506  NRCPICRQTIRTVRRIY  522



>ref|XP_002438171.1| hypothetical protein SORBIDRAFT_10g009080 [Sorghum bicolor]
 gb|EER89538.1| hypothetical protein SORBIDRAFT_10g009080 [Sorghum bicolor]
Length=182

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (49%), Gaps = 5/109 (5%)
 Frame = -2

Query  683  DTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLC  504
            D   +  P+   + +    L       S    +  +P  S++    P +D     M   C
Sbjct  75   DAAEQEEPIRRRQDETEPILPRKEVFFSYGATEEHQPECSASCPA-PAEDPLSEKM---C  130

Query  503  AICFDAPRDCXFLPCGHCLSCFECGTKIA-ETAGTCPVCRRRMKKVKKI  360
             IC+D+PR C  +PCGHC +CF C  +I  E +  CP+CRR + +V+++
Sbjct  131  RICYDSPRSCFLIPCGHCFTCFTCARRIVEEESKACPICRRLIHRVRRL  179



>ref|XP_002967442.1| hypothetical protein SELMODRAFT_87199, partial [Selaginella moellendorffii]
 gb|EFJ32041.1| hypothetical protein SELMODRAFT_87199, partial [Selaginella moellendorffii]
Length=81

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKI-AETAGTCPVCRRRMKKVKKIYT  354
            LCAIC DAP+D  F PCGHC +C+ CG +I A     CP+CR  ++ V++++ 
Sbjct  28   LCAICLDAPKDSFFDPCGHCATCYACGERIKASGNAICPICRENIRTVRRLFV  80



>ref|XP_007047432.1| RING finger protein B, putative [Theobroma cacao]
 gb|EOX91589.1| RING finger protein B, putative [Theobroma cacao]
Length=172

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 57/110 (52%), Gaps = 18/110 (16%)
 Frame = -2

Query  680  TGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCA  501
            T SE  P+ S+K     ++  +Y +  +D E     +     DG+            +C 
Sbjct  79   TESETNPLCSEK-----AMPLTYGTCEEDVETGSCSSGEDLYDGR------------ICV  121

Query  500  ICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            IC+D  R+C F+PCGHC +C++C  +I +     CPVCRR + KV+K++ 
Sbjct  122  ICYDEQRNCFFVPCGHCATCYDCAQRIYDGDNKVCPVCRRVIGKVRKLFA  171



>ref|XP_010495684.1| PREDICTED: uncharacterized protein LOC104772813 [Camelina sativa]
Length=87

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -2

Query  524  SDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTK  423
            +  R LCAICF+APR+C F PCGHC+SC+ECGTK
Sbjct  54   NQTRRLCAICFNAPRECIFFPCGHCVSCYECGTK  87



>dbj|BAD46155.1| hypothetical protein [Oryza sativa Japonica Group]
Length=187

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -2

Query  533  SEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKI  360
            SE     ++C IC+DAPR C F+PCGH  +CF C  +IAE     CP+CRR + +V+++
Sbjct  116  SEDMCSENVCKICYDAPRSCFFIPCGHGFACFTCARRIAEDKNQACPICRRLIHRVRRL  174



>emb|CDP01243.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKI  360
            +C IC+D PR+C F+PCGHC +C +C  +I E     CP+CRR + KV+K+
Sbjct  439  ICVICYDMPRNCFFVPCGHCATCQDCANRIMEGETRVCPICRRLIHKVRKV  489



>ref|XP_007136732.1| hypothetical protein PHAVU_009G069600g [Phaseolus vulgaris]
 gb|ESW08726.1| hypothetical protein PHAVU_009G069600g [Phaseolus vulgaris]
Length=399

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 52/90 (58%), Gaps = 10/90 (11%)
 Frame = -2

Query  617  SYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCF  438
            SY + ++DDE+     SSS         SE+     LC IC+D  R   F+PCGHC +C+
Sbjct  319  SYGTNAKDDEENSVAYSSS---------SEELYDEKLCCICYDEQRSSFFVPCGHCATCY  369

Query  437  ECGTKIAE-TAGTCPVCRRRMKKVKKIYTV  351
            +C  +I +  +  CP+CRR + KV++++ +
Sbjct  370  DCAQRIVDGESKVCPICRRLIHKVRRLFHI  399



>gb|EEE65460.1| hypothetical protein OsJ_20838 [Oryza sativa Japonica Group]
Length=71

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -2

Query  533  SEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKI  360
            SE     ++C IC+DAPR C F+PCGH  +CF C  +IAE     CP+CRR + +V+++
Sbjct  4    SEDMCSENVCKICYDAPRSCFFIPCGHGFACFTCARRIAEDKNQACPICRRLIHRVRRL  62



>ref|XP_011458845.1| PREDICTED: uncharacterized protein LOC101292282 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKIY  357
            LC IC+D  R+C F+PCGHC +C++C  +I +  +  CP+CRR + KV++++
Sbjct  280  LCVICYDEQRNCFFVPCGHCATCYDCAQRIMDGESKVCPICRRLIHKVRRLF  331



>gb|ABK24811.1| unknown [Picea sitchensis]
Length=451

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -2

Query  512  HLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIY  357
            +LC ICF+  ++  F PCGHC +C+ CG +I E +  CP+CR+ ++++ KIY
Sbjct  398  NLCTICFEEQKNSFFQPCGHCATCYNCGLRIKEMSPECPICRQPIQEIGKIY  449



>ref|XP_010271532.1| PREDICTED: uncharacterized protein LOC104607564 [Nelumbo nucifera]
Length=391

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 57/107 (53%), Gaps = 22/107 (21%)
 Frame = -2

Query  662  PMLSDKQDDNLSLGSSYCSLSQDDEDAEE---PTSSSTLDGKPVKDSEQSDMRHLCAICF  492
            P+L +K+    S G+      +++ED E     +S    DGK            +C IC+
Sbjct  302  PLLPEKRIQ-FSYGTG-----EEEEDPESRMCGSSEDLYDGK------------ICVICY  343

Query  491  DAPRDCXFLPCGHCLSCFECGTKIA-ETAGTCPVCRRRMKKVKKIYT  354
            D  R+C F+PCGHC +C+ C  +I  E    CP+CRR + KV+++++
Sbjct  344  DEQRNCFFVPCGHCATCYTCAQRIVDEENKVCPICRRLIHKVRRLFS  390



>ref|XP_004292747.1| PREDICTED: uncharacterized protein LOC101292282 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=389

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKIY  357
            LC IC+D  R+C F+PCGHC +C++C  +I +  +  CP+CRR + KV++++
Sbjct  336  LCVICYDEQRNCFFVPCGHCATCYDCAQRIMDGESKVCPICRRLIHKVRRLF  387



>ref|XP_007018571.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY15796.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
Length=396

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 66/108 (61%), Gaps = 13/108 (12%)
 Frame = -2

Query  674  SERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAIC  495
            +E  P+L +K   +L+ G++     +D++DAE  T SS+   + + D++      LC IC
Sbjct  300  TETEPILPEKTV-HLTYGTT---AEEDNDDAE--TGSSSSSSEDLYDAK------LCVIC  347

Query  494  FDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            +D  R+C F+PCGHC +C++C  +I E     CP+CRR + K +++++
Sbjct  348  YDDQRNCFFVPCGHCATCYDCAQRIMEEDNKMCPICRRLIHKARRLFS  395



>gb|ABD33279.1| Zinc finger, RING-type [Medicago truncatula]
Length=400

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 29/119 (24%)
 Frame = -2

Query  626  LGSSYCSLSQDDEDAEEPTSSSTLDGKPV---------KDSEQSDM------RHLCAICF  492
            LG+ Y  +    E  E   +   +   PV         K+   SD+        LC ICF
Sbjct  282  LGADYGEIHNVAEAQEVTETEPLMQPNPVTYGTNIFHEKEETNSDVSEELYDEKLCIICF  341

Query  491  DAPRDCXFLPCGHCLSCFECGTKIAE--------------TAGTCPVCRRRMKKVKKIY  357
            D  R+C F+PCGHC +C++C  +I +               +  CPVCRR + KVK+++
Sbjct  342  DEQRNCFFVPCGHCATCYDCAQRIMDEESNSTLTDQIANPKSKVCPVCRRVINKVKRLF  400



>ref|XP_007018572.1| RING/U-box superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY15797.1| RING/U-box superfamily protein isoform 3 [Theobroma cacao]
Length=348

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 66/108 (61%), Gaps = 13/108 (12%)
 Frame = -2

Query  674  SERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAIC  495
            +E  P+L +K   +L+ G++     +D++DAE  T SS+   + + D++      LC IC
Sbjct  252  TETEPILPEKTV-HLTYGTT---AEEDNDDAE--TGSSSSSSEDLYDAK------LCVIC  299

Query  494  FDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            +D  R+C F+PCGHC +C++C  +I E     CP+CRR + K +++++
Sbjct  300  YDDQRNCFFVPCGHCATCYDCAQRIMEEDNKMCPICRRLIHKARRLFS  347



>gb|AES59366.2| ubiquitin-protein ligase, putative [Medicago truncatula]
Length=401

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 29/119 (24%)
 Frame = -2

Query  626  LGSSYCSLSQDDEDAEEPTSSSTLDGKPV---------KDSEQSDM------RHLCAICF  492
            LG+ Y  +    E  E   +   +   PV         K+   SD+        LC ICF
Sbjct  283  LGADYGEIHNVAEAQEVTETEPLMQPNPVTYGTNIFHEKEETNSDVSEELYDEKLCIICF  342

Query  491  DAPRDCXFLPCGHCLSCFECGTKIAE--------------TAGTCPVCRRRMKKVKKIY  357
            D  R+C F+PCGHC +C++C  +I +               +  CPVCRR + KVK+++
Sbjct  343  DEQRNCFFVPCGHCATCYDCAQRIMDEESNSTLTDQIANPKSKVCPVCRRVINKVKRLF  401



>ref|XP_004287981.1| PREDICTED: E3 ubiquitin-protein ligase Mdm2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011463635.1| PREDICTED: E3 ubiquitin-protein ligase Mdm2 [Fragaria vesca subsp. 
vesca]
Length=185

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKI  360
            +C IC+  PR+C  +PCGHC +C++C  +I E    TCP+CRR + KV+K+
Sbjct  131  ICVICYTDPRNCFLVPCGHCATCYDCAQRIFEGENRTCPICRRLIGKVRKL  181



>ref|XP_011099344.1| PREDICTED: apoptosis 1 inhibitor-like [Sesamum indicum]
Length=171

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 10/89 (11%)
 Frame = -2

Query  614  YCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
            + S     ED E  +SSS  D   + D        +C IC+D  R+C F+PCGHC++C  
Sbjct  92   FTSYGTSGEDLESGSSSSCED---LYDGT------ICVICYDDQRNCFFIPCGHCVACHA  142

Query  434  CGTKI-AETAGTCPVCRRRMKKVKKIYTV  351
            C  +I  E + +CP+CR  + KVK+++ V
Sbjct  143  CAHRIFNEESKSCPICRGNIDKVKRLHIV  171



>ref|XP_002867675.1| hypothetical protein ARALYDRAFT_329238 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43934.1| hypothetical protein ARALYDRAFT_329238 [Arabidopsis lyrata subsp. 
lyrata]
Length=157

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (48%), Gaps = 13/138 (9%)
 Frame = -2

Query  770  YFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            Y   +G      +L  + L+       +ED     +P++++++     + + +  L  + 
Sbjct  27   YITVLGTIMTITYLVLKFLSE----CDMEDDTERLLPLMAEEE-----VHTVWTPLINE-  76

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-AE  414
              + E T    ++      S+  D   LC ICF+  R+C F+PCGH  +C  C  KI +E
Sbjct  77   --SSEVTGKGDVETASFSSSDDVDYSTLCVICFEERRNCFFVPCGHSATCRGCAQKILSE  134

Query  413  TAGTCPVCRRRMKKVKKI  360
                CP+CRR ++K K++
Sbjct  135  ENKVCPICRRVIRKSKRL  152



>ref|XP_008338401.1| PREDICTED: RNA-binding protein MEX3B-like isoform X3 [Malus domestica]
Length=145

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 72/142 (51%), Gaps = 13/142 (9%)
 Frame = -2

Query  758  IGGTCFFVFLAQRILN--NXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            I      V +A  IL   N +    +ED G  +E  P+    Q     + S+Y +  +  
Sbjct  7    ICNAALLVIVAFMILKYINEYEETSVEDVGBSAETDPL----QPAGKRMPSTYGTCDEWX  62

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMR--HLCAICFDAPRDCXFLPCGHCLSCFECGTKI-  420
             ++   +SSS+     V  S   D+    +C IC+   RDC  +PCGHC +C++C  +I 
Sbjct  63   IESGNCSSSSSNSSNAVITSSSEDLYDGKICVICYTEQRDCFLVPCGHCATCYDCAQRIF  122

Query  419  -AETAGTCPVCRRRMKKVKKIY  357
              ET  TCP+CRR ++KV++++
Sbjct  123  YGETK-TCPICRRFIRKVRRLF  143



>emb|CDP02557.1| unnamed protein product [Coffea canephora]
Length=184

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 7/79 (9%)
 Frame = -2

Query  593  DEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAE  414
            +ED E    SS+     + D +      +C IC+D  R+C F+PCGHC +C  C  +I E
Sbjct  109  EEDLESAKCSSSPSDDDLYDGK------ICVICYDERRNCFFIPCGHCATCSICARRITE  162

Query  413  -TAGTCPVCRRRMKKVKKI  360
                TCPVCRR + KV+K+
Sbjct  163  GETKTCPVCRRYIHKVRKL  181



>ref|XP_010277150.1| PREDICTED: uncharacterized protein LOC104611677 isoform X1 [Nelumbo 
nucifera]
Length=388

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (54%), Gaps = 19/108 (18%)
 Frame = -2

Query  674  SERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTL-DGKPVKDSEQSDMRHLCAI  498
            +E  P+L +K     ++  SY +  ++D ++    SS  L DGK            +C I
Sbjct  296  NETSPLLPEK-----AIPFSYGTGEEEDSESSMHGSSEDLYDGK------------ICVI  338

Query  497  CFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIY  357
            C+D  R+C F+PCGH  +C+ C  +I E     CP+CRR + KV++++
Sbjct  339  CYDEQRNCFFIPCGHSATCYTCAERIVEGENKVCPICRRLIHKVRRLF  386



>ref|XP_010277151.1| PREDICTED: uncharacterized protein LOC104611677 isoform X2 [Nelumbo 
nucifera]
Length=342

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (54%), Gaps = 19/108 (18%)
 Frame = -2

Query  674  SERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTL-DGKPVKDSEQSDMRHLCAI  498
            +E  P+L +K     ++  SY +  ++D ++    SS  L DGK            +C I
Sbjct  250  NETSPLLPEK-----AIPFSYGTGEEEDSESSMHGSSEDLYDGK------------ICVI  292

Query  497  CFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIY  357
            C+D  R+C F+PCGH  +C+ C  +I E     CP+CRR + KV++++
Sbjct  293  CYDEQRNCFFIPCGHSATCYTCAERIVEGENKVCPICRRLIHKVRRLF  340



>ref|XP_011008574.1| PREDICTED: apoptosis 1 inhibitor-like [Populus euphratica]
 ref|XP_011008575.1| PREDICTED: apoptosis 1 inhibitor-like [Populus euphratica]
 ref|XP_011008577.1| PREDICTED: apoptosis 1 inhibitor-like [Populus euphratica]
 ref|XP_011008578.1| PREDICTED: apoptosis 1 inhibitor-like [Populus euphratica]
Length=183

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 64/116 (55%), Gaps = 4/116 (3%)
 Frame = -2

Query  698  RAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSD  519
            R ++E   ++   +L  K    LSL  SY + ++D E     TSSS+ D      SE+  
Sbjct  70   RNEVEIRAAQTDQLLPRKA---LSLFFSYGTCNKDLESGNCSTSSSSSDDGKNSSSEELY  126

Query  518  MRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
               +C IC+D  R+C ++PCGHC +C+ C  +I  +    CPVCRR + K++K++ 
Sbjct  127  DGKICVICYDEERNCFYVPCGHCATCYVCAQRIFNSENKVCPVCRRFIGKIRKLFA  182



>ref|XP_008338399.1| PREDICTED: RNA-binding protein MEX3B-like isoform X1 [Malus domestica]
Length=188

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 72/142 (51%), Gaps = 13/142 (9%)
 Frame = -2

Query  758  IGGTCFFVFLAQRILN--NXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            I      V +A  IL   N +    +ED G  +E  P+    Q     + S+Y +  +  
Sbjct  50   IAILTLLVIVAFMILKYINEYEETSVEDVGBSAETDPL----QPAGKRMPSTYGTCDEWX  105

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMR--HLCAICFDAPRDCXFLPCGHCLSCFECGTKI-  420
             ++   +SSS+     V  S   D+    +C IC+   RDC  +PCGHC +C++C  +I 
Sbjct  106  IESGNCSSSSSNSSNAVITSSSEDLYDGKICVICYTEQRDCFLVPCGHCATCYDCAQRIF  165

Query  419  -AETAGTCPVCRRRMKKVKKIY  357
              ET  TCP+CRR ++KV++++
Sbjct  166  YGETK-TCPICRRFIRKVRRLF  186



>ref|XP_002524949.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37446.1| conserved hypothetical protein [Ricinus communis]
Length=90

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -2

Query  593  DEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAE  414
            + D+EE    S+        +E  D + +C IC+D  R+C F+PCGHC +C+ C  +I +
Sbjct  10   NTDSEESGYCSSSTSSSNFSTELYDGK-VCVICYDEERNCFFVPCGHCATCYVCARRIFD  68

Query  413  TAG-TCPVCRRRMKKVKKIYTV  351
                 CPVCRR + KV+K++ +
Sbjct  69   GENKVCPVCRRFIGKVRKLFAL  90



>gb|EYU18316.1| hypothetical protein MIMGU_mgv1a006609mg [Erythranthe guttata]
Length=437

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = -2

Query  596  DDEDAEEP-TSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI  420
            DD     P  ++S+L G   K++E+SD    C IC DAP +   +PCGH   C  C  +I
Sbjct  355  DDGQVHYPAVNTSSLGGAHEKNNEESDTNSSCTICLDAPLEGACVPCGHLAGCMSCLNEI  414

Query  419  AETAGTCPVCRRRMKKVKKIYTV  351
                  CPVCR  + +V +IY V
Sbjct  415  KSKKWGCPVCRAEIDQVIRIYAV  437



>ref|XP_008338400.1| PREDICTED: RNA-binding protein MEX3B-like isoform X2 [Malus domestica]
Length=179

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 72/142 (51%), Gaps = 13/142 (9%)
 Frame = -2

Query  758  IGGTCFFVFLAQRILN--NXHRRAQLEDTG--SERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            I      V +A  IL   N +    +ED G  +E  P+    Q     + S+Y +  +  
Sbjct  41   ICNAALLVIVAFMILKYINEYEETSVEDVGBSAETDPL----QPAGKRMPSTYGTCDEWX  96

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMR--HLCAICFDAPRDCXFLPCGHCLSCFECGTKI-  420
             ++   +SSS+     V  S   D+    +C IC+   RDC  +PCGHC +C++C  +I 
Sbjct  97   IESGNCSSSSSNSSNAVITSSSEDLYDGKICVICYTEQRDCFLVPCGHCATCYDCAQRIF  156

Query  419  -AETAGTCPVCRRRMKKVKKIY  357
              ET  TCP+CRR ++KV++++
Sbjct  157  YGETK-TCPICRRFIRKVRRLF  177



>ref|XP_010059871.1| PREDICTED: uncharacterized protein LOC104447838 isoform X3 [Eucalyptus 
grandis]
Length=355

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKIYT  354
            LC IC+D  R+C F+PCGH  +C++C  +I E  +  CP+CRR ++KV+++++
Sbjct  302  LCVICYDDQRNCFFVPCGHRTTCYDCAQRIMEGESKVCPICRRLIRKVRRLFS  354



>ref|XP_009137428.1| PREDICTED: E3 ubiquitin-protein ligase NEURL3-like [Brassica 
rapa]
Length=122

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 60/129 (47%), Gaps = 13/129 (10%)
 Frame = -2

Query  743  FFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDEDAEEPTSS  564
            F +FL  + LN+       ED   E +P+++ ++   +     Y        +    T +
Sbjct  2    FLIFLILKSLND----CDTEDDDMESLPLVAGQEVVTIWTPLVY--------EPSGVTGN  49

Query  563  STLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-AETAGTCPVCR  387
                      +E  D   LC ICF+  R+C F+PCGH  +C  C  +I +E    CP+CR
Sbjct  50   KDFATASFSSAEDVDYSTLCVICFEERRNCFFVPCGHSATCKGCALRIMSEENKVCPICR  109

Query  386  RRMKKVKKI  360
            R ++K K++
Sbjct  110  RVIRKSKRL  118



>gb|KCW66317.1| hypothetical protein EUGRSUZ_F00142 [Eucalyptus grandis]
Length=293

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKIYT  354
            LC IC+D  R+C F+PCGH  +C++C  +I E  +  CP+CRR ++KV+++++
Sbjct  240  LCVICYDDQRNCFFVPCGHRTTCYDCAQRIMEGESKVCPICRRLIRKVRRLFS  292



>ref|XP_010059869.1| PREDICTED: uncharacterized protein LOC104447838 isoform X1 [Eucalyptus 
grandis]
 gb|KCW66316.1| hypothetical protein EUGRSUZ_F00142 [Eucalyptus grandis]
Length=406

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKIYT  354
            LC IC+D  R+C F+PCGH  +C++C  +I E  +  CP+CRR ++KV+++++
Sbjct  353  LCVICYDDQRNCFFVPCGHRTTCYDCAQRIMEGESKVCPICRRLIRKVRRLFS  405



>ref|XP_010059870.1| PREDICTED: uncharacterized protein LOC104447838 isoform X2 [Eucalyptus 
grandis]
Length=398

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKIYT  354
            LC IC+D  R+C F+PCGH  +C++C  +I E  +  CP+CRR ++KV+++++
Sbjct  345  LCVICYDDQRNCFFVPCGHRTTCYDCAQRIMEGESKVCPICRRLIRKVRRLFS  397



>ref|XP_010086625.1| putative E3 ubiquitin-protein ligase XBOS34 [Morus notabilis]
 gb|EXB22191.1| putative E3 ubiquitin-protein ligase XBOS34 [Morus notabilis]
Length=533

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 3/88 (3%)
 Frame = -2

Query  614  YCSLSQDDEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFE  435
            Y SL+ D++ + +PT          K    S     C +C++AP++   +PCGH   C  
Sbjct  449  YPSLNLDEDSSSQPTDDEASASNCKKAGGHSSS---CVVCWEAPKEGACIPCGHMACCMS  505

Query  434  CGTKIAETAGTCPVCRRRMKKVKKIYTV  351
            C  +I    G CPVCR +MK+V +IY V
Sbjct  506  CLIEIKAKKGVCPVCRSKMKRVVRIYAV  533



>ref|XP_008438514.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X2 [Cucumis melo]
Length=459

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 56/129 (43%), Gaps = 7/129 (5%)
 Frame = -2

Query  728  AQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGS-SYCSLSQDDEDAEEPTSSSTLD  552
             Q I  N H + Q      + VP      D+ L  G+  Y S+     D   PT+    D
Sbjct  335  GQSITTNEHPQIQNNVIPPDAVPSAPLAADEILEDGAIHYPSIDSSPIDLSSPTA----D  390

Query  551  GKPVKDSEQSD--MRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRM  378
              P++  E  D      C IC DAP     +PCGH   C  C T+I      CPVCR ++
Sbjct  391  NAPLRAGEGKDETSSSSCVICLDAPIQGACIPCGHMAGCMNCLTEIKSKKWGCPVCRAKI  450

Query  377  KKVKKIYTV  351
             +V ++Y V
Sbjct  451  DQVVRLYAV  459



>ref|XP_010679564.1| PREDICTED: RNA-binding protein MEX3B [Beta vulgaris subsp. vulgaris]
Length=156

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 67/141 (48%), Gaps = 7/141 (5%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
             YF  +        +A + L         E+ G  R P++S      +   S      Q+
Sbjct  17   AYFAILALLVIIALIALKCLGEWRLTHPDEEEGESR-PLISQCNSSKIVTASY--GACQE  73

Query  593  DEDAEE--PTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI  420
            D + E    +SSS+      K S   D++ +C IC+D  R+C F+PCGHC +CF C  +I
Sbjct  74   DPEFENCSSSSSSSSSSSSSKCSTLYDVK-ICIICYDEQRNCFFVPCGHCATCFVCAQRI  132

Query  419  -AETAGTCPVCRRRMKKVKKI  360
              E    CPVCRR + K++++
Sbjct  133  FHEENRNCPVCRRYIGKIRRL  153



>ref|XP_009777213.1| PREDICTED: uncharacterized protein LOC104226833 isoform X3 [Nicotiana 
sylvestris]
Length=368

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  512  HLCAICFDAPRDCXFLPCGHCLSCFECGTKIAET-AGTCPVCRRRMKKVKKI  360
             +C IC+D  R+C F+PCGHC +C EC  +I +  +  CPVCRR + KV+K+
Sbjct  314  RICVICYDNTRNCFFVPCGHCATCQECAQRIMDVESRVCPVCRRPIYKVRKL  365



>gb|KHN04458.1| Apoptosis 1 inhibitor [Glycine soja]
Length=399

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIA-ETAGTCPVCRRRMKKVKKIY  357
            LC IC+D  R   F+PCGHC +C++C  +I  E +  CP+CRR + KV+++Y
Sbjct  346  LCCICYDEQRSSFFVPCGHCATCYDCAQRILDEESIVCPICRRLIHKVRRLY  397



>ref|XP_008438510.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Cucumis melo]
 ref|XP_008438511.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Cucumis melo]
 ref|XP_008438512.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Cucumis melo]
 ref|XP_008438513.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 isoform 
X1 [Cucumis melo]
Length=476

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 56/129 (43%), Gaps = 7/129 (5%)
 Frame = -2

Query  728  AQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGS-SYCSLSQDDEDAEEPTSSSTLD  552
             Q I  N H + Q      + VP      D+ L  G+  Y S+     D   PT+    D
Sbjct  352  GQSITTNEHPQIQNNVIPPDAVPSAPLAADEILEDGAIHYPSIDSSPIDLSSPTA----D  407

Query  551  GKPVKDSEQSD--MRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRM  378
              P++  E  D      C IC DAP     +PCGH   C  C T+I      CPVCR ++
Sbjct  408  NAPLRAGEGKDETSSSSCVICLDAPIQGACIPCGHMAGCMNCLTEIKSKKWGCPVCRAKI  467

Query  377  KKVKKIYTV  351
             +V ++Y V
Sbjct  468  DQVVRLYAV  476



>ref|XP_006578043.1| PREDICTED: uncharacterized protein LOC100777075 isoform X2 [Glycine 
max]
Length=400

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIA-ETAGTCPVCRRRMKKVKKIY  357
            LC IC+D  R   F+PCGHC +C++C  +I  E +  CP+CRR + KV+++Y
Sbjct  347  LCCICYDEQRSSFFVPCGHCATCYDCAQRILDEESIVCPICRRLIHKVRRLY  398



>ref|XP_009360243.1| PREDICTED: uncharacterized protein LOC103950736 isoform X1 [Pyrus 
x bretschneideri]
Length=343

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            LC IC+D  R+  F+PCGHC +C++C  +I +     CP+CRR + KV+K++ 
Sbjct  290  LCVICYDEQRNSFFVPCGHCATCYDCAQRIMDGENKVCPICRRLIHKVRKLFN  342



>ref|XP_008377991.1| PREDICTED: uncharacterized protein LOC103441074 isoform X3 [Malus 
domestica]
Length=346

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIYT  354
            LC IC+D  R+  F+PCGHC +C++C  +I +     CP+CRR + KV+K++ 
Sbjct  293  LCVICYDEQRNSFFVPCGHCATCYDCAQRIMDGENKVCPICRRLIHKVRKLFN  345



>ref|XP_009777212.1| PREDICTED: uncharacterized protein LOC104226833 isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 14/137 (10%)
 Frame = -2

Query  767  FLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDDE  588
            ++GI       F+ +  L      + +E+T   R    +D    +  LGS Y +  ++  
Sbjct  243  YVGILAVIIICFILKS-LGACDNESYVEETPVTREITETDPMLPHKELGSIYGTCEEESN  301

Query  587  DAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAET-  411
              +  +S    DG+            +C IC+D  R+C F+PCGHC +C EC  +I +  
Sbjct  302  SGKSSSSEDLYDGR------------ICVICYDNTRNCFFVPCGHCATCQECAQRIMDVE  349

Query  410  AGTCPVCRRRMKKVKKI  360
            +  CPVCRR + KV+K+
Sbjct  350  SRVCPVCRRPIYKVRKL  366



>ref|XP_006578044.1| PREDICTED: uncharacterized protein LOC100777075 isoform X3 [Glycine 
max]
Length=392

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIA-ETAGTCPVCRRRMKKVKKIY  357
            LC IC+D  R   F+PCGHC +C++C  +I  E +  CP+CRR + KV+++Y
Sbjct  339  LCCICYDEQRSSFFVPCGHCATCYDCAQRILDEESIVCPICRRLIHKVRRLY  390



>ref|XP_003523614.2| PREDICTED: uncharacterized protein LOC100777075 isoform X1 [Glycine 
max]
Length=382

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIA-ETAGTCPVCRRRMKKVKKIY  357
            LC IC+D  R   F+PCGHC +C++C  +I  E +  CP+CRR + KV+++Y
Sbjct  329  LCCICYDEQRSSFFVPCGHCATCYDCAQRILDEESIVCPICRRLIHKVRRLY  380



>gb|KHN45168.1| Apoptosis 1 inhibitor [Glycine soja]
Length=403

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKIY  357
            LC IC+D  R+  F+PCGHC +C++C  +I +  +  CP+CRR + KV+++Y
Sbjct  350  LCCICYDEQRNSFFVPCGHCATCYDCAERIVDGESKVCPICRRLIHKVRRLY  401



>ref|XP_009354132.1| PREDICTED: uncharacterized protein LOC103945304 isoform X3 [Pyrus 
x bretschneideri]
Length=346

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIY  357
            LC IC+D  R+  F+PCGHC +C++C  +I +     CP+CRR + KV+K++
Sbjct  293  LCVICYDEQRNSFFVPCGHCATCYDCAQRIMDGENRVCPICRRLIHKVRKLF  344



>ref|XP_004167338.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Cucumis 
sativus]
Length=459

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 56/129 (43%), Gaps = 7/129 (5%)
 Frame = -2

Query  728  AQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGS-SYCSLSQDDEDAEEPTSSSTLD  552
             Q I  N H + Q   T  + VP      D+ L  G+  Y S+     D     SS T  
Sbjct  335  GQSITANEHPQIQTNVTPPDAVPSAPLAADEILDNGAIHYPSIDSSPID----LSSQTAH  390

Query  551  GKPVKDSEQSD--MRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRM  378
              P++  E  D      C IC DAP     +PCGH   C  C T+I      CPVCR ++
Sbjct  391  NAPLQAGEGKDETSSSSCVICLDAPVQGACIPCGHMAGCMNCLTEIKSKKWGCPVCRAKI  450

Query  377  KKVKKIYTV  351
             +V ++Y V
Sbjct  451  DQVVRLYAV  459



>ref|XP_006581252.1| PREDICTED: uncharacterized protein LOC100794488 [Glycine max]
Length=404

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAE-TAGTCPVCRRRMKKVKKIY  357
            LC IC+D  R+  F+PCGHC +C++C  +I +  +  CP+CRR + KV+++Y
Sbjct  351  LCCICYDEQRNSFFVPCGHCATCYDCAERIVDGESKVCPICRRLIHKVRRLY  402



>ref|XP_011099345.1| PREDICTED: RNA-binding protein MEX3B-like [Sesamum indicum]
Length=155

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  512  HLCAICFDAPRDCXFLPCGHCLSCFECGTKI-AETAGTCPVCRRRMKKVKKI  360
             +C +C+D  R+C F+PCGH ++C+ C  +I +E   TCP+CR  + KV+K+
Sbjct  101  RICVVCYDDERNCFFIPCGHYVTCYTCAQRISSEDIKTCPICRSLINKVRKL  152



>ref|XP_009777211.1| PREDICTED: uncharacterized protein LOC104226833 isoform X1 [Nicotiana 
sylvestris]
Length=371

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 66/138 (48%), Gaps = 14/138 (10%)
 Frame = -2

Query  767  FLGIGGTCFFVF-LAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQDD  591
            ++GI G    +     + L      + +E+T   R    +D    +  LGS Y +  ++ 
Sbjct  243  YVGILGIAVIIICFILKSLGACDNESYVEETPVTREITETDPMLPHKELGSIYGTCEEES  302

Query  590  EDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAET  411
               +  +S    DG+            +C IC+D  R+C F+PCGHC +C EC  +I + 
Sbjct  303  NSGKSSSSEDLYDGR------------ICVICYDNTRNCFFVPCGHCATCQECAQRIMDV  350

Query  410  -AGTCPVCRRRMKKVKKI  360
             +  CPVCRR + KV+K+
Sbjct  351  ESRVCPVCRRPIYKVRKL  368



>ref|XP_004134060.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35-like [Cucumis 
sativus]
 gb|KGN56851.1| hypothetical protein Csa_3G134990 [Cucumis sativus]
Length=459

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 56/129 (43%), Gaps = 7/129 (5%)
 Frame = -2

Query  728  AQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGS-SYCSLSQDDEDAEEPTSSSTLD  552
             Q I  N H + Q   T  + VP      D+ L  G+  Y S+     D     SS T  
Sbjct  335  GQSITANEHPQIQTNVTPPDAVPSAPLAADEILDNGAIHYPSIDSSPID----LSSQTAH  390

Query  551  GKPVKDSEQSD--MRHLCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRM  378
              P++  E  D      C IC DAP     +PCGH   C  C T+I      CPVCR ++
Sbjct  391  NAPLQAGEGKDEMSSSSCVICLDAPVQGACIPCGHMAGCMNCLTEIKSKKWGCPVCRAKI  450

Query  377  KKVKKIYTV  351
             +V ++Y V
Sbjct  451  DQVVRLYAV  459



>ref|XP_009354130.1| PREDICTED: uncharacterized protein LOC103945304 isoform X1 [Pyrus 
x bretschneideri]
Length=394

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIY  357
            LC IC+D  R+  F+PCGHC +C++C  +I +     CP+CRR + KV+K++
Sbjct  341  LCVICYDEQRNSFFVPCGHCATCYDCAQRIMDGENRVCPICRRLIHKVRKLF  392



>ref|XP_009354131.1| PREDICTED: uncharacterized protein LOC103945304 isoform X2 [Pyrus 
x bretschneideri]
Length=391

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIY  357
            LC IC+D  R+  F+PCGHC +C++C  +I +     CP+CRR + KV+K++
Sbjct  338  LCVICYDEQRNSFFVPCGHCATCYDCAQRIMDGENRVCPICRRLIHKVRKLF  389



>ref|XP_008377989.1| PREDICTED: uncharacterized protein LOC103441074 isoform X1 [Malus 
domestica]
Length=394

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIY  357
            LC IC+D  R+  F+PCGHC +C++C  +I +     CP+CRR + KV+K++
Sbjct  341  LCVICYDEQRNSFFVPCGHCATCYDCAQRIMDGENKVCPICRRLIHKVRKLF  392



>ref|XP_008377990.1| PREDICTED: uncharacterized protein LOC103441074 isoform X2 [Malus 
domestica]
Length=391

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIY  357
            LC IC+D  R+  F+PCGHC +C++C  +I +     CP+CRR + KV+K++
Sbjct  338  LCVICYDEQRNSFFVPCGHCATCYDCAQRIMDGENKVCPICRRLIHKVRKLF  389



>ref|XP_009360249.1| PREDICTED: uncharacterized protein LOC103950736 isoform X2 [Pyrus 
x bretschneideri]
Length=391

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIY  357
            LC IC+D  R+  F+PCGHC +C++C  +I +     CP+CRR + KV+K++
Sbjct  338  LCVICYDEQRNSFFVPCGHCATCYDCAQRIMDGENKVCPICRRLIHKVRKLF  389



>gb|KFK28983.1| hypothetical protein AALP_AA7G073300 [Arabis alpina]
Length=273

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 66/135 (49%), Gaps = 19/135 (14%)
 Frame = -2

Query  773  TYFLGIGGTCFFVFLAQRILNNXHRRAQLEDTGSERVPMLSDKQDDNLSLGSSYCSLSQD  594
             YF  +G     + L  + L+       LED  +  +P+ ++++   L + ++     Q 
Sbjct  149  VYFTVLGTVMLVIVLLLKFLSEY----DLED-DTAMLPVSAEEEQRPLMINNA---PRQG  200

Query  593  DEDAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-A  417
            DE+     SSS          E  D   +C ICF+  ++C F+PCGH  +C+ C  KI +
Sbjct  201  DEETAIMFSSS----------EDVDYSKICVICFEERKNCFFVPCGHSATCYGCAQKILS  250

Query  416  ETAGTCPVCRRRMKK  372
            E +  CP+CRR ++K
Sbjct  251  EESKVCPICRRVIRK  265



>ref|XP_008351980.1| PREDICTED: uncharacterized protein LOC103415424 isoform X2 [Malus 
domestica]
Length=343

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -2

Query  509  LCAICFDAPRDCXFLPCGHCLSCFECGTKIAETAG-TCPVCRRRMKKVKKIY  357
            LC IC+D  R+  F+PCGHC +C++C  +I       CP+CRR + KV+K++
Sbjct  290  LCVICYDEQRNSFFVPCGHCATCYDCAQRIMXGENKVCPICRRLIHKVRKLF  341



>ref|XP_009834277.1| hypothetical protein H257_09679 [Aphanomyces astaci]
 gb|ETV76152.1| hypothetical protein H257_09679 [Aphanomyces astaci]
Length=428

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  506  CAICFDAPRDCXFLPCGHCLSCFECGTKIAETAGTCPVCRRRMKKVKKIY  357
            C +CFDAP+    +PCGH + C +C T+I  T+  CP+CR+ +++V ++Y
Sbjct  377  CVVCFDAPQSAVCVPCGHIVLCMQCATRITSTSSRCPLCRQHVREVIQVY  426



>ref|NP_001119039.1| RING-finger domain-containing protein [Arabidopsis thaliana]
 gb|AEE84865.1| RING-finger domain-containing protein [Arabidopsis thaliana]
Length=157

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -2

Query  587  DAEEPTSSSTLDGKPVKDSEQSDMRHLCAICFDAPRDCXFLPCGHCLSCFECGTKI-AET  411
            ++ E T    ++      S+  D   LC ICF+  R+C F+PCGH  +C  C  +I +E 
Sbjct  76   ESLEVTGKGDVETASFSSSDDVDYSTLCVICFEERRNCFFVPCGHSATCRGCAQRILSEE  135

Query  410  AGTCPVCRRRMKKVKKI  360
            +  CP+CRR ++K K++
Sbjct  136  SKVCPICRRVIRKSKRL  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520