BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019D02

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                   379   1e-128   Citrus sinensis [apfelsine]
gb|KJB11770.1|  hypothetical protein B456_001G276400                    378   4e-128   Gossypium raimondii
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    376   2e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    376   3e-127   Camelina sativa [gold-of-pleasure]
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                379   4e-127   Arachis hypogaea [goober]
gb|KJB70724.1|  hypothetical protein B456_011G088800                    375   5e-127   Gossypium raimondii
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    377   1e-126   Cucumis melo [Oriental melon]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    377   1e-126   Cucumis melo [Oriental melon]
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    377   1e-126   Citrus sinensis [apfelsine]
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             377   2e-126   Citrus clementina [clementine]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         375   8e-126   Morus notabilis
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    375   8e-126   Arabis alpina [alpine rockcress]
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    375   1e-125   Nicotiana sylvestris
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    374   2e-125   Solanum lycopersicum
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             374   2e-125   Cucumis sativus [cucumbers]
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             374   2e-125   Populus trichocarpa [western balsam poplar]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                374   3e-125   Mangifera indica
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    374   3e-125   Populus euphratica
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    369   4e-125   Tarenaya hassleriana [spider flower]
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    374   5e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   5e-125   Nicotiana tomentosiformis
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   5e-125   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   5e-125   Oryza brachyantha
gb|KJB11771.1|  hypothetical protein B456_001G276400                    373   6e-125   Gossypium raimondii
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   6e-125   
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   6e-125   
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   6e-125   Populus euphratica
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    375   6e-125   
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             373   9e-125   Prunus persica
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   9e-125   
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    373   9e-125   Glycine soja [wild soybean]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   1e-124   Prunus mume [ume]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    372   1e-124   
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   1e-124   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    372   1e-124   Glycine soja [wild soybean]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             372   1e-124   Eutrema salsugineum [saltwater cress]
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   2e-124   
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   2e-124   Cicer arietinum [garbanzo]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   2e-124   Nelumbo nucifera [Indian lotus]
gb|KJB70723.1|  hypothetical protein B456_011G088800                    372   2e-124   Gossypium raimondii
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             372   2e-124   Nicotiana benthamiana
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    372   2e-124   Arabidopsis thaliana [mouse-ear cress]
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         372   2e-124   Jatropha curcas
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             372   2e-124   Capsella rubella
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    369   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_002875330.1|  gapa                                               371   2e-124   Arabidopsis lyrata subsp. lyrata
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    371   3e-124   Nelumbo nucifera [Indian lotus]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    371   4e-124   Brassica rapa
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    371   4e-124   Ricinus communis
gb|ACU21011.1|  unknown                                                 371   4e-124   Glycine max [soybeans]
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      369   5e-124   Arabidopsis thaliana [mouse-ear cress]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                370   5e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    370   6e-124   Solanum lycopersicum
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    370   6e-124   Sesamum indicum [beniseed]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    370   8e-124   Theobroma cacao [chocolate]
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    370   9e-124   Malus domestica [apple tree]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                368   1e-123   Lilium regale
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    370   1e-123   Solanum tuberosum [potatoes]
gb|ABK96233.1|  unknown                                                 369   2e-123   Populus trichocarpa x Populus deltoides
ref|NP_001052984.1|  Os04g0459500                                       369   2e-123   
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    366   3e-123   Brassica rapa
gb|ABK96725.1|  unknown                                                 369   3e-123   Populus trichocarpa x Populus deltoides
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    369   4e-123   Pyrus x bretschneideri [bai li]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    366   5e-123   Pyrus x bretschneideri [bai li]
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    368   7e-123   Tarenaya hassleriana [spider flower]
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    365   7e-123   
dbj|BAJ34149.1|  unnamed protein product                                368   7e-123   Eutrema halophilum
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              367   9e-123   Scoparia dulcis [escobilla]
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          367   9e-123   Amborella trichopoda
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             367   1e-122   
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    367   1e-122   Pyrus x bretschneideri [bai li]
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   368   1e-122   Citrus sinensis [apfelsine]
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    367   1e-122   Malus domestica [apple tree]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    367   1e-122   Eucalyptus grandis [rose gum]
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    368   2e-122   
gb|AGJ50596.1|  GAPDH                                                   367   2e-122   Pericallis cruenta
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    366   2e-122   Setaria italica
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    366   3e-122   Fragaria vesca subsp. vesca
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    363   3e-122   Camelina sativa [gold-of-pleasure]
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         366   4e-122   
gb|ABK94956.1|  unknown                                                 366   4e-122   Populus trichocarpa [western balsam poplar]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             366   4e-122   Phaseolus vulgaris [French bean]
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    363   5e-122   Camelina sativa [gold-of-pleasure]
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    365   6e-122   Zea mays [maize]
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     362   8e-122   Arabidopsis thaliana [mouse-ear cress]
emb|CAA30152.1|  GADPH (383 AA)                                         364   9e-122   Zea mays [maize]
gb|EPS59235.1|  hypothetical protein M569_15573                         364   2e-121   Genlisea aurea
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    364   3e-121   Vitis vinifera
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    363   3e-121   
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         363   4e-121   Medicago truncatula
emb|CAN78872.1|  hypothetical protein VITISV_021726                     363   4e-121   Vitis vinifera
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                363   6e-121   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    363   6e-121   Brachypodium distachyon [annual false brome]
emb|CDY16038.1|  BnaC08g40850D                                          362   7e-121   Brassica napus [oilseed rape]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    363   8e-121   Pisum sativum [garden pea]
emb|CDY26599.1|  BnaA09g46780D                                          362   1e-120   Brassica napus [oilseed rape]
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       362   1e-120   Medicago sativa [alfalfa]
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              360   1e-120   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    361   2e-120   Brassica rapa
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    358   3e-120   Miscanthus sinensis
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    358   3e-120   Spinacia oleracea
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    358   4e-120
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    358   4e-120   Spinacia oleracea
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    361   4e-120   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               358   4e-120   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    360   4e-120   Brassica rapa
emb|CDY19412.1|  BnaC05g09210D                                          360   4e-120   Brassica napus [oilseed rape]
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    358   5e-120   Spinacia oleracea
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               360   5e-120   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    360   5e-120   Camelina sativa [gold-of-pleasure]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    360   6e-120   Arabis alpina [alpine rockcress]
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    358   9e-120   Spinacia oleracea
emb|CAA33264.1|  unnamed protein product                                360   1e-119   Pisum sativum [garden pea]
gb|ABK25233.1|  unknown                                                 360   1e-119   Picea sitchensis
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    359   1e-119   Spinacia oleracea
gb|ACN40537.1|  unknown                                                 360   1e-119   Picea sitchensis
gb|ACN39951.1|  unknown                                                 357   2e-119   Picea sitchensis
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    357   2e-119   Spinacia oleracea
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    359   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             357   4e-119   
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             358   4e-119   Eutrema salsugineum [saltwater cress]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        358   4e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     356   5e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892719.1|  GAPA-2                                             358   5e-119   Arabidopsis lyrata subsp. lyrata
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                360   5e-119   Erythranthe guttata [common monkey flower]
dbj|BAJ90885.1|  predicted protein                                      358   5e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90530.1|  predicted protein                                      358   6e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN40000.1|  unknown                                                 358   9e-119   Picea sitchensis
gb|ABK24313.1|  unknown                                                 358   9e-119   Picea sitchensis
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    357   9e-119   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   358   1e-118   Citrus sinensis [apfelsine]
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             357   1e-118   Selaginella moellendorffii
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             357   2e-118   
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             355   5e-118   Selaginella moellendorffii
dbj|BAH57068.1|  AT1G12900                                              353   9e-118   Arabidopsis thaliana [mouse-ear cress]
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    348   1e-117   Sinapis alba [bai jie]
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  354   2e-117   Pinus sylvestris [Scotch pine]
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    351   2e-116   Nicotiana tabacum [American tobacco]
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              351   2e-116   Phaseolus vulgaris [French bean]
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    344   4e-114   Marchantia polymorpha
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               344   1e-113   Marchantia polymorpha
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    339   1e-112   Chlorokybus atmophyticus
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase                334   3e-112   Helianthus annuus
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               337   8e-112   Capsicum annuum
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase                333   1e-111   Helianthus annuus
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      337   2e-111   Chlorokybus atmophyticus
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    337   6e-111   
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    337   1e-110   
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    331   3e-110   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    334   4e-110   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               332   6e-110   Capsicum annuum
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase                328   1e-109   Helianthus annuus
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    335   1e-109   Zea mays [maize]
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    331   4e-109   
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase               327   5e-109   Artemisia indica
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          330   1e-108   Chlamydomonas sp. W80
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                327   1e-108   Mesostigma viride
ref|XP_001771209.1|  predicted protein                                  331   1e-108   
ref|XP_001771246.1|  predicted protein                                  331   3e-108   
ref|XP_001779769.1|  predicted protein                                  330   6e-108   
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                325   1e-107   Mesostigma viride
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    325   2e-107   Mesostigma viride
ref|XP_001779753.1|  predicted protein                                  328   2e-107   
ref|XP_001753934.1|  predicted protein                                  328   4e-107   
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     327   4e-107   Physcomitrella patens
emb|CDP18560.1|  unnamed protein product                                327   4e-107   Coffea canephora [robusta coffee]
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    326   4e-107   Triticum urartu
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      325   7e-107   Mesostigma viride
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                325   2e-106   Syntrichia caninervis
emb|CDX83635.1|  BnaC07g23750D                                          324   4e-106   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     321   1e-105   Physcomitrella patens
emb|CDY13649.1|  BnaA06g32740D                                          323   2e-105   Brassica napus [oilseed rape]
emb|CDY28536.1|  BnaC02g36240D                                          322   3e-105   Brassica napus [oilseed rape]
ref|XP_001766703.1|  predicted protein                                  322   3e-105   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    320   7e-104   Botryococcus braunii
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      313   2e-103   Spermatozopsis similis
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                317   4e-103   Dunaliella salina
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              315   1e-102   Volvox carteri f. nagariensis
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      312   3e-102   Chara vulgaris
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               311   3e-102   Sphagnum cuspidatum
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    315   3e-102   Auxenochlorella protothecoides
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    314   3e-102   Chlamydomonas incerta
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           314   3e-102   Bathycoccus prasinos
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               312   3e-102   Sphagnum cuspidatum
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           313   5e-102   Chlamydomonas reinhardtii
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               311   6e-102   Spirogyra sp.
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      313   1e-101   Cladophora rupestris
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           313   1e-101   Coccomyxa subellipsoidea C-169
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    312   3e-101   Dunaliella viridis
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      309   6e-101   Chlorella sp. JP-2005
emb|CDY48981.1|  BnaA02g28150D                                          308   5e-100   Brassica napus [oilseed rape]
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      309   8e-100   Cyanophora paradoxa
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    308   1e-99    Micromonas commoda
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    306   4e-99    Ostreococcus sp. 'lucimarinus'
ref|XP_001420043.1|  predicted protein                                  305   4e-99    Ostreococcus lucimarinus CCE9901
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase                300   5e-99    Helianthus annuus
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               308   5e-99    Solanum tuberosum [potatoes]
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              303   6e-99    Medicago truncatula
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                303   9e-99    Klebsormidium flaccidum
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      306   9e-99    Scherffelia dubia
gb|KJB57938.1|  hypothetical protein B456_009G186400                    306   1e-98    Gossypium raimondii
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          306   1e-98    
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    305   2e-98    Ostreococcus tauri
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    305   2e-98    
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    306   2e-98    Nicotiana tabacum [American tobacco]
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    307   2e-98    Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    307   2e-98    Nicotiana tomentosiformis
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   4e-98    Solanum tuberosum [potatoes]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    306   5e-98    Gossypium raimondii
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               306   5e-98    Marchantia polymorpha
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   5e-98    Solanum lycopersicum
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    306   5e-98    Gossypium arboreum [tree cotton]
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           306   5e-98    Medicago truncatula
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    301   6e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   7e-98    Tarenaya hassleriana [spider flower]
gb|EPS70760.1|  hypothetical protein M569_03997                         305   8e-98    Genlisea aurea
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    308   8e-98    Cicer arietinum [garbanzo]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             305   8e-98    Prunus persica
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   8e-98    Prunus mume [ume]
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      304   1e-97    Mesostigma viride
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   1e-97    Nicotiana sylvestris
gb|KJB14201.1|  hypothetical protein B456_002G114000                    305   1e-97    Gossypium raimondii
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   1e-97    Nicotiana tomentosiformis
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   1e-97    Elaeis guineensis
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   2e-97    Sesamum indicum [beniseed]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    305   2e-97    Gossypium arboreum [tree cotton]
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    304   2e-97    Pisum sativum [garden pea]
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      304   2e-97    Chlorokybus atmophyticus
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         304   2e-97    Jatropha curcas
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             301   3e-97    Micromonas pusilla CCMP1545
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   3e-97    Pyrus x bretschneideri [bai li]
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    304   3e-97    
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   3e-97    Eucalyptus grandis [rose gum]
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   4e-97    Malus domestica [apple tree]
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   4e-97    
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   4e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    303   4e-97    Pyrus x bretschneideri [bai li]
gb|ACJ84309.1|  unknown                                                 303   7e-97    Medicago truncatula
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               298   8e-97    Klebsormidium flaccidum
ref|NP_001048847.1|  Os03g0129300                                       303   8e-97    
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   9e-97    
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   1e-96    
gb|ACU20783.1|  unknown                                                 302   1e-96    Glycine max [soybeans]
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              299   1e-96    Brassica rapa subsp. chinensis [bok-choy]
emb|CDP07271.1|  unnamed protein product                                302   1e-96    Coffea canephora [robusta coffee]
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   1e-96    
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    302   2e-96    Glycine soja [wild soybean]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              302   2e-96    Pyrus x bretschneideri [bai li]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    300   2e-96    Mesostigma viride
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   2e-96    
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   2e-96    Phoenix dactylifera
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         300   2e-96    Micromonas commoda
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    302   2e-96    
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             301   2e-96    Eutrema salsugineum [saltwater cress]
ref|NP_001240080.1|  uncharacterized protein LOC100806482               301   2e-96    Glycine max [soybeans]
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                297   2e-96    Mesostigma viride
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    301   3e-96    Glycine max [soybeans]
emb|CDY69523.1|  BnaC08g46180D                                          300   3e-96    Brassica napus [oilseed rape]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   3e-96    Brassica rapa
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             301   3e-96    Phaseolus vulgaris [French bean]
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    300   4e-96    Ostreococcus tauri
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              301   4e-96    Scoparia dulcis [escobilla]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   4e-96    Fragaria vesca subsp. vesca
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   5e-96    Populus euphratica
dbj|BAK02737.1|  predicted protein                                      296   5e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA33262.1|  unnamed protein product                                301   5e-96    Pisum sativum [garden pea]
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   5e-96    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ86633.1|  predicted protein                                      300   5e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    298   6e-96    Spinacia oleracea
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   6e-96    Nelumbo nucifera [Indian lotus]
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           298   9e-96    Bathycoccus prasinos
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    300   9e-96    
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   1e-95    Populus euphratica
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    300   1e-95    
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             299   1e-95    
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    300   1e-95    
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             298   1e-95    
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    300   1e-95    
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    300   1e-95    
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    300   1e-95    
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   1e-95    
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             299   2e-95    
gb|ADD54591.1|  putative glyceraldehyde-3-phosphate dehydrogenase       291   2e-95    
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      298   2e-95    
gb|ABK24645.1|  unknown                                                 300   2e-95    
gb|ACN40006.1|  unknown                                                 300   2e-95    
dbj|BAJ87214.1|  predicted protein                                      299   2e-95    
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    299   2e-95    
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            299   2e-95    
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             298   2e-95    
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             299   2e-95    
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    299   3e-95    
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    299   3e-95    
gb|ACN40526.1|  unknown                                                 299   3e-95    
emb|CAN69459.1|  hypothetical protein VITISV_021576                     298   4e-95    
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   4e-95    
ref|XP_001415434.1|  predicted protein                                  297   4e-95    
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    298   6e-95    
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    298   6e-95    
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             298   8e-95    
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   9e-95    
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    297   1e-94    
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    292   1e-94    
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    297   2e-94    
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    297   2e-94    
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    297   2e-94    
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      292   2e-94    
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               297   3e-94    
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             296   4e-94    
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    295   6e-94    
emb|CBI29293.3|  unnamed protein product                                291   6e-94    
dbj|BAD72793.1|  glyceraldehyde-3-phosphate dehydrogenase               286   1e-93    
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    292   2e-93    
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    294   2e-93    
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           290   3e-93    
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         290   3e-93    
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    292   1e-92    
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase                283   2e-92    
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           290   3e-92    
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    290   3e-92    
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           286   8e-92    
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             286   1e-91    
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              284   1e-91    
gb|ABK00066.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    283   1e-91    
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    285   2e-91    
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    285   2e-91    
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           285   2e-91    
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    285   3e-91    
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           285   3e-91    
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             285   4e-91    
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         303   6e-91    
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    286   7e-91    
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           283   1e-90    
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    283   1e-90    
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             284   1e-90    
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             284   1e-90    
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         283   1e-90    
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    283   2e-90    
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    285   2e-90    
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           283   2e-90    
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    282   4e-90    
gb|ERT05629.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        280   4e-90    
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                281   4e-90    
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           281   6e-90    
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...    281   7e-90    
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    281   8e-90    
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    281   8e-90    
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           281   1e-89    
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           280   2e-89    
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    280   3e-89    
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           280   3e-89    
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               278   4e-89    
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           279   6e-89    
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        280   6e-89    
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    281   7e-89    
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                279   7e-89    
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    278   1e-88    
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           278   1e-88    
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    278   1e-88    
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    278   1e-88    
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           278   1e-88    
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      277   2e-88    
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           278   2e-88    
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               277   2e-88    
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           278   2e-88    
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              280   2e-88    
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           277   2e-88    
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           282   2e-88    
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           277   2e-88    
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    277   3e-88    
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           277   3e-88    
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           277   3e-88    
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           277   3e-88    
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           277   3e-88    
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    277   4e-88    
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           277   4e-88    
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        276   4e-88    
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    276   5e-88    
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        276   8e-88    
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           276   1e-87    
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                276   1e-87    
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    275   1e-87    
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           276   2e-87    
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    275   2e-87    
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               274   2e-87    
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           275   2e-87    
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    275   3e-87    
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    275   3e-87    
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           275   3e-87    
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           274   3e-87    
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           274   4e-87    
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           274   4e-87    
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    274   4e-87    
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    274   4e-87    
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           274   5e-87    
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    274   5e-87    
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                274   6e-87    
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           273   7e-87    
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase           274   7e-87    
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           273   8e-87    
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           273   8e-87    
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           273   8e-87    
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    273   9e-87    
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    273   1e-86    
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           273   2e-86    
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           272   2e-86    
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           272   2e-86    
gb|AHB87911.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehyd...    271   2e-86    
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   275   3e-86    
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      275   3e-86    
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           272   3e-86    
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    272   3e-86    
gb|ADB81485.1|  glyceraldehyde-3-phosphate dehydrogenase                270   4e-86    
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         271   4e-86    
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           271   5e-86    
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    271   5e-86    
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase           271   5e-86    
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           271   7e-86    
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                270   7e-86    
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        270   7e-86    
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           271   8e-86    
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase           271   8e-86    
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           271   9e-86    
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           271   9e-86    
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    271   1e-85    
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           270   1e-85    
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...    271   1e-85    
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           270   2e-85    
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    270   2e-85    
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    267   2e-85    
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    270   2e-85    
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           270   2e-85    
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           270   2e-85    
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           270   3e-85    
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase                267   3e-85    
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           269   4e-85    
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           269   4e-85    
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                269   4e-85    
ref|WP_015125741.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    269   5e-85    
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           269   5e-85    
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           268   1e-84    
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           268   1e-84    
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    268   1e-84    
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           268   1e-84    
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           268   1e-84    
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    268   2e-84    
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    268   2e-84    
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           268   2e-84    
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           267   2e-84    
ref|WP_025944290.1|  glyceraldehyde-3-phosphate dehydrogenase           264   3e-84    
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           266   4e-84    
ref|WP_010313976.1|  glyceraldehyde-3-phosphate dehydrogenase           266   4e-84    
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           266   4e-84    
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    266   6e-84    
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           266   7e-84    
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    266   7e-84    
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    266   7e-84    
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           265   1e-83    
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    265   1e-83    
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    266   1e-83    
ref|WP_025938864.1|  glyceraldehyde-3-phosphate dehydrogenase           265   1e-83    
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    265   1e-83    
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           265   2e-83    
ref|WP_025895306.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    265   2e-83    
ref|WP_025887309.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    265   2e-83    
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           265   2e-83    
ref|WP_025900197.1|  glyceraldehyde-3-phosphate dehydrogenase           262   3e-83    
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           266   3e-83    
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           264   3e-83    
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase           264   4e-83    
gb|AIQ96116.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    263   4e-83    
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           264   4e-83    
ref|WP_025970551.1|  glyceraldehyde-3-phosphate dehydrogenase           264   4e-83    
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           264   4e-83    
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    263   6e-83    
ref|WP_038650443.1|  glyceraldehyde-3-phosphate dehydrogenase           264   6e-83    
ref|WP_025924004.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    263   6e-83    
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           263   6e-83    
ref|WP_025935563.1|  glyceraldehyde-3-phosphate dehydrogenase           263   7e-83    
ref|YP_002049068.1|  Glyceraldehyde 3-phosphate dehydrogenase NAD...    263   7e-83    
ref|WP_036906091.1|  glyceraldehyde-3-phosphate dehydrogenase           263   7e-83    
ref|WP_025941106.1|  glyceraldehyde-3-phosphate dehydrogenase           263   8e-83    
ref|WP_025923775.1|  glyceraldehyde-3-phosphate dehydrogenase           263   8e-83    
ref|WP_011817500.1|  glyceraldehyde-3-phosphate dehydrogenase           263   9e-83    
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           263   9e-83    
ref|WP_025932858.1|  glyceraldehyde-3-phosphate dehydrogenase           263   1e-82    
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           263   1e-82    
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                264   1e-82    
ref|WP_025925726.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    263   1e-82    
ref|WP_032523814.1|  glyceraldehyde-3-phosphate dehydrogenase           263   1e-82    
ref|WP_011375588.1|  glyceraldehyde-3-phosphate dehydrogenase           263   1e-82    
ref|WP_025947080.1|  glyceraldehyde-3-phosphate dehydrogenase           263   1e-82    
ref|WP_025970042.1|  glyceraldehyde-3-phosphate dehydrogenase           263   1e-82    
ref|WP_025921298.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    263   1e-82    
ref|WP_032515148.1|  glyceraldehyde-3-phosphate dehydrogenase           263   1e-82    
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase           262   2e-82    



>gb|KDO63479.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=293

 Score =   379 bits (972),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY PDEPIISNASCTTNC
Sbjct  55   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC  114

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  115  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  174

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  175  ALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  234

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  235  DEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  293



>gb|KJB11770.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=305

 Score =   378 bits (970),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  67   GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADIYNPDEPIISNASCTTNC  126

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  127  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  186

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  187  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILSVC  246

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  247  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  305



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  79   GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  138

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC  258

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  259  DEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  317



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   376 bits (965),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  79   GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  138

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC  258

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  259  DEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  317



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   379 bits (973),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 236/239 (99%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC
Sbjct  167  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  226

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVC
Sbjct  287  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVC  346

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  347  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSWK  405



>gb|KJB70724.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=303

 Score =   375 bits (962),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  65   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDEPIISNASCTTNC  124

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  125  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  184

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAF+ESA  EL GILSVC
Sbjct  185  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFKESAEKELQGILSVC  244

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            +EPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  245  EEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSWK  303



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 234/239 (98%), Positives = 236/239 (99%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 234/239 (98%), Positives = 236/239 (99%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVC
Sbjct  286  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  346  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY PDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  285  ALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   377 bits (968),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY PDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  285  ALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   375 bits (964),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKF IIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  346  DEPLVSVDFRCTDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   375 bits (963),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  162  GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  221

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL VC
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILEVC  341

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  342  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   375 bits (962),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  163  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL GIL VC
Sbjct  283  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGILDVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  343  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 231/238 (97%), Positives = 234/238 (98%), Gaps = 0/238 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDE IISNASCTTNC
Sbjct  171  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYSPDESIISNASCTTNC  230

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  231  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  290

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  291  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELAGILSVC  350

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA+IVANQW
Sbjct  351  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLANIVANQW  408



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 231/239 (97%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYS DE IISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSHDESIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPN SVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNASVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKVLITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADAYSSDEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  346  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   374 bits (960),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 231/239 (97%), Positives = 236/239 (99%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  163  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  283  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGILSVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  343  DEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  401



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   374 bits (960),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKVLITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADAYSSDEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  346  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_010528120.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=280

 Score =   369 bits (947),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD+EGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY P EPIISNASCTTNC
Sbjct  42   GTGVFVDQEGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYDPAEPIISNASCTTNC  101

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  102  LAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  161

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL GIL VC
Sbjct  162  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELKGILEVC  221

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  222  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  280



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   374 bits (959),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN DAY+PDEPIISNASCTTNC
Sbjct  164  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEDAYNPDEPIISNASCTTNC  223

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GILSVC
Sbjct  284  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAADKELKGILSVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  344  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  402



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   373 bits (958),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  163  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE+A  EL GIL VC
Sbjct  283  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFREAADKELKGILDVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  343  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   373 bits (958),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYS DE IISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSHDESIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   373 bits (958),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNASCTTNC
Sbjct  163  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVNAAFR+SAANEL GIL VC
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRDSAANELQGILEVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  343  DVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   373 bits (958),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  165  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADIYNPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   373 bits (958),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYS DE IISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSHDESIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   373 bits (958),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNASCTTNC
Sbjct  165  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVNAAFR+SAANEL GIL VC
Sbjct  285  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRDSAANELQGILEVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  345  DVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  403



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   373 bits (958),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 231/239 (97%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  346  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  404



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   375 bits (962),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  207  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  266

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  267  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  326

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GILSVC
Sbjct  327  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDTAEKELKGILSVC  386

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  387  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  445



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   373 bits (957),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKH++AGAKKVLITAPGKGDIPTYVVGVNADAYSPDE IISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+S+A EL GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSSAKELAGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   373 bits (957),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELQGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   373 bits (957),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   373 bits (957),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKH++AGAKKVLITAPGKGDIPTYVVGVNADAYSPDE IISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+S+A EL GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSSAKELAGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   372 bits (956),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   372 bits (956),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVNAAFR +A  EL+GILSVC
Sbjct  286  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRNAAEKELNGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  346  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  404



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   372 bits (956),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   372 bits (956),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  162  GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  221

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILEVC  341

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  342  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   372 bits (955),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  162  GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  221

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILEVC  341

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  342  DEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  400



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   372 bits (955),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  162  GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  221

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC  341

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  342  DEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  400



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   372 bits (955),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAY+ DE IISNASCTTNC
Sbjct  167  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYTHDEAIISNASCTTNC  226

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVN AFRESAANEL+GILSVC
Sbjct  287  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNEAFRESAANELNGILSVC  346

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  347  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  405



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   372 bits (954),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDE IISNASCTTNC
Sbjct  164  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDETIISNASCTTNC  223

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  284  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGILSVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  344  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  402



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   372 bits (955),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  170  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDEPIISNASCTTNC  229

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  230  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  289

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAF+ESA  EL GILSVC
Sbjct  290  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFKESAEKELQGILSVC  349

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            +EPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  350  EEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSWK  408



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   372 bits (954),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDE IISNASCTTNC
Sbjct  163  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDESIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL GIL VC
Sbjct  283  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGILDVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  343  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   372 bits (954),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  158  GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  217

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  218  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  277

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  278  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC  337

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  338  DEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  396



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   372 bits (955),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+P EPIISNASCTTNC
Sbjct  173  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPAEPIISNASCTTNC  232

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  233  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  292

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  293  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGILSVC  352

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  353  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  411



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   372 bits (954),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  162  GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  221

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILEVC  341

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  342  DEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   369 bits (948),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  99   GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  158

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  159  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  218

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  219  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC  278

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  279  DEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  337



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   372 bits (954),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  162  GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  221

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC  341

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  342  DEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  400



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   371 bits (953),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  158  GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  217

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  218  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  277

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  278  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC  337

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  338  DEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  396



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   371 bits (953),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 236/239 (99%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD+Y+P+EPIISNASCTTNC
Sbjct  164  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADSYNPEEPIISNASCTTNC  223

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL+GILSVC
Sbjct  284  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELNGILSVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  344  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  402



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   371 bits (952),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGA KHIEAGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  162  GTGVFVDREGAXKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  221

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA  EL GIL VC
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESAEKELKGILEVC  341

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  342  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   371 bits (953),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YS DEPIISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADGYSADEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELKGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  346  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   371 bits (952),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSPDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR VDLADIVAN+WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRAVDLADIVANKWK  403



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   369 bits (947),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKH+EAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  112  GTGVFVDREGAGKHMEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  171

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  172  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  231

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  232  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC  291

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  292  DEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  350



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   370 bits (951),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKH+EAGAKKV+ITAPGKGDIPTYVVGVNADAYS DEPIISNASCTTNC
Sbjct  158  GTGVFVDREGAGKHMEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNC  217

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  218  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  277

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  278  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVC  337

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  338  DEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  396



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   370 bits (951),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS DEPIISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHDEPIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE+A  EL+GILSVC
Sbjct  281  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFREAADKELNGILSVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  341  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  399



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   370 bits (951),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYSPDEPIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL+GILSVC
Sbjct  281  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADKELNGILSVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   370 bits (950),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD +GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD+Y+PDEPIISNASCTTNC
Sbjct  166  GTGVFVDSDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADSYNPDEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL+GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELNGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  346  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   370 bits (950),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKH+ AGAKKVLITAPGKGDIPTYVVGVNADAYSPDE IISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   368 bits (944),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 230/239 (96%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPD+ IISNASCTTNC
Sbjct  106  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDDTIISNASCTTNC  165

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  166  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  225

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  226  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADGELKGILSVC  285

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  286  DEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  344



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   370 bits (949),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ Y+ DEPIISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYNHDEPIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE+A  EL+GIL+VC
Sbjct  281  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFREAADKELNGILAVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  399



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKV+ITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHITAGAKKVIITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+QWK
Sbjct  346  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQWK  404



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNASCTTNC
Sbjct  164  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNASCTTNC  223

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR+SAANEL GIL VC
Sbjct  284  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDSAANELKGILEVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSDVS T+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  344  DVPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  402



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   366 bits (939),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNASCTTNC
Sbjct  79   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCTTNC  138

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VC
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVC  258

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDL+DIVAN WK
Sbjct  259  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNWK  317



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   369 bits (947),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKVLITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNLGFRESAEKELKGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+QWK
Sbjct  346  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQWK  404



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   369 bits (946),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKH+ AGAKKVLITAPGKGDIPTYVVGVNADAY+PDE IISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYNPDETIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   366 bits (940),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKH+ AGAKKVLITAPGKGDIPTYVVGVNADAY+PDE IISNASCTTNC
Sbjct  117  GTGVFVDREGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYNPDETIISNASCTTNC  176

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  177  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  236

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVC
Sbjct  237  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVC  296

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  297  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  355



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   368 bits (944),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD+EGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY P EPIISNASCTTNC
Sbjct  164  GTGVFVDQEGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYDPAEPIISNASCTTNC  223

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL GIL VC
Sbjct  284  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELKGILEVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  344  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  402



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   365 bits (936),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  79   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  138

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  258

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  259  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  317



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   368 bits (944),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  162  GTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  221

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTT SYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTPSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILEVC  341

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  342  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   367 bits (943),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YS DEPIISNASCTTNC
Sbjct  160  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYSADEPIISNASCTTNC  219

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  220  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  279

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL+GILSVC
Sbjct  280  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRETADKELNGILSVC  339

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  340  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  398



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   367 bits (943),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 228/238 (96%), Positives = 232/238 (97%), Gaps = 0/238 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD+EGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+P EPIISNASCTTNC
Sbjct  160  GTGVFVDKEGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPSEPIISNASCTTNC  219

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  220  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  279

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL GILSVC
Sbjct  280  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELQGILSVC  339

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVANQW
Sbjct  340  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVANQW  397



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   367 bits (943),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKV+ITAPGKGDIPTYVVGVNADAY PDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHITAGAKKVIITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+QWK
Sbjct  345  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQWK  403



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   367 bits (943),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKH+ AGAKKVLITAPGKGDIPTYVVGVNADAYSPDE IISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DE LVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DESLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   368 bits (944),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 232/252 (92%), Positives = 235/252 (93%), Gaps = 13/252 (5%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY PDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKF-------------GIIKGTMTTTHSYTGDQrlldashrdlrraraaaL  453
            LAPFVKVLDQKF             GIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAL
Sbjct  225  LAPFVKVLDQKFVTQLNDRIFPMCAGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAL  284

Query  452  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRE  273
            NIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE
Sbjct  285  NIVPTSTGAAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE  344

Query  272  SAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRV  93
            SA NEL GILSVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRV
Sbjct  345  SADNELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRV  404

Query  92   VDLADIVANQWK  57
            VDLADIVAN WK
Sbjct  405  VDLADIVANNWK  416



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   367 bits (942),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH+ AGAKKVLITAPGKGDIPTYVVGVNADAY+PDE IISNASCTTNC
Sbjct  165  GTGVFVDRDGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYNPDETIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVC
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   367 bits (942),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHIEAGAKKVLITAPGKGDIPTYVVGVNAD Y+P EPIISNASCTTNC
Sbjct  164  GTGVFVDRDGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADLYNPAEPIISNASCTTNC  223

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNA FRESA NEL GILSVC
Sbjct  284  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRESADNELKGILSVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+ WK
Sbjct  344  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADNWK  402



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN + Y+PDEPIISNASCTTNC
Sbjct  207  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNVETYNPDEPIISNASCTTNC  266

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  267  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  326

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GILSVC
Sbjct  327  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDTAEKELKGILSVC  386

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  387  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  445



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHIEAGAKKVLITAPGKGDIPTYVVGVNAD Y+  E IISNASCTTNC
Sbjct  160  GTGVFVDRDGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADLYNHSENIISNASCTTNC  219

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  220  LAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  279

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+AANEL+GILSVC
Sbjct  280  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAAANELNGILSVC  339

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDM+KVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  340  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMLKVIAWYDNEWGYSQRVVDLADIVANNWK  398



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNAD Y+PDEPIISNASCTTNC
Sbjct  163  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNADQYNPDEPIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR+SAANEL GIL VC
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDSAANELAGILEVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  343  DAPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  401



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   366 bits (940),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNA+ YS D+ IISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNAELYSHDDTIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA  EL GILSVC
Sbjct  286  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESADKELAGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  346  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  79   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  138

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  258

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  259  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  317



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   366 bits (939),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            +LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VC
Sbjct  285  SLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGILEVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI ANQWK
Sbjct  345  DVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQWK  403



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   366 bits (939),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKV+ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHITAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDHKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+QWK
Sbjct  345  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQWK  403



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   366 bits (939),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKVLITAPGKGDIPTYVVGVN   YS DEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIVAGAKKVLITAPGKGDIPTYVVGVNEYDYSGDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  345  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  79   GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  138

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  258

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  259  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  317



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   365 bits (938),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            +LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VC
Sbjct  285  SLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGILEVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI ANQWK
Sbjct  345  DVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQWK  403



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score =   362 bits (929),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  79   GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  138

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  258

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  259  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  317



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   364 bits (935),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  145  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCTTNC  204

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  205  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  264

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            +LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VC
Sbjct  265  SLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGILEVC  324

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI ANQWK
Sbjct  325  DVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQWK  383



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   364 bits (935),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y PDE IISNASCTTNC
Sbjct  157  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYKPDETIISNASCTTNC  216

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KF IIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  217  LAPFVKVLDEKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  276

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL GILSVC
Sbjct  277  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELKGILSVC  336

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  337  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  395



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+ DE IISNASCTTNC
Sbjct  166  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDESIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNA FR+SA  EL GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRDSAEKELQGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  346  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  404



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   363 bits (933),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+ DE IISNASCTTNC
Sbjct  165  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDESIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNA FR+SA  EL GILSVC
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRDSAEKELQGILSVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  345  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKVLITAPGKGDIPTYVVGVNAD YS  + IISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADGYSHADDIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN AFR+SAA EL GILSVC
Sbjct  286  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRDSAAKELSGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  346  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   363 bits (933),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+ DE IISNASCTTNC
Sbjct  166  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDEXIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNA FR+SA  EL GILSVC
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRDSAEKELQGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  346  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  404



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   363 bits (932),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAK VLITAPGKGDIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  167  GTGVFVDREGAGKHIHAGAKNVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCTTNC  226

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQK GIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK V
Sbjct  227  LAPFVKVLDQKSGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKPV  286

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+L+GKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  287  ALVLPTLRGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGILSVC  346

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGY QRVVDLAD+VA +WK
Sbjct  347  DEPLVSVDFRCRDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYFQRVVDLADVVAEKWK  405



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH+EAGAKKVLITAPGKGDIPTYVVGVNA+ YS  + IISNASCTTNC
Sbjct  165  GTGVFVDRDGAGKHLEAGAKKVLITAPGKGDIPTYVVGVNAELYSHSDTIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVNAAFR++AANEL GIL VC
Sbjct  285  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRDAAANELKGILDVC  344

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  345  DEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  403



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>sp|P12858.2|G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Pisum sativum]
 emb|CAA36396.1| glyceraldehyde-3-phosphate dehydrogenase [Pisum sativum]
Length=405

 Score =   363 bits (931),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAG+HI AGAKKVLITAPGKGDIPTYVVGVNADAY+  + IISNASCTTNC
Sbjct  167  GTGVFVDREGAGRHITAGAKKVLITAPGKGDIPTYVVGVNADAYTHADDIISNASCTTNC  226

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN AFRESAA EL GILSVC
Sbjct  287  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGILSVC  346

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  347  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  405



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI AGAKKVLITAPGKGDIPTYVVGVNAD Y+  + IISNASCTTNC
Sbjct  166  GTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADGYNHADDIISNASCTTNC  225

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN AFR+SAA EL GILSVC
Sbjct  286  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRDSAAKELSGILSVC  345

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  346  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   360 bits (923),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ I+SNASCTTNC
Sbjct  98   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIVSNASCTTNC  157

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  217

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VC
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVC  277

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  278  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  336



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDL+DIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNWK  399



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   358 bits (918),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  78   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCTTNC  137

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  138  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  197

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            +LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VC
Sbjct  198  SLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELIGILEVC  257

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI A +WK
Sbjct  258  DVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICAIKWK  316



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNASCTTNC
Sbjct  98   GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNC  157

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  217

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  277

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  278  DEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  336



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   358 bits (920),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNASCTTNC
Sbjct  98   GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNC  157

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  217

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  218  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  277

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  278  DEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  336



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   358 bits (920),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNASCTTNC
Sbjct  98   GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNC  157

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  217

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  277

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  278  DEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  336



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNASCTTNC
Sbjct  163  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA NEL GILSVC
Sbjct  283  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESADNELKGILSVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVA++W+
Sbjct  343  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADKWQ  401



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   358 bits (919),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  90   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  149

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  150  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  209

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR +AANEL GIL VC
Sbjct  210  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRGAAANELKGILDVC  269

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSV FRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  270  DEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  328



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   358 bits (919),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNASCTTNC
Sbjct  98   GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNC  157

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDA+HRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDAAHRDLRRARAACLNIVPTSTGAAKAV  217

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  277

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  278  DEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  336



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR +AANEL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRGAAANELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSV FRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVNA+ YS  + IISNASCTTNC
Sbjct  161  GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHADTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANE+ GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANEMKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   358 bits (920),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 220/244 (90%), Positives = 233/244 (95%), Gaps = 0/244 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNASCTTNC
Sbjct  98   GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNC  157

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  217

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  277

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*  54
            DEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+ 
Sbjct  278  DEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQG  337

Query  53   MPAS  42
            +  S
Sbjct  338  LEGS  341



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAG+HI AGAKKVLITAP KGDIPTYVVGVNADAY+  + IISNASCTTNC
Sbjct  167  GTGVFVDREGAGRHITAGAKKVLITAPRKGDIPTYVVGVNADAYTHADDIISNASCTTNC  226

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN AFRESAA EL GILSVC
Sbjct  287  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGILSVC  346

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  347  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  405



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSP + IISNASCTTNC
Sbjct  171  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCTTNC  230

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  231  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  290

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VC
Sbjct  291  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVC  350

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  351  DEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  409



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNASCTTNC
Sbjct  163  GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  343  DEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  401



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSP + IISNASCTTNC
Sbjct  171  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCTTNC  230

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  231  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  290

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VC
Sbjct  291  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVC  350

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  351  DEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  409



>gb|ACN39951.1| unknown [Picea sitchensis]
Length=330

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSP + IISNASCTTNC
Sbjct  91   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCTTNC  150

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  151  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  210

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VC
Sbjct  211  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVC  270

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  271  DEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  329



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVN + Y+  + IISNASCTTNC
Sbjct  96   GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNC  155

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  156  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  215

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  216  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADQELKGILSVC  275

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  276  DEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  334



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   357 bits (915),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNASCTTNC
Sbjct  112  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCTTNC  171

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  172  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  231

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  232  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  291

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  292  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  350



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   358 bits (919),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV GVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   358 bits (919),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   356 bits (914),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  112  GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  171

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  172  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  231

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  232  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  291

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  292  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  350



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   358 bits (918),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  161  GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   360 bits (924),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY+  + IISNASCTTNC
Sbjct  228  GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYTHADDIISNASCTTNC  287

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  288  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  347

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A NEL GIL+VC
Sbjct  348  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADNELSGILAVC  407

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  408  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  466



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   358 bits (918),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 220/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR GAGKH+EAGAKKVLITAPGKGDIPTYV GVNAD Y+  + IISNASCTTNC
Sbjct  163  GTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VC
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  343  DEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   358 bits (918),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 220/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR GAGKH+EAGAKKVLITAPGKGDIPTYV GVNAD Y+  + IISNASCTTNC
Sbjct  163  GTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VC
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  343  DEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSP + IISNASCTTNC
Sbjct  171  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCTTNC  230

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGII GTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  231  LAPFVKVLDQKFGIINGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  290

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VC
Sbjct  291  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVC  350

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  351  DEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  409



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   358 bits (918),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVN   YSP + IISNASCTTNC
Sbjct  171  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCTTNC  230

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  231  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  290

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VC
Sbjct  291  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVC  350

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRCSDVSSTVDSSLTMVMGDDMV V+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  351  DEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVNVVAWYDNEWGYSQRVVDLADIVANNWK  409



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   357 bits (917),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 220/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR GAGKH+EAGAKKVLITAPGKGDIPTYV GVNAD Y+  + IISNASCTTNC
Sbjct  164  GTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCTTNC  223

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VC
Sbjct  284  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  344  DEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  402



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 232/278 (83%), Positives = 235/278 (85%), Gaps = 39/278 (14%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNADAY PDEPIISNASCTTNC
Sbjct  165  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFG---------------------------------------IIKGTMTT  531
            LAPFVKVLDQKFG                                       IIKGTMTT
Sbjct  225  LAPFVKVLDQKFGKYQKHLQKSSLSLCSDIIQLRKTQKVTQLNDRIFPMCAGIIKGTMTT  284

Query  530  THSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTP  351
            THSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTP
Sbjct  285  THSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIALRVPTP  344

Query  350  NvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdss  171
            NVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVSSTVDSS
Sbjct  345  NVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDSS  404

Query  170  ltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            LT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  405  LTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  442



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 220/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD+EGAGKH++AGAKKVLITAPGKG IPTYVVGVNA+ YSP EPIISNASCTTNC
Sbjct  164  GTGVFVDQEGAGKHLKAGAKKVLITAPGKGAIPTYVVGVNAEQYSPTEPIISNASCTTNC  223

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA   L+GIL+VC
Sbjct  284  ALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKALNGILAVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+IVA QWK
Sbjct  344  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQWK  402



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVNA+ YS  + IISNASCTTNC
Sbjct  161  GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHADTIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD+EGAGKH++AGAKKVLITAPGKG IPTYVVGVNA+ YSP EPIISNASCTTNC
Sbjct  164  GTGVFVDQEGAGKHLKAGAKKVLITAPGKGAIPTYVVGVNAEQYSPTEPIISNASCTTNC  223

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A   L+GIL+VC
Sbjct  284  ALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADKALNGILAVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+IVA QWK
Sbjct  344  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQWK  402



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   353 bits (905),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 220/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKH++AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNC
Sbjct  112  GTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNC  171

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  172  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  231

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VC
Sbjct  232  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVC  291

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQR VDLADIVAN WK
Sbjct  292  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRDVDLADIVANNWK  350



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score =   348 bits (893),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 217/233 (93%), Positives = 225/233 (97%), Gaps = 0/233 (0%)
 Frame = -2

Query  755  DREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVK  576
            DREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNCLAPFVK
Sbjct  1    DREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNCLAPFVK  60

Query  575  VLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPS  396
            VLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+
Sbjct  61   VLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPN  120

Query  395  LKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVS  216
            LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVS
Sbjct  121  LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVS  180

Query  215  VDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            VDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  VDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  233



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            G GVFVDREGAGKH++AGAKKVLITAPGKGDIPTYV GVN D Y P E IISNASCTTNC
Sbjct  172  GPGVFVDREGAGKHLQAGAKKVLITAPGKGDIPTYVCGVNEDKYYPAEEIISNASCTTNC  231

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  232  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  291

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL GIL+VC
Sbjct  292  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRETADKELKGILAVC  351

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  352  DEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  410



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  154  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCTTNC  213

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  214  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  273

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            AL   +L+G    + LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL GIL VC
Sbjct  274  ALSSQALRGSSMALPLRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGILDVC  333

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  334  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  392



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 215/239 (90%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDRE AGKHI AGAKKVLITAPGKGDIPTYVVGVN   YS DEPIISNASCTTNC
Sbjct  165  GTGVFVDRERAGKHIVAGAKKVLITAPGKGDIPTYVVGVNEYDYSGDEPIISNASCTTNC  224

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTT SYTGD+ L  +     R   AA  NIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTPSYTGDRALDASHRDLRRARAAAL-NIVPTSTGAAKAV  283

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  284  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILSVC  343

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEP VSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  344  DEPFVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  402



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   344 bits (882),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 211/238 (89%), Positives = 227/238 (95%), Gaps = 0/238 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD+EGAGKH++AGAKKVLITAPGKG IPTYV+GVN + Y P E IISNASCTTNC
Sbjct  119  GTGVFVDKEGAGKHLQAGAKKVLITAPGKGPIPTYVIGVNEELYDPSEQIISNASCTTNC  178

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  179  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  238

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  ++ GIL+VC
Sbjct  239  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAANGDMKGILAVC  298

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W
Sbjct  299  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  356



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 211/238 (89%), Positives = 227/238 (95%), Gaps = 0/238 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD+EGAGKH++AGAKKVLITAPGKG IPTYV+GVN + Y P E IISNASCTTNC
Sbjct  160  GTGVFVDKEGAGKHLQAGAKKVLITAPGKGPIPTYVIGVNEELYDPSEQIISNASCTTNC  219

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  220  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  279

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  ++ GIL+VC
Sbjct  280  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAANGDMKGILAVC  339

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W
Sbjct  340  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  397



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 219/239 (92%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVFVD  GAGKHIEAGAKKVLITAP KG DIPTYVVGVN   Y P  PIISNASCTTN
Sbjct  74   GTGVFVDSAGAGKHIEAGAKKVLITAPAKGSDIPTYVVGVNDQDYDPSAPIISNASCTTN  133

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVK+L  KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  134  CLAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA  193

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVS+VDLV+Q  KKTFAEEVNAAFRE+A   L GIL+V
Sbjct  194  VALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTFAEEVNAAFREAANGPLKGILAV  253

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
            CDEPLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN W
Sbjct  254  CDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  312



>gb|ABG35250.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35251.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35252.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35253.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35256.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35257.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35258.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35259.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35260.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35261.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35262.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35263.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35264.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35265.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35266.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35268.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35269.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35270.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35271.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35272.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35273.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35274.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35275.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35276.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35277.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35278.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35279.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35280.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35281.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35282.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35283.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35284.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35285.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35286.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35287.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35288.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35289.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35290.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35291.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35292.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35293.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35294.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35295.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35296.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35297.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35298.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35299.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35300.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35301.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35302.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35303.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35304.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35305.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35306.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35307.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35308.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35309.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35310.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35311.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35312.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35313.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   334 bits (857),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 213/224 (95%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  728  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGII  549
            EAGAKKVLITAPGKGDIPTYVVGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGII
Sbjct  1    EAGAKKVLITAPGKGDIPTYVVGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGII  60

Query  548  KGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  369
            KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  61   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  120

Query  368  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  189
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  121  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  180

Query  188  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  224



>emb|CAC80372.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=314

 Score =   337 bits (863),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 212/221 (96%), Positives = 218/221 (99%), Gaps = 0/221 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  94   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCTTNC  153

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  154  LAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  213

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL+GILSVC
Sbjct  214  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELNGILSVC  273

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEW  111
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEW
Sbjct  274  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEW  314



>gb|ABG35267.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   333 bits (853),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 212/224 (95%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = -2

Query  728  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGII  549
            EAGAKKVLITAPGKGDIPTYVVGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGII
Sbjct  1    EAGAKKVLITAPGKGDIPTYVVGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGII  60

Query  548  KGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  369
            KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  61   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  120

Query  368  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  189
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  121  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  180

Query  188  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            STVDSSLTMVMGDDMVKVIAWYD+EWGYSQRVVDLADIVAN WK
Sbjct  181  STVDSSLTMVMGDDMVKVIAWYDHEWGYSQRVVDLADIVANNWK  224



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 219/239 (92%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVFVD  GAGKHIEAGAKKVLITAP KG DIPTYVVGVN   Y P  PIISNASCTTN
Sbjct  96   GTGVFVDSAGAGKHIEAGAKKVLITAPAKGSDIPTYVVGVNDQDYDPSAPIISNASCTTN  155

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVK+L  KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  156  CLAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA  215

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVS+VDLV+Q  KKTFAEEVNAAFRE+A   L GIL+V
Sbjct  216  VALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTFAEEVNAAFREAANGPLKGILAV  275

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
            CDEPLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN W
Sbjct  276  CDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  334



>ref|XP_008663264.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58480.1| hypothetical protein ZEAMMB73_511551 [Zea mays]
Length=401

 Score =   337 bits (865),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD EGAGKHI+AGAKKVLITAP KG+IPTYVVGVNAD Y+PDEPII+NASCTTNC
Sbjct  163  GTGVFVDHEGAGKHIQAGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIINNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
              PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AAKAV
Sbjct  223  RVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL VC
Sbjct  283  ALVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGILEVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQWK
Sbjct  343  DVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQWK  401



>ref|XP_008663258.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58475.1| hypothetical protein ZEAMMB73_739238 [Zea mays]
Length=401

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD E AGKHI+AGAKKVLITAP KG+IPTYVVGVNAD Y+PDEPIISNASCTTNC
Sbjct  163  GTGVFVDHESAGKHIQAGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIISNASCTTNC  222

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
              PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AAKAV
Sbjct  223  RVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAAKAV  282

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL VC
Sbjct  283  ALVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGILEVC  342

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQWK
Sbjct  343  DVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQWK  401



>ref|XP_010929533.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic [Elaeis guineensis]
Length=261

 Score =   331 bits (848),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 212/240 (88%), Positives = 223/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITA-PGKGDIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVFV+REGAGK+I+A        + PG+GDIPTYVVGVNA+ Y+PDEPIISNASCTTN
Sbjct  22   GTGVFVEREGAGKNIQAAGGADGAXSWPGEGDIPTYVVGVNAETYNPDEPIISNASCTTN  81

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CL+PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  82   CLSPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA  141

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP+LKGKLN IALRVPTPNVSVVDLVVQVSKK  AEE+NAAFR+SA  EL GILSV
Sbjct  142  VALVLPTLKGKLNEIALRVPTPNVSVVDLVVQVSKKILAEEINAAFRDSAEKELRGILSV  201

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  202  CDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  261



>gb|AFW58485.1| hypothetical protein ZEAMMB73_956640 [Zea mays]
Length=372

 Score =   334 bits (857),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD EGAGKHI+ GAKKVLITAP KG+IPTYVVGVNAD Y+PDEPIISN SCTTNC
Sbjct  134  GTGVFVDHEGAGKHIQVGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIISNTSCTTNC  193

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
              PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AAKAV
Sbjct  194  RVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAAKAV  253

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
             LVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL VC
Sbjct  254  VLVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGILEVC  313

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQWK
Sbjct  314  DVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQWK  372



>emb|CAC80373.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=312

 Score =   332 bits (850),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 212/219 (97%), Positives = 215/219 (98%), Gaps = 0/219 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYVVGVNAD YSPDEPIISNASCTTNC
Sbjct  94   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYSPDEPIISNASCTTNC  153

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  154  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  213

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVC
Sbjct  214  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELAGILSVC  273

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDN  117
            DEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDN
Sbjct  274  DEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDN  312



>gb|ABG35254.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35255.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   328 bits (840),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 210/224 (94%), Positives = 216/224 (96%), Gaps = 0/224 (0%)
 Frame = -2

Query  728  EAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGII  549
            EAGAKK +I APGKGDIPTYVVGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGII
Sbjct  1    EAGAKKGVIRAPGKGDIPTYVVGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGII  60

Query  548  KGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  369
            KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  61   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  120

Query  368  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  189
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  121  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  180

Query  188  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  224



>ref|XP_008664191.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Zea mays]
Length=420

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD EGAGKHI+ GAKKVLITAP KG+IPTYVVGVNAD Y+PDEPIISN SCTTNC
Sbjct  182  GTGVFVDHEGAGKHIQVGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIISNTSCTTNC  241

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
              PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AAKAV
Sbjct  242  RVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAAKAV  301

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
             LVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL VC
Sbjct  302  VLVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGILEVC  361

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQWK
Sbjct  362  DVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQWK  420



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score =   331 bits (848),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 209/240 (87%), Gaps = 12/240 (5%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAK VLITAPGKGDIPTYVVGVNAD Y+PDEPIISNASC    
Sbjct  118  GTGVFVDRDGAGKHIQAGAKXVLITAPGKGDIPTYVVGVNADIYNPDEPIISNASC----  173

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
              PFVKVLDQKFGIIKGTMTTTHSYTGDQR LD   R          NIVPTSTGAAKAV
Sbjct  174  -XPFVKVLDQKFGIIKGTMTTTHSYTGDQRFLDXRARAAAL------NIVPTSTGAAKAV  226

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK-TFAEEVNAAFRESAANELDGILSV  237
             LVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KK TFAEEVNA FRES  NEL GILSV
Sbjct  227  VLVLPTLKGKLNGIALRVPTPNVSVVDLVVQVTKKXTFAEEVNAVFRESTENELKGILSV  286

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRCSDVSSTVDS LTMV+GDDMVKVIAWYDNE GYSQRVVDLADIVA+ WK
Sbjct  287  CDEPLVSVDFRCSDVSSTVDSXLTMVVGDDMVKVIAWYDNEXGYSQRVVDLADIVAHNWK  346



>dbj|BAN09110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Artemisia 
indica]
Length=241

 Score =   327 bits (837),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 209/223 (94%), Positives = 216/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR+GAGKHI+AGAKKVLITAPGKGDIPTYVVGVNA+ Y+  E IISNASCTTNC
Sbjct  19   GTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYNHSEDIISNASCTTNC  78

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA 
Sbjct  79   LAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAA  138

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLPSLKGKLNGIALR PTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVC
Sbjct  139  ALVLPSLKGKLNGIALRAPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVC  198

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  105
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGY
Sbjct  199  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGY  241



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 223/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGD-IPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D +GAGKHIEAGAKKVLITAP KGD IPT+V GVNAD Y  + PIISNASCTTN
Sbjct  130  GTGVFIDTKGAGKHIEAGAKKVLITAPAKGDGIPTFVCGVNADDYKHEYPIISNASCTTN  189

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            C+APFVKVL++KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAA+NIVPTSTGAAKA
Sbjct  190  CMAPFVKVLEEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKA  249

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLPS+KGKLNGIALRVPTPNVS+VDLVVQV KKTFAEEVNAAFRE+A     G+L+V
Sbjct  250  VALVLPSMKGKLNGIALRVPTPNVSIVDLVVQVEKKTFAEEVNAAFREAANGAQKGVLAV  309

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
             DEPLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+I A +W+
Sbjct  310  SDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQKWE  369



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 205/238 (86%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GAGKHI AGAKKVLITAPGKG +IPTYVVGVNAD Y   + I+SNASCTTN
Sbjct  47   GTGVFIDEAGAGKHITAGAKKVLITAPGKGPNIPTYVVGVNADQYKSTDTIVSNASCTTN  106

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPF KVLD KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  107  CLAPFAKVLDDKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA  166

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+L+V
Sbjct  167  VALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGVLAV  226

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            CDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+ANQ
Sbjct  227  CDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMANQ  284



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 209/240 (87%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKHI+AGAKKVLITAPGKG IPTYVVGVN   Y   + IISNASCTTNC
Sbjct  160  GTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEKDYKHSDSIISNASCTTNC  219

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  220  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  279

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRES-AANELDGILSV  237
            ALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++ A  EL G+L+V
Sbjct  280  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACATEELKGVLAV  339

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA IVA +W+
Sbjct  340  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKWQ  399



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 209/240 (87%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKHI+AGAKKVLITAPGKG IPTYVVGVN   Y   + IISNASCTTNC
Sbjct  167  GTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEKDYKHSDSIISNASCTTNC  226

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRES-AANELDGILSV  237
            ALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++ A  EL G+L+V
Sbjct  287  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACATEELKGVLAV  346

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA IVA +W+
Sbjct  347  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKWQ  406



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   330 bits (845),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKHI+AGAKKVLITAPGKG IPTYVVGVN   Y   + IISNASCTTNC
Sbjct  161  GTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEQDYKHSDAIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGILSV  237
            ALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+L+V
Sbjct  281  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACETEQLKGVLAV  340

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  341  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  400



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   325 bits (832),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 203/238 (85%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GAGKHI AGAKKVLITAPGKG +IPTYVVGVNAD Y   + I+SNASCTTN
Sbjct  47   GTGVFIDEAGAGKHITAGAKKVLITAPGKGPNIPTYVVGVNADQYKSTDTIVSNASCTTN  106

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPF KVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  107  CLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA  166

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+L+V
Sbjct  167  VALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGVLAV  226

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            CDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+A +
Sbjct  227  CDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  284



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score =   325 bits (833),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 203/238 (85%), Positives = 219/238 (92%), Gaps = 1/238 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GAGKHI AGAKKVLITAPGKG +IPTYVVGVNAD Y   + I+SNASCTTN
Sbjct  73   GTGVFIDEAGAGKHITAGAKKVLITAPGKGPNIPTYVVGVNADQYKSTDTIVSNASCTTN  132

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPF KVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  133  CLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA  192

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+L+V
Sbjct  193  VALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGVLAV  252

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            CDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+A +
Sbjct  253  CDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  310



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKHI+AGAKKVLITAPGKG IPTYVVGVN   Y   + IISNASCTTNC
Sbjct  167  GTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEQDYKHSDAIISNASCTTNC  226

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGILSV  237
            ALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+L+V
Sbjct  287  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACETEQLKGVLAV  346

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  347  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  406



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKHI+AGAKKVLITAPGKG IPT+VVGVN   Y   + IISNASCTTNC
Sbjct  167  GTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTFVVGVNEQDYKHSDAIISNASCTTNC  226

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGILSV  237
            ALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+L+V
Sbjct  287  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACQTEQLKGVLAV  346

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  347  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWE  406



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   327 bits (838),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKHI+AGAKKVLITAPGKG IPT+VVGVN   Y   + IISNASCTTNC
Sbjct  139  GTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTFVVGVNEQDYKHSDAIISNASCTTNC  198

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  199  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  258

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGILSV  237
            ALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+L+V
Sbjct  259  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACQTEQLKGVLAV  318

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  319  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWE  378



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   327 bits (838),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 219/239 (92%), Gaps = 13/239 (5%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKHI+AGAKKVLITAPGKGDIPTYV+GVNA+ Y+PDE IISNASCTTNC
Sbjct  161  GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVIGVNAETYNPDETIISNASCTTNC  220

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL+GILSVC
Sbjct  281  ALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADKELNGILSVC  340

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRC+DVSSTVD+SLTMVMGDDMVK             RVVDLADIVAN WK
Sbjct  341  DEPLVSVDFRCTDVSSTVDASLTMVMGDDMVK-------------RVVDLADIVANNWK  386



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 202/239 (85%), Gaps = 27/239 (11%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDR GAGKH+EAGAKKVLITAPGKGDIPTYV GVNAD Y+  + IISNASCTTNC
Sbjct  154  GTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCTTNC  213

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRL                           AV
Sbjct  214  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRL---------------------------AV  246

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VC
Sbjct  247  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVC  306

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVA+QWK
Sbjct  307  DEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADQWK  365



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   325 bits (832),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 220/240 (92%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GAGKHI AGAKKVLITAPGKG +IPTYVVGVNAD Y   + I+SNASCTTN
Sbjct  94   GTGVFIDEAGAGKHITAGAKKVLITAPGKGPNIPTYVVGVNADQYKSTDTIVSNASCTTN  153

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPF KVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  154  CLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA  213

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+L+V
Sbjct  214  VALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGVLAV  273

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+A + K
Sbjct  274  CDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKEMK  333



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKH++AGAKKVLITAPGKG IPTYV+GVN   Y+  + IISNASCTTNC
Sbjct  138  GTGVFVDEAGAGKHLQAGAKKVLITAPGKGAIPTYVIGVNEQDYTHADKIISNASCTTNC  197

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  198  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  257

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAAN-ELDGILSV  237
            ALVLP LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++    +L GIL+V
Sbjct  258  ALVLPRLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACETPQLKGILAV  317

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  318  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  377



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 214/239 (90%), Gaps = 20/239 (8%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREG                    DIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  162  GTGVFVDREG--------------------DIPTYVVGVNADAYNPDEPIISNASCTTNC  201

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  202  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  261

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA  EL GIL VC
Sbjct  262  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESAEKELKGILEVC  321

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  322  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  380



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKHI+AGAKKVLITAPGKG IPTYVVGVN   Y   + IISNASCTTNC
Sbjct  84   GTGVFVDEAGAGKHIQAGAKKVLITAPGKGPIPTYVVGVNEQDYKHSDTIISNASCTTNC  143

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  144  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  203

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESA-ANELDGILSV  237
            ALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT AEEVN AFR++   ++L G+L+V
Sbjct  204  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTSAEEVNQAFRDACNTDQLKGVLAV  263

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+DVSSTVDSSLTMVMG+DMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  264  CDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  323



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 214/239 (90%), Gaps = 20/239 (8%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREG                    DIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  162  GTGVFVDREG--------------------DIPTYVVGVNADAYNPDEPIISNASCTTNC  201

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  202  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  261

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GIL VC
Sbjct  262  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELKGILEVC  321

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  322  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  380



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 214/239 (90%), Gaps = 20/239 (8%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREG                    DIPTYVVGVNADAY+PDEPIISNASCTTNC
Sbjct  162  GTGVFVDREG--------------------DIPTYVVGVNADAYNPDEPIISNASCTTNC  201

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  202  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  261

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEE+NAAFR+SA  EL GIL VC
Sbjct  262  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEINAAFRDSAEKELKGILEVC  321

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  322  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  380



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKHI+AGAKKVLITAPGKG IPTYVVGVN   Y   + IISNASCTTNC
Sbjct  137  GTGVFVDEAGAGKHIQAGAKKVLITAPGKGPIPTYVVGVNEQDYKHSDTIISNASCTTNC  196

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  197  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  256

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESA-ANELDGILSV  237
            ALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT AEEVN AFR++   ++L G+L+V
Sbjct  257  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTSAEEVNQAFRDACNTDQLKGVLAV  316

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+DVSSTVDSSLTMVMG+DMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  317  CDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  376



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVFV  EGAGKHI AGAKKVLITAP KG D+PTYVVGVNAD Y   + IISNASCTTN
Sbjct  172  GTGVFVSSEGAGKHIAAGAKKVLITAPAKGSDVPTYVVGVNADQYKHSDNIISNASCTTN  231

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVKVLD+K GI+KGT+TTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  232  CLAPFVKVLDEKLGIVKGTVTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  291

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP+LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVN AFRE+A   + GIL V
Sbjct  292  VALVLPNLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNEAFREAANGPMKGILVV  351

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
             DEPLVS DF CSD SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+IVA +W
Sbjct  352  SDEPLVSKDFACSDQSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEIVAKKW  410



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGK-GDIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GAGKH+ AGAKKV+ITAP K   IPT+V+GVN   Y  + PI+SNASCTTN
Sbjct  24   GTGVFIDEAGAGKHLTAGAKKVIITAPAKDKSIPTFVIGVNDKDYKHEYPIVSNASCTTN  83

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            C+APF KVLD KFGI+KG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  84   CMAPFCKVLDAKFGIVKGVMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  143

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP+LKGKLNG ALRVPTPNVS+VDLV+QV KKTFAEEVN AFRE+AA E+ G+L+V
Sbjct  144  VALVLPNLKGKLNGFALRVPTPNVSIVDLVIQVEKKTFAEEVNNAFREAAAGEMKGVLAV  203

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
            CDEPLVSVDFRC+DVS ++DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA++ A++W
Sbjct  204  CDEPLVSVDFRCTDVSVSIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAELAASKW  262



>gb|ACA35006.1| glyceraldehyde-3-phosphate dehydrogenase [Dunaliella salina]
Length=376

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 214/239 (90%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GAGKHI+AGAKKVLITAP KG DIPT+VVGVN D Y  D PI+SNASCTTN
Sbjct  136  GTGVFIDTPGAGKHIQAGAKKVLITAPAKGSDIPTFVVGVNCDGYKHDYPIVSNASCTTN  195

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVKVL +KFG++KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  196  CLAPFVKVLHEKFGVVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  255

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNG+ALRVPTPNVS+VDLVVQV KKTFAEEVN AFRE+AA  +  +L+V
Sbjct  256  VALVLPELKGKLNGVALRVPTPNVSIVDLVVQVEKKTFAEEVNNAFREAAAGPMKNVLAV  315

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
             DEPLVS DF+  D S+ +DS+LTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+I A +W
Sbjct  316  ADEPLVSADFKGMDQSTAIDSALTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQRW  374



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGK-GDIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D+ GAGKHI+AGAKKVLITAP K  DIPT+VVGVN   Y  + PIISNASCTTN
Sbjct  134  GTGVFIDKVGAGKHIQAGAKKVLITAPAKDKDIPTFVVGVNEADYKHEYPIISNASCTTN  193

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVKVL +KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  194  CLAPFVKVLQEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  253

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTP VSVVDLVVQV KKTFAEEVNAAFRE+AA  + G+L V
Sbjct  254  VALVLPQLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAAAGPMKGVLHV  313

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
             D PLVS+DF+C+D S+++DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A +W
Sbjct  314  EDAPLVSIDFKCTDQSTSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAQKW  372



>gb|ABD37958.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Chara vulgaris]
Length=318

 Score =   312 bits (800),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 207/223 (93%), Gaps = 0/223 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVDREGAGKH++AGAKKVLITAPGKGDIPTYVVGVN   Y P E IISNASCTTNC
Sbjct  96   GTGVFVDREGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNDADYDPSETIISNASCTTNC  155

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD KF I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  156  LAPFVKVLDNKFTIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  215

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQ +KKTFAEEVN AFRESA   L GIL+VC
Sbjct  216  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTAKKTFAEEVNNAFRESADGPLKGILAVC  275

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  105
            DEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNE GY
Sbjct  276  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNELGY  318



>emb|CAC80394.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=283

 Score =   311 bits (797),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 212/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD+EGAGKH++AGAKKVLITAPGKG IPTYVVGVN + YS  + IISNASCTTNC
Sbjct  61   GTGVFVDKEGAGKHLQAGAKKVLITAPGKGAIPTYVVGVNEEQYSHRDEIISNASCTTNC  120

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  121  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  180

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFR+++A  L GIL+VC
Sbjct  181  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDASAGALKGILAVC  240

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  105
            DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKV+AWYD EWGY
Sbjct  241  DEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDXEWGY  283



>ref|XP_011399143.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 219/240 (91%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVFVDR+GA KH++AGAKKV+ITAP KG D+PTYV+GVNAD YS  + IISNASCTTN
Sbjct  173  GTGVFVDRKGASKHLQAGAKKVIITAPAKGSDVPTYVMGVNADQYSNSDDIISNASCTTN  232

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVKVL+ +FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  233  CLAPFVKVLNDRFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  292

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNG+ALRVPTP VSVVDLV+Q  KKTF EEVN+AFRE++   L GIL+V
Sbjct  293  VALVLPQLKGKLNGVALRVPTPTVSVVDLVIQTEKKTFTEEVNSAFREASEGYLKGILAV  352

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
             DEPLVS D+R +DVSST+D++LTMVMGDDMVKVIAWYDNEWGYSQRVVDLA++VA +W+
Sbjct  353  SDEPLVSCDYRMTDVSSTIDAALTMVMGDDMVKVIAWYDNEWGYSQRVVDLAELVAQKWE  412



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGK-GDIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D+ GAGKHI+AGA KVLITAP K  DIPT+VVGVN   Y  + PIISNASCTTN
Sbjct  129  GTGVFIDKVGAGKHIQAGAHKVLITAPAKDKDIPTFVVGVNDADYKHEYPIISNASCTTN  188

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVKVL+QKFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  189  CLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  248

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLPSLKGKLNGIALRVPTP VSVVDLVVQV KKTFAEEVNAAFRE+A   + G+L V
Sbjct  249  VALVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGVLHV  308

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
             D PLVS+DF+C+D S+++D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+I A +W
Sbjct  309  EDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAKKW  367



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 214/240 (89%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGD-IPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GA KH+ AGAKKV+ITAP KGD IPTYV+GVNAD Y   + IISNASCTTN
Sbjct  140  GTGVFIDTPGASKHLTAGAKKVVITAPAKGDDIPTYVLGVNADQYKNSDKIISNASCTTN  199

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
             LAPFVKVL+ KFG++KG MTTTHSYTGDQ++LDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  200  GLAPFVKVLNDKFGLVKGLMTTTHSYTGDQKILDASHRDLRRARAAALNIVPTSTGAAKA  259

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLV+Q SKK  AEEVN AFRESAA  L GILSV
Sbjct  260  VALVLPELKGKLNGIALRVPTPNVSVVDLVIQTSKKVTAEEVNNAFRESAAGPLKGILSV  319

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            CDEPLVSVDFRC+D S+T+DS+LTMV+GDDM+KV+AWYDNEWGYSQRVVDLA++ A  W+
Sbjct  320  CDEPLVSVDFRCTDQSTTIDSALTMVIGDDMLKVVAWYDNEWGYSQRVVDLAELTAANWE  379



>emb|CAC80393.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=318

 Score =   312 bits (799),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 213/223 (96%), Gaps = 0/223 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD+EGAGKH++AGAKKVLITAPGKG IPTYVVGVNAD Y+  + IISNASCTTNC
Sbjct  96   GTGVFVDKEGAGKHLKAGAKKVLITAPGKGAIPTYVVGVNADEYNHGDEIISNASCTTNC  155

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  156  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  215

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFR+++A  L GIL+VC
Sbjct  216  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDASAGPLKGILAVC  275

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  105
            DEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWY NEWGY
Sbjct  276  DEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYXNEWGY  318



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGK-GDIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D+ GAGKHI+AGA KVLITAP K  DIPT+VVGVN   Y  + PIISNASCTTN
Sbjct  134  GTGVFIDKVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKHEYPIISNASCTTN  193

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVKVL+QKFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  194  CLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  253

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            V+LVLPSLKGKLNGIALRVPTP VSVVDLVVQV KKTFAEEVNAAFRE+A   + G+L V
Sbjct  254  VSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGVLHV  313

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
             D PLVS+DF+C+D S+++D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A +W
Sbjct  314  EDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAKKW  372



>emb|CAC80392.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Spirogyra 
sp.]
Length=318

 Score =   311 bits (797),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 196/223 (88%), Positives = 209/223 (94%), Gaps = 0/223 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVF+D  GAGKHIEAGAKKVLITAPGKG IPTYVVGVNAD Y   EPIISNASCTTNC
Sbjct  96   GTGVFIDGPGAGKHIEAGAKKVLITAPGKGPIPTYVVGVNADKYVHSEPIISNASCTTNC  155

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVK+L++KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  156  LAPFVKILEEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  215

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            +LVLPSLKGKLNGIALRVPTPNVSVVDLV+Q  KKTFAEEVNAAFRE+AA  + G+L+VC
Sbjct  216  SLVLPSLKGKLNGIALRVPTPNVSVVDLVIQTEKKTFAEEVNAAFREAAAGPMKGVLAVC  275

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  105
            DEPLVS+DFRCSDVS T+DSSLTMVMGDDMVKV+AWYDNE GY
Sbjct  276  DEPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNELGY  318



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFV  EGAGKH++AGAKKV+ITAPGKGDIPT+V+GVN+D Y  + PIISNASCTTNC
Sbjct  138  GTGVFVSEEGAGKHLQAGAKKVIITAPGKGDIPTFVMGVNSDDYKHEYPIISNASCTTNC  197

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKV+ +KFG++KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  198  LAPFVKVIVEKFGVVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  257

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT AEEVN AFR++AA  L G+L V 
Sbjct  258  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTLAEEVNQAFRDAAAGPLKGVLGVA  317

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            D PLVS+DF+ SDVS+T+DS+LTMVMGDDMVKV+AWYDNEWGYSQRV+DLA++ A +W+
Sbjct  318  DIPLVSMDFKKSDVSTTIDSALTMVMGDDMVKVVAWYDNEWGYSQRVLDLAELCAEKWE  376



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 214/236 (91%), Gaps = 1/236 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVFV  +GAGKHI+AGAKKVLITAP KG DIPTYV+GVN D + P  PIISNASCTTN
Sbjct  155  GTGVFVSSDGAGKHIKAGAKKVLITAPAKGNDIPTYVIGVNDDTFDPSAPIISNASCTTN  214

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPF KVL +KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  215  CLAPFAKVLHEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  274

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKT AEEVN AFR +AANEL GIL+V
Sbjct  275  VALVLPELKGKLNGIALRVPTPNVSVVDLVIQVEKKTLAEEVNEAFRNAAANELKGILAV  334

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVA  69
             D PLVS DF  +DVS+T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA
Sbjct  335  SDVPLVSRDFALTDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELVA  390



>gb|ABC00187.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
 gb|ABC00188.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
Length=376

 Score =   312 bits (799),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 213/239 (89%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVFVD  GAGKHI+AGAKKVLITAP KG DIPT+VVGVN D Y+   PIISNASCTTN
Sbjct  136  GTGVFVDTPGAGKHIQAGAKKVLITAPAKGNDIPTFVVGVNCDGYNHSYPIISNASCTTN  195

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVKVL +KF I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  196  CLAPFVKVLHEKFRIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  255

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNG+ALRVPTPNVS+VDLVVQV KKTFAEEVN AFRE+AA  +  +L+V
Sbjct  256  VALVLPDLKGKLNGVALRVPTPNVSIVDLVVQVEKKTFAEEVNNAFREAAAGPMSNVLAV  315

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
             DEPLVS DF+  D S+ +DS+LTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A +W
Sbjct  316  ADEPLVSADFKGMDQSTAIDSALTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELTAQRW  374



>gb|ABD37953.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorella 
sp. JP-2005]
Length=316

 Score =   309 bits (791),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 212/240 (88%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D +GA KHIEAGAKKVLITAP KG DIPTYVVGVN   Y   + IISNASCTTN
Sbjct  77   GTGVFIDTKGASKHIEAGAKKVLITAPAKGSDIPTYVVGVNEQDYKHSDAIISNASCTTN  136

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVKVLD+KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKA
Sbjct  137  CLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKA  196

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNG+ALRVPTP VSVVDLVVQV KKTFAEEVN AFRE+A   L GIL V
Sbjct  197  VALVLPKLKGKLNGVALRVPTPTVSVVDLVVQVEKKTFAEEVNEAFREAANGPLKGILGV  256

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
             DEPLVS DF+ ++VSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA   A  W+
Sbjct  257  SDEPLVSCDFKMTNVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAAYTAKHWE  316



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   308 bits (789),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -2

Query  683  DIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQr  504
            DIPTYVVGVNADAY+PD+PIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQR
Sbjct  160  DIPTYVVGVNADAYNPDKPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQR  219

Query  503  lldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvv  324
            LLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK NGIALRVPTPNVSVVDLVV
Sbjct  220  LLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKHNGIALRVPTPNVSVVDLVV  279

Query  323  qVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDM  144
            QV+KKTFAEEVNAAFR SA  EL GIL VCDEPLVSVDF+CSDVSST+DSSLTMVMGDDM
Sbjct  280  QVTKKTFAEEVNAAFRNSAEKELKGILKVCDEPLVSVDFKCSDVSSTIDSSLTMVMGDDM  339

Query  143  VKVIAWYDNEWGYSQRVVDLADIVANQWK  57
            VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  340  VKVIAWYDNEWGYSQRVVDLADIVANNWK  368



>gb|ABD37954.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cyanophora 
paradoxa]
Length=412

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 197/237 (83%), Positives = 215/237 (91%), Gaps = 2/237 (1%)
 Frame = -2

Query  770  TGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTTN  597
            TGVF+D  GAGKHI AGAKKV+ITAP KG DIPTYVVGVN   Y+P  + I+SNASCTTN
Sbjct  174  TGVFIDGPGAGKHIAAGAKKVVITAPAKGSDIPTYVVGVNHKDYNPSTDHIVSNASCTTN  233

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
            CLAPFVKVLD+KF IIKGTMTTTHSYTGDQRLLDASHRDLRRARAAA+NIVPTSTGAAKA
Sbjct  234  CLAPFVKVLDEKFKIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKA  293

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP+LKGKLNG+ALRVPTPNVS+VDLVVQV KKTFA+EVNAA RE+A  +L G+L V
Sbjct  294  VALVLPNLKGKLNGLALRVPTPNVSIVDLVVQVEKKTFADEVNAALREAANTDLKGVLVV  353

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  66
             DEPLVS DFRC+D SST+D+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA+IVA 
Sbjct  354  SDEPLVSCDFRCTDQSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAEIVAQ  410



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   308 bits (788),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 188/239 (79%), Positives = 213/239 (89%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGD-IPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GA KH+EAGA+KVLITAP KGD IPTYV+GVNAD Y+  + IISNASCTTN
Sbjct  137  GTGVFIDTPGASKHLEAGAEKVLITAPAKGDDIPTYVMGVNADQYTHADKIISNASCTTN  196

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
             LAPF KVLD KFGI+KG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  197  GLAPFAKVLDDKFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKA  256

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVD+ +Q  KK  AEE+NAAFRE+A   + GIL+V
Sbjct  257  VALVLPQLKGKLNGIALRVPTPNVSVVDMCIQTEKKCTAEEINAAFREAAEGPMKGILAV  316

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
             DEPLVS+DFRCSDVS+T+D++LTMVMGDD++KV+AWYDNEWGYSQRVVDLA++ A +W
Sbjct  317  ADEPLVSIDFRCSDVSTTIDAALTMVMGDDLIKVVAWYDNEWGYSQRVVDLAELTATKW  375



>gb|ABG85190.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus 'lucimarinus']
Length=380

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 214/240 (89%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGD-IPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GA KH+ AGAKKV+ITAP KGD IPTYV+GVNAD Y   + I+SNASCTTN
Sbjct  141  GTGVFIDTPGASKHLTAGAKKVVITAPAKGDDIPTYVLGVNADQYKNTDKIVSNASCTTN  200

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
             LAPFVKVLD +FGI+KG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  201  GLAPFVKVLDDRFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKA  260

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLV+Q SKK  A+EVNAAFRE AA +L GIL+V
Sbjct  261  VALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKKVTADEVNAAFREEAAGKLKGILAV  320

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
             DEPLVS DF+CSDVS+++D++LTMVMGDDM+KV+AWYDNEWGYSQRVVDLA++ A  W+
Sbjct  321  ADEPLVSCDFKCSDVSTSIDAALTMVMGDDMLKVVAWYDNEWGYSQRVVDLAELCAANWE  380



>ref|XP_001420043.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98336.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=341

 Score =   305 bits (781),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 214/240 (89%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGD-IPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GA KH+ AGAKKV+ITAP KGD IPTYV+GVNAD Y   + I+SNASCTTN
Sbjct  102  GTGVFIDTPGASKHLTAGAKKVVITAPAKGDDIPTYVLGVNADQYKNTDKIVSNASCTTN  161

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
             LAPFVKVLD +FGI+KG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  162  GLAPFVKVLDDRFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKA  221

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLV+Q SKK  A+EVNAAFRE AA +L GIL+V
Sbjct  222  VALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKKVTADEVNAAFREEAAGKLKGILAV  281

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
             DEPLVS DF+CSDVS+++D++LTMVMGDDM+KV+AWYDNEWGYSQRVVDLA++ A  W+
Sbjct  282  ADEPLVSCDFKCSDVSTSIDAALTMVMGDDMLKVVAWYDNEWGYSQRVVDLAELCAANWE  341



>gb|ABW89099.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89100.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89101.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89102.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89103.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89105.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89106.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89107.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89108.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89109.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89111.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89112.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89113.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89114.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89115.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89116.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89117.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=206

 Score =   300 bits (768),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  674  TYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlld  495
            TYVVGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLD
Sbjct  1    TYVVGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLD  60

Query  494  ashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVS  315
            ASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVS
Sbjct  61   ASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVS  120

Query  314  KKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKV  135
            KKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKV
Sbjct  121  KKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKV  180

Query  134  IAWYDNEWGYSQRVVDLADIVANQWK  57
            IAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  IAWYDNEWGYSQRVVDLADIVANNWK  206



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 219/241 (91%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTT
Sbjct  181  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTT  240

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPF K+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  241  NCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  300

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L+GIL
Sbjct  301  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLSAEDVNAAFRKAADGPLNGIL  360

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCDEPLVSVDFRCSDVS+T+DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA +VAN+
Sbjct  361  AVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVANK  420

Query  62   W  60
            W
Sbjct  421  W  421



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 200/247 (81%), Positives = 219/247 (89%), Gaps = 3/247 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNASCTT
Sbjct  48   GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNASCTT  107

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  108  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  167

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L
Sbjct  168  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVL  227

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+
Sbjct  228  DVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANK  287

Query  62   WK*MPAS  42
            W   P +
Sbjct  288  WPGTPQA  294



>gb|ADB81491.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Klebsormidium 
flaccidum]
Length=314

 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 193/221 (87%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKH++AGAKKVLITAPGKG+IPTYVVGV+ + Y   E IISNASCTTNC
Sbjct  94   GTGVFVDEAGAGKHLQAGAKKVLITAPGKGNIPTYVVGVSEEKYKHSEAIISNASCTTNC  153

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFG+IKGTMTTTHSYTGDQRLLDASHRDLRRARAAAL+IVPTSTGAAKAV
Sbjct  154  LAPFVKVLDQKFGVIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALSIVPTSTGAAKAV  213

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLV+Q  KKTFAEEVN AFRE+A NEL GIL+V 
Sbjct  214  ALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTEKKTFAEEVNNAFREAANNELKGILAVN  273

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEW  111
            DEPLVS+DFRCSDVSSTVDSSLTMV+GDDMVKV+AWYDNEW
Sbjct  274  DEPLVSIDFRCSDVSSTVDSSLTMVLGDDMVKVVAWYDNEW  314



>gb|ABD37955.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Scherffelia 
dubia]
Length=390

 Score =   306 bits (783),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 218/239 (91%), Gaps = 2/239 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVF+D EGAGKHI AGAKKV+ITAP KG D+PTYV+GVN   Y+P  + I+SNASCTT
Sbjct  151  GTGVFLDSEGAGKHITAGAKKVVITAPAKGKDVPTYVIGVNDKDYNPKTDHIVSNASCTT  210

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D+KFGI+KG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAK
Sbjct  211  NCLAPFVKVVDEKFGIVKGMMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAK  270

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILS  240
            AVALVLP LKGKLNG ALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++AA  + G+L+
Sbjct  271  AVALVLPGLKGKLNGFALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDAAAGPMKGVLA  330

Query  239  VCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            + D PLVSVDFRC+DVS+TVD++LTMVMGDDMVK++AWYDNEWGYSQRVVDLA++VA +
Sbjct  331  ITDIPLVSVDFRCTDVSTTVDAALTMVMGDDMVKIVAWYDNEWGYSQRVVDLAELVAKK  389



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 219/246 (89%), Gaps = 3/246 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNASCTT
Sbjct  129  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNASCTT  188

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  189  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  248

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L
Sbjct  249  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLKGVL  308

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  309  DVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  368

Query  62   WK*MPA  45
            W  MPA
Sbjct  369  WPGMPA  374



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 218/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTT
Sbjct  144  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEGDYSDEVSNIVSNASCTT  203

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  204  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  263

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+SA   L GIL
Sbjct  264  AVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKSAEGPLKGIL  323

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  324  AVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  383

Query  62   W  60
            W
Sbjct  384  W  384



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 211/240 (88%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGD-IPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GA KHI AGA KVLITAP KGD IPTYV+GVNAD Y   + IISNASCTTN
Sbjct  141  GTGVFIDTPGASKHITAGASKVLITAPAKGDDIPTYVLGVNADGYKHSDKIISNASCTTN  200

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
             LAPFVKV+D+KFG++KG MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGAAKA
Sbjct  201  GLAPFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGAAKA  260

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLVVQ SKK  A+EVNAAFRE+A   L GIL+V
Sbjct  261  VALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKKCTADEVNAAFREAANGPLKGILAV  320

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
             DEPLVS DFRC+DVS T+D++LTMVMGDDM+KV++WYDNEWGYSQRVVDLA++ A  W+
Sbjct  321  ADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAANWE  380



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 190/240 (79%), Positives = 211/240 (88%), Gaps = 1/240 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGD-IPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GA KHI AGA KVLITAP KGD IPTYV+GVNAD Y   + IISNASCTTN
Sbjct  139  GTGVFIDTPGASKHITAGASKVLITAPAKGDDIPTYVLGVNADGYKHSDKIISNASCTTN  198

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
             LAPFVKV+D+KFG++KG MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGAAKA
Sbjct  199  GLAPFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGAAKA  258

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVDLVVQ SKK  A+EVNAAFRE+A   L GIL+V
Sbjct  259  VALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKKCTADEVNAAFREAANGPLKGILAV  318

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  57
             DEPLVS DFRC+DVS T+D++LTMVMGDDM+KV++WYDNEWGYSQRVVDLA++ A  W+
Sbjct  319  ADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAANWE  378



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 218/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   IISNASCTT
Sbjct  151  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNASCTT  210

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  211  NCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  270

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L
Sbjct  271  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVL  330

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN 
Sbjct  331  AVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANN  390

Query  62   W  60
            W
Sbjct  391  W  391



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 219/241 (91%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   IISNASCTT
Sbjct  180  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNASCTT  239

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  240  NCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  299

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L
Sbjct  300  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVL  359

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+
Sbjct  360  AVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANK  419

Query  62   W  60
            W
Sbjct  420  W  420



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 219/241 (91%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   IISNASCTT
Sbjct  180  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNASCTT  239

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  240  NCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  299

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L
Sbjct  300  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVL  359

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+
Sbjct  360  AVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANK  419

Query  62   W  60
            W
Sbjct  420  W  420



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 220/241 (91%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV+GVN   YS +   I+SNASCTT
Sbjct  181  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYSHEVANIVSNASCTT  240

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPF K+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  241  NCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  300

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L+GIL
Sbjct  301  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLNGIL  360

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCDEPLVSVDFRCSDVS+T+DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA +VA++
Sbjct  361  AVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVASK  420

Query  62   W  60
            W
Sbjct  421  W  421



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 219/246 (89%), Gaps = 3/246 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNASCTT
Sbjct  185  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNASCTT  244

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  245  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  304

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L
Sbjct  305  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLKGVL  364

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  365  DVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  424

Query  62   WK*MPA  45
            W  MPA
Sbjct  425  WPGMPA  430



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 215/241 (89%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV+GVN   YS +   IISNASCTT
Sbjct  188  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVMGVNEGDYSHEVANIISNASCTT  247

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKVLD+KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  248  NCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  307

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+   KK   AE+VN AFRE+A   L GIL
Sbjct  308  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFREAANGPLKGIL  367

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA Q
Sbjct  368  AVCDIPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAQ  427

Query  62   W  60
            W
Sbjct  428  W  428



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 219/241 (91%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTT
Sbjct  181  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTT  240

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPF K+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  241  NCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  300

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L+GIL
Sbjct  301  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAADGPLNGIL  360

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCDEPLVSVDFRCSDVS+T+DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA +VA++
Sbjct  361  AVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVADK  420

Query  62   W  60
            W
Sbjct  421  W  421



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 219/246 (89%), Gaps = 3/246 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNASCTT
Sbjct  185  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNASCTT  244

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  245  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  304

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L
Sbjct  305  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVL  364

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  365  DVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  424

Query  62   WK*MPA  45
            W  MPA
Sbjct  425  WPGMPA  430



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 218/245 (89%), Gaps = 3/245 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+
Sbjct  362  DVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANK  421

Query  62   WK*MP  48
            W   P
Sbjct  422  WPGTP  426



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   301 bits (771),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 216/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV+GVN   YS +   IISNASCTT
Sbjct  48   GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNASCTT  107

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  108  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  167

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AVALVLP LKGKLNGIALRVPTPNVSVVDLV+   K    A++VNAAFR++AA  L GIL
Sbjct  168  AVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLSGIL  227

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  228  DVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  287

Query  62   W  60
            W
Sbjct  288  W  288



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 219/241 (91%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTT
Sbjct  183  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHEVANIVSNASCTT  242

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  243  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  302

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A+  L+GIL
Sbjct  303  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAASGPLNGIL  362

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  363  DVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  422

Query  62   W  60
            W
Sbjct  423  W  423



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 216/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS D   IISNASCTT
Sbjct  170  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHDVSDIISNASCTT  229

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKVLD++FGI KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  230  NCLAPFVKVLDEEFGIEKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  289

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFA-EEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK  A E++N+AFR++A   L G+L
Sbjct  290  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGIAAEDINSAFRKAAEGPLKGVL  349

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+
Sbjct  350  DVCDAPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANK  409

Query  62   W  60
            W
Sbjct  410  W  410



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   308 bits (788),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 218/245 (89%), Gaps = 3/245 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  D   IISNASCTT
Sbjct  256  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHDVADIISNASCTT  315

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  316  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  375

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L G+L
Sbjct  376  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAAEGPLKGVL  435

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+
Sbjct  436  DVCDLPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANK  495

Query  62   WK*MP  48
            W   P
Sbjct  496  WPGTP  500



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 219/245 (89%), Gaps = 3/245 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L GIL
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQGIL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  362  AVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  421

Query  62   WK*MP  48
            W   P
Sbjct  422  WPGTP  426



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 218/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L GIL
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQGIL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  362  AVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  421

Query  62   W  60
            W
Sbjct  422  W  422



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 213/244 (87%), Gaps = 3/244 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVF+D  GAGKHI AGAKKVLITAP KG +IPTYVVGVN   Y+ D   IISNASCTT
Sbjct  145  GTGVFIDGPGAGKHIIAGAKKVLITAPAKGAEIPTYVVGVNEKDYTHDVSNIISNASCTT  204

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPF KVLD+ FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  205  NCLAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  264

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+  +KK   AEEVNAAFR+ A   + GIL
Sbjct  265  AVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEANGAMKGIL  324

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +V D PLVS+DFRCSDVS T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN 
Sbjct  325  AVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANN  384

Query  62   WK*M  51
            W  M
Sbjct  385  WPGM  388



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 219/241 (91%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTT
Sbjct  180  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTT  239

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  240  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  299

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV + KK   AE+VNAAFR++A   L+GIL
Sbjct  300  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISAEDVNAAFRKAADGPLNGIL  359

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  360  AVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  419

Query  62   W  60
            W
Sbjct  420  W  420



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 202/247 (82%), Positives = 219/247 (89%), Gaps = 3/247 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNASCTT
Sbjct  184  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNASCTT  243

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  244  NCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  303

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+SA   L G+L
Sbjct  304  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKSAEGPLKGVL  363

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  364  EVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  423

Query  62   WK*MPAS  42
            W  MP +
Sbjct  424  WPGMPVA  430



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 219/241 (91%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTT
Sbjct  180  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNASCTT  239

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  240  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  299

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L+GIL
Sbjct  300  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRKAADGPLNGIL  359

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  360  AVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  419

Query  62   W  60
            W
Sbjct  420  W  420



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 199/245 (81%), Positives = 218/245 (89%), Gaps = 3/245 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   I+SNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYSHEVSNIVSNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR++A   L GIL
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAANGPLKGIL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRC+DVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  362  DVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  421

Query  62   WK*MP  48
            W  MP
Sbjct  422  WPGMP  426



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 217/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   IISNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQGYSHEVSDIISNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLAGVL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  362  DVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVADK  421

Query  62   W  60
            W
Sbjct  422  W  422



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 220/246 (89%), Gaps = 3/246 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVN-ADAYSPDEPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN  D +     I+SNASCTT
Sbjct  179  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYHHEASNIVSNASCTT  238

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  239  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  298

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR++A   L GIL
Sbjct  299  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLKGIL  358

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  359  AVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  418

Query  62   WK*MPA  45
            W  +PA
Sbjct  419  WPGVPA  424



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 201/247 (81%), Positives = 219/247 (89%), Gaps = 3/247 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNASCTT
Sbjct  184  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNASCTT  243

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  244  NCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  303

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L
Sbjct  304  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVL  363

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  364  EVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  423

Query  62   WK*MPAS  42
            W  MP +
Sbjct  424  WPGMPVA  430



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 220/246 (89%), Gaps = 3/246 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVN-ADAYSPDEPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN  D +     I+SNASCTT
Sbjct  177  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYHHEASNIVSNASCTT  236

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  237  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  296

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR++A   L GIL
Sbjct  297  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLKGIL  356

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  357  AVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  416

Query  62   WK*MPA  45
            W  +PA
Sbjct  417  WPGVPA  422



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 217/245 (89%), Gaps = 3/245 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV+GVN   Y  +   IISNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPF KVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L GIL
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGIL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVS+T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+
Sbjct  362  DVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANK  421

Query  62   WK*MP  48
            W   P
Sbjct  422  WPGTP  426



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 216/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKH++AGAKKVLITAP KG +IPTYVVGVN D Y  D   IISNASCTT
Sbjct  185  GTGVFVDGPGAGKHLQAGAKKVLITAPAKGAEIPTYVVGVNEDQYDHDASAIISNASCTT  244

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAK
Sbjct  245  NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAK  304

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AVALVLP LKGKLNGIALRVPTPNVSVVDLV+   KK   A++VNAAFR++A   L+G+L
Sbjct  305  AVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGITADQVNAAFRKAAEGPLNGVL  364

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +V D PLVS+DFRCSDVSST+DSSLTMVMGDDM+KV+AWYDNEWGYSQRVVDLA IVAN 
Sbjct  365  AVSDLPLVSIDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHIVANN  424

Query  62   W  60
            W
Sbjct  425  W  425



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 216/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS     I+SNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHQVANIVSNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGIL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+
Sbjct  362  DVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANE  421

Query  62   W  60
            W
Sbjct  422  W  422



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 212/239 (89%), Gaps = 1/239 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGD-IPTYVVGVNADAYSPDEPIISNASCTTN  597
            GTGVF+D  GA KH+ AGA KV+ITAP KGD IPTYV+GVNAD Y   + IISNASCTTN
Sbjct  139  GTGVFIDTPGASKHLTAGASKVIITAPAKGDDIPTYVMGVNADDYKDSDKIISNASCTTN  198

Query  596  CLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKA  417
             LAPF KVLD  FGIIKG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKA
Sbjct  199  GLAPFAKVLDDSFGIIKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKA  258

Query  416  VALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSV  237
            VALVLP LKGKLNGIALRVPTPNVSVVD+V+QV KK  AE+VNAAFRE+AA  + GIL V
Sbjct  259  VALVLPQLKGKLNGIALRVPTPNVSVVDMVIQVEKKCTAEDVNAAFREAAAGPMKGILQV  318

Query  236  CDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  60
             DEPLVS+DFRC+DVS+++DS+LTMVMG+D+VK++AWYDNEWGYSQRVVDLA++ A++W
Sbjct  319  VDEPLVSIDFRCTDVSTSIDSALTMVMGEDLVKIVAWYDNEWGYSQRVVDLAELTASKW  377



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 218/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  D   I+SNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHDVANIVSNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L GIL
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGIL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  362  AVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  421

Query  62   W  60
            W
Sbjct  422  W  422



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 200/247 (81%), Positives = 220/247 (89%), Gaps = 3/247 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   I+SNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIVSNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  362  DVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  421

Query  62   WK*MPAS  42
            W  +PA+
Sbjct  422  WPGVPAA  428



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 217/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV GVN   YS +   IISNASCTT
Sbjct  183  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVYGVNETDYSHEVANIISNASCTT  242

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKVLD+KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  243  NCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  302

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL
Sbjct  303  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRDAAEGPLKGIL  362

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD+PLVSVDFRCSDVSST+DSSL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA +
Sbjct  363  AVCDDPLVSVDFRCSDVSSTIDSSLSMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAVK  422

Query  62   W  60
            W
Sbjct  423  W  423



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 218/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  D   I+SNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHDVANIVSNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L GIL
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGIL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  362  AVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  421

Query  62   W  60
            W
Sbjct  422  W  422



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 218/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV+GVN + Y  D   I+SNAS TT
Sbjct  177  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEEGYDHDVANIVSNASWTT  236

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  237  NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  296

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AVALVLP LKGKLNGIALRVPTPNVSVVDLV+  +K    A++VNAAFR++AA  L+GIL
Sbjct  297  AVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTAKTGITADDVNAAFRKAAAGPLNGIL  356

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCDEPLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  357  DVCDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  416

Query  62   W  60
            W
Sbjct  417  W  417



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS D   IISNASCTT
Sbjct  181  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYSHDVANIISNASCTT  240

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  241  NCLAPFVKIMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  300

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV + KK   AE+VN AFR++AA    G+L
Sbjct  301  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNNAFRKAAAGPSKGVL  360

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+
Sbjct  361  EVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANK  420

Query  62   WK*M  51
            W  M
Sbjct  421  WPGM  424



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 218/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  D   I+SNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHDVANIVSNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L GIL
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGIL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
            +VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  362  AVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  421

Query  62   W  60
            W
Sbjct  422  W  422



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   303 bits (776),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 199/245 (81%), Positives = 217/245 (89%), Gaps = 3/245 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y  +   IISNASCTT
Sbjct  182  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNASCTT  241

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  242  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  301

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L
Sbjct  302  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVL  361

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEW YSQRVVDLA +VAN+
Sbjct  362  DVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWDYSQRVVDLAHLVANK  421

Query  62   WK*MP  48
            W   P
Sbjct  422  WPGTP  426



>emb|CAC80391.2| glyceraldehyde-3-phosphate dehydrogenase [Klebsormidium flaccidum]
Length=315

 Score =   298 bits (763),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 191/220 (87%), Positives = 203/220 (92%), Gaps = 0/220 (0%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  594
            GTGVFVD  GAGKH+EAGAKKVLITAPGKG+IPTYV+GVN + Y   E IISNASCTTNC
Sbjct  96   GTGVFVDEAGAGKHLEAGAKKVLITAPGKGNIPTYVIGVNEEKYKHSEKIISNASCTTNC  155

Query  593  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  414
            LAPFVKVLDQKFG++KG MTTTHSYTGDQRLLDASHRDLRRARAAAL+IVPTSTGAAKAV
Sbjct  156  LAPFVKVLDQKFGVVKGCMTTTHSYTGDQRLLDASHRDLRRARAAALSIVPTSTGAAKAV  215

Query  413  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  234
            ALVLP LKGKLNGIALRVPTPNVSVVDLV+Q  KKTFAEEVN AFRE+A NEL GIL V 
Sbjct  216  ALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTEKKTFAEEVNNAFREAANNELKGILDVN  275

Query  233  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNE  114
            DEPLVS+DFRCSDVSSTVDSSLTMV+GDDMVKV+AWYDNE
Sbjct  276  DEPLVSIDFRCSDVSSTVDSSLTMVLGDDMVKVVAWYDNE  315



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 216/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV+GVN   YS +   IISNASCTT
Sbjct  174  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNASCTT  233

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  234  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  293

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AVALVLP LKGKLNGIALRVPTPNVSVVDLV+   K    A++VNAAFR++AA  L GIL
Sbjct  294  AVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLSGIL  353

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  354  DVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  413

Query  62   W  60
            W
Sbjct  414  W  414



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   303 bits (775),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 216/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   IISNASCTT
Sbjct  181  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEIANIISNASCTT  240

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  241  NCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  300

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL
Sbjct  301  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGIL  360

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVS+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA +VA++
Sbjct  361  DVCDAPLVSVDFRCSDVSATIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHLVASK  420

Query  62   W  60
            W
Sbjct  421  W  421



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 196/241 (81%), Positives = 217/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV+GVN   YS +   IISNASCTT
Sbjct  174  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNASCTT  233

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  234  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  293

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AVALVLP LKGKLNGIALRVPTPNVSVVDLV+   K    A++VNAAFR++A+  L+GIL
Sbjct  294  AVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAASGPLNGIL  353

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  354  DVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  413

Query  62   W  60
            W
Sbjct  414  W  414



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 216/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   Y+     IISNASCTT
Sbjct  183  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNERDYTHQISNIISNASCTT  242

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  243  NCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  302

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L
Sbjct  303  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVL  362

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVS+DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  363  DVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  422

Query  62   W  60
            W
Sbjct  423  W  423



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 213/241 (88%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGA KV+ITAP KG DIPTYVVGVN   YS D   IISNASCTT
Sbjct  98   GTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVVGVNEQDYSHDVANIISNASCTT  157

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPF KVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  158  NCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  217

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VN AFR++AA  L G+L
Sbjct  218  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPLKGVL  277

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVS DFRCSDVS+T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA +
Sbjct  278  EVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAK  337

Query  62   W  60
            W
Sbjct  338  W  338



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 216/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVN-ADAYSPDEPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN  D Y     I+SNASCTT
Sbjct  188  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYYHEVSNIVSNASCTT  247

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  248  NCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  307

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V K+   AE+VNAAFR++A   L GIL
Sbjct  308  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKRGLTAEDVNAAFRKAADGPLKGIL  367

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDF+C+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  368  DVCDAPLVSVDFKCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  427

Query  62   W  60
            W
Sbjct  428  W  428



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 216/241 (90%), Gaps = 3/241 (1%)
 Frame = -2

Query  773  GTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  600
            GTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVVGVN   YS +   IISNASCTT
Sbjct  181  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEIANIISNASCTT  240

Query  599  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  420
            NCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  241  NCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  300

Query  419  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  243
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL
Sbjct  301  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGIL  360

Query  242  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  63
             VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  361  DVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  420

Query  62   W  60
            W
Sbjct  421  W  421



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520