BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019C11

Length=792
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI14966.3|  unnamed protein product                              85.9    3e-17   Vitis vinifera
ref|XP_006344459.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.9    4e-17   Solanum tuberosum [potatoes]
ref|XP_004236255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.9    4e-17   Solanum lycopersicum
ref|XP_011071940.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.9    4e-17   Sesamum indicum [beniseed]
ref|XP_011071939.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.5    5e-17   Sesamum indicum [beniseed]
ref|XP_006439905.1|  hypothetical protein CICLE_v10019394mg           88.2    1e-16   
ref|XP_009594348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  88.6    3e-16   Nicotiana tomentosiformis
gb|KDO69502.1|  hypothetical protein CISIN_1g013176mg                 87.4    3e-16   Citrus sinensis [apfelsine]
ref|XP_009769444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  88.2    4e-16   Nicotiana sylvestris
ref|XP_006439909.1|  hypothetical protein CICLE_v10019394mg           87.4    6e-16   Citrus clementina [clementine]
ref|XP_009112063.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.0    8e-16   Brassica rapa
emb|CDY16735.1|  BnaA09g06470D                                        87.0    8e-16   Brassica napus [oilseed rape]
emb|CDY48128.1|  BnaCnng15700D                                        87.0    8e-16   Brassica napus [oilseed rape]
gb|KFK25761.1|  hypothetical protein AALP_AA8G156100                  86.7    9e-16   Arabis alpina [alpine rockcress]
ref|XP_006394312.1|  hypothetical protein EUTSA_v10003871mg           86.7    9e-16   Eutrema salsugineum [saltwater cress]
gb|AFW97645.1|  cold responsive DEAD-box RNA helicase                 86.7    9e-16   Chorispora bungeana
ref|XP_006476870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  86.7    1e-15   Citrus sinensis [apfelsine]
emb|CDP12744.1|  unnamed protein product                              86.3    1e-15   Coffea canephora [robusta coffee]
ref|XP_011046220.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  85.9    2e-15   Populus euphratica
ref|XP_007210287.1|  hypothetical protein PRUPE_ppa002741mg           85.5    2e-15   Prunus persica
ref|XP_010678860.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  85.5    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008239580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  85.5    3e-15   Prunus mume [ume]
ref|NP_974985.1|  DEAD-box ATP-dependent RNA helicase 30              85.5    3e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10554.1|  ATP-dependent RNA helicase-like protein              85.1    3e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CAN78903.1|  hypothetical protein VITISV_026451                   85.1    4e-15   Vitis vinifera
ref|XP_010102487.1|  DEAD-box ATP-dependent RNA helicase 20           85.1    4e-15   Morus notabilis
ref|XP_010663104.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  85.1    4e-15   Vitis vinifera
ref|XP_010484038.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.7    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010444189.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.7    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010459851.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.7    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_002866536.1|  hypothetical protein ARALYDRAFT_496494           84.7    4e-15   
gb|KDP31038.1|  hypothetical protein JCGZ_11414                       84.7    5e-15   Jatropha curcas
ref|XP_002322195.2|  hypothetical protein POPTR_0015s09460g           84.3    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_007155472.1|  hypothetical protein PHAVU_003G204200g           84.0    9e-15   Phaseolus vulgaris [French bean]
ref|XP_011047813.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.0    9e-15   Populus euphratica
ref|XP_002318665.2|  ethylene-responsive DEAD box RNA helicase fa...  83.6    1e-14   
ref|XP_006845267.1|  hypothetical protein AMTR_s00005p00263980        84.0    1e-14   Amborella trichopoda
gb|KHG00891.1|  DEAD-box ATP-dependent RNA helicase 30                78.2    1e-14   Gossypium arboreum [tree cotton]
gb|KGN63543.1|  hypothetical protein Csa_1G004090                     78.2    1e-14   
ref|XP_006280218.1|  hypothetical protein CARUB_v10026128mg           83.2    1e-14   Capsella rubella
ref|XP_010550696.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.4    3e-14   Tarenaya hassleriana [spider flower]
ref|XP_008807455.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  82.0    4e-14   Phoenix dactylifera
gb|KHN34349.1|  DEAD-box ATP-dependent RNA helicase 30                81.3    5e-14   Glycine soja [wild soybean]
ref|XP_006579582.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.3    6e-14   
ref|XP_004299135.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  81.3    6e-14   Fragaria vesca subsp. vesca
gb|KHN18420.1|  DEAD-box ATP-dependent RNA helicase 30                80.5    8e-14   Glycine soja [wild soybean]
ref|XP_010932245.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.9    9e-14   Elaeis guineensis
ref|XP_008365657.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.5    1e-13   
ref|XP_003549600.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  80.5    1e-13   Glycine max [soybeans]
ref|XP_007036326.1|  P-loop containing nucleoside triphosphate hy...  79.7    2e-13   
ref|NP_001172705.1|  Os01g0911100                                     74.7    2e-13   
ref|XP_009345779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  79.0    4e-13   Pyrus x bretschneideri [bai li]
ref|XP_009363040.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  78.6    5e-13   Pyrus x bretschneideri [bai li]
ref|XP_006646592.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.0    1e-12   
tpg|DAA56213.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  77.0    1e-12   
ref|XP_004138092.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.4    1e-12   Cucumis sativus [cucumbers]
ref|NP_001105241.1|  DEAD box RNA helicase1                           77.0    1e-12   
ref|XP_010251083.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.4    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_008464517.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  77.0    1e-12   Cucumis melo [Oriental melon]
gb|KEH31793.1|  DEAD-box ATP-dependent RNA helicase-like protein      76.6    2e-12   Medicago truncatula
gb|EMT04443.1|  DEAD-box ATP-dependent RNA helicase 30                73.2    2e-12   
gb|KJB40103.1|  hypothetical protein B456_007G047000                  76.3    2e-12   Gossypium raimondii
ref|XP_009412685.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  76.3    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004515873.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  76.3    3e-12   Cicer arietinum [garbanzo]
ref|XP_010027294.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.5    4e-12   Eucalyptus grandis [rose gum]
ref|XP_004971011.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.1    6e-12   Setaria italica
gb|EYU22173.1|  hypothetical protein MIMGU_mgv1a003417mg              75.1    6e-12   Erythranthe guttata [common monkey flower]
ref|XP_004971010.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  75.1    6e-12   
ref|XP_002458964.1|  hypothetical protein SORBIDRAFT_03g043450        75.1    6e-12   Sorghum bicolor [broomcorn]
gb|EMS66298.1|  DEAD-box ATP-dependent RNA helicase 30                74.3    1e-11   Triticum urartu
emb|CDM85602.1|  unnamed protein product                              73.9    1e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564892.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  73.6    2e-11   Brachypodium distachyon [annual false brome]
dbj|BAD82427.1|  putative DEAD box RNA helicase                       72.8    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ACN39916.1|  unknown                                               72.4    4e-11   Picea sitchensis
sp|Q5N7W4.2|RH30_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...  72.8    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006385358.1|  DEAD box RNA helicase family protein             71.6    7e-11   
ref|XP_011000790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.9    1e-10   Populus euphratica
gb|ABR16327.1|  unknown                                               70.5    2e-10   Picea sitchensis
ref|XP_009336746.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  66.6    2e-10   Pyrus x bretschneideri [bai li]
gb|AAG51573.1|AC027034_19  RNA helicase, 5' partial; 101954-101280    67.0    2e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CAA09209.1|  RNA helicase                                         66.6    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EPS60527.1|  hypothetical protein M569_14276                       67.0    6e-10   Genlisea aurea
ref|XP_006392683.1|  hypothetical protein EUTSA_v10011413mg           68.6    8e-10   Eutrema salsugineum [saltwater cress]
ref|XP_006392681.1|  hypothetical protein EUTSA_v10011413mg           68.2    9e-10   Eutrema salsugineum [saltwater cress]
ref|XP_004486821.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.8    1e-09   Cicer arietinum [garbanzo]
ref|XP_010542432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.4    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_002527412.1|  dead box ATP-dependent RNA helicase, putative    67.4    2e-09   Ricinus communis
ref|XP_006426523.1|  hypothetical protein CICLE_v10025421mg           67.4    2e-09   
ref|XP_004486820.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.4    2e-09   
gb|KDO65284.1|  hypothetical protein CISIN_1g010649mg                 67.4    2e-09   Citrus sinensis [apfelsine]
ref|XP_006426525.1|  hypothetical protein CICLE_v10025421mg           67.4    2e-09   Citrus clementina [clementine]
ref|XP_006426526.1|  hypothetical protein CICLE_v10025421mg           67.4    2e-09   
ref|XP_010262147.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.4    2e-09   Nelumbo nucifera [Indian lotus]
gb|KDP40778.1|  hypothetical protein JCGZ_24777                       67.4    2e-09   Jatropha curcas
ref|XP_010262145.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.4    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_006466041.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.4    2e-09   Citrus sinensis [apfelsine]
ref|XP_006466042.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.4    2e-09   Citrus sinensis [apfelsine]
ref|XP_006426524.1|  hypothetical protein CICLE_v10025421mg           67.4    2e-09   Citrus clementina [clementine]
gb|KDO65287.1|  hypothetical protein CISIN_1g010649mg                 67.0    2e-09   Citrus sinensis [apfelsine]
ref|XP_010262146.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010242202.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    2e-09   Nelumbo nucifera [Indian lotus]
gb|KHG24204.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein  67.0    2e-09   Gossypium arboreum [tree cotton]
gb|KDO65286.1|  hypothetical protein CISIN_1g010649mg                 67.0    2e-09   Citrus sinensis [apfelsine]
ref|XP_003529884.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    3e-09   Glycine max [soybeans]
ref|XP_006583016.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    3e-09   Glycine max [soybeans]
gb|KJB56888.1|  hypothetical protein B456_009G140700                  67.0    3e-09   Gossypium raimondii
ref|XP_006858286.1|  hypothetical protein AMTR_s00064p00050700        67.0    3e-09   Amborella trichopoda
gb|KJB56890.1|  hypothetical protein B456_009G140700                  67.0    3e-09   Gossypium raimondii
ref|XP_002279117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    3e-09   Vitis vinifera
ref|XP_007135556.1|  hypothetical protein PHAVU_010G139400g           67.0    3e-09   Phaseolus vulgaris [French bean]
ref|XP_010686087.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    3e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN39300.1|  DEAD-box ATP-dependent RNA helicase 20                66.6    3e-09   Glycine soja [wild soybean]
gb|KJB70270.1|  hypothetical protein B456_011G066000                  66.6    3e-09   Gossypium raimondii
ref|XP_008447604.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  66.6    3e-09   Cucumis melo [Oriental melon]
gb|KHF98903.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein  66.6    4e-09   Gossypium arboreum [tree cotton]
ref|XP_004146825.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  66.6    4e-09   Cucumis sativus [cucumbers]
ref|XP_003531619.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  66.2    4e-09   Glycine max [soybeans]
gb|KCW53605.1|  hypothetical protein EUGRSUZ_J028691                  66.2    5e-09   Eucalyptus grandis [rose gum]
ref|XP_010033787.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  66.2    5e-09   Eucalyptus grandis [rose gum]
ref|XP_007024450.1|  DEA(D/H)-box RNA helicase family protein         66.2    5e-09   
ref|NP_175911.1|  DEAD-box ATP-dependent RNA helicase 20              66.2    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.9    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008805785.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.9    6e-09   Phoenix dactylifera
ref|XP_008228305.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.9    6e-09   Prunus mume [ume]
ref|XP_007215261.1|  hypothetical protein PRUPE_ppa004545mg           65.9    6e-09   Prunus persica
ref|XP_008228303.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.9    6e-09   Prunus mume [ume]
ref|XP_008805786.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.9    7e-09   Phoenix dactylifera
ref|XP_010480028.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.9    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010480030.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.5    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008391321.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.5    8e-09   Malus domestica [apple tree]
ref|XP_009367550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.5    8e-09   Pyrus x bretschneideri [bai li]
ref|XP_010106662.1|  DEAD-box ATP-dependent RNA helicase 20           65.5    9e-09   
emb|CDO97919.1|  unnamed protein product                              65.5    1e-08   Coffea canephora [robusta coffee]
ref|XP_010462358.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.5    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009380443.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.1    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010462359.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.1    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004297601.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.1    1e-08   Fragaria vesca subsp. vesca
ref|XP_004968530.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  64.7    2e-08   Setaria italica
ref|NP_001142117.1|  uncharacterized protein LOC100274281             64.7    2e-08   Zea mays [maize]
ref|XP_011011886.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  64.7    2e-08   Populus euphratica
ref|XP_003597619.1|  DEAD-box ATP-dependent RNA helicase              64.3    2e-08   Medicago truncatula
ref|XP_002891814.1|  hypothetical protein ARALYDRAFT_474570           64.3    2e-08   
ref|XP_011072507.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  64.3    2e-08   Sesamum indicum [beniseed]
ref|XP_010314157.1|  PREDICTED: ethylene-responsive RNA helicase ...  64.3    2e-08   
ref|XP_008673096.1|  PREDICTED: putative DEAD-box ATP-dependent R...  64.3    2e-08   
gb|AFK42127.1|  unknown                                               64.3    2e-08   Medicago truncatula
ref|XP_004968529.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  64.3    2e-08   
ref|NP_001234650.1|  ethylene-responsive RNA helicase                 64.3    2e-08   
ref|NP_001168054.1|  putative DEAD-box ATP-dependent RNA helicase...  64.3    2e-08   Zea mays [maize]
ref|XP_006366150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.9    3e-08   Solanum tuberosum [potatoes]
gb|EEE54050.1|  hypothetical protein OsJ_00740                        63.9    3e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70110.1|  hypothetical protein OsI_00766                        63.9    3e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_005850349.1|  hypothetical protein CHLNCDRAFT_30080            63.9    3e-08   Chlorella variabilis
ref|XP_009802114.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.9    3e-08   Nicotiana sylvestris
ref|XP_009625322.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.9    3e-08   Nicotiana tomentosiformis
sp|Q5QMN3.2|RH20_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...  63.9    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.9    3e-08   Oryza brachyantha
gb|KCW55996.1|  hypothetical protein EUGRSUZ_I01775                   62.4    4e-08   Eucalyptus grandis [rose gum]
ref|XP_002324002.1|  hypothetical protein POPTR_0017s10760g           63.5    4e-08   
gb|KCW55995.1|  hypothetical protein EUGRSUZ_I01775                   62.4    5e-08   Eucalyptus grandis [rose gum]
ref|XP_009106904.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.2    5e-08   Brassica rapa
emb|CDY02459.1|  BnaA08g00660D                                        63.2    5e-08   
ref|XP_010915213.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    6e-08   Elaeis guineensis
gb|KCW55992.1|  hypothetical protein EUGRSUZ_I01775                   62.4    6e-08   Eucalyptus grandis [rose gum]
gb|KCW55994.1|  hypothetical protein EUGRSUZ_I01775                   62.4    7e-08   Eucalyptus grandis [rose gum]
ref|XP_006306418.1|  hypothetical protein CARUB_v10012355mg           62.8    8e-08   Capsella rubella
emb|CDY10596.1|  BnaC03g70180D                                        62.8    8e-08   Brassica napus [oilseed rape]
ref|XP_004968358.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    8e-08   
ref|XP_006840690.1|  hypothetical protein AMTR_s00096p00079870        62.8    8e-08   
ref|XP_001763089.1|  predicted protein                                62.4    8e-08   
ref|XP_004968356.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    9e-08   
ref|XP_004968357.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.4    9e-08   Setaria italica
ref|XP_004968355.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.4    9e-08   Setaria italica
gb|KFK38698.1|  hypothetical protein AALP_AA3G148400                  62.4    1e-07   Arabis alpina [alpine rockcress]
ref|XP_004968354.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.4    1e-07   
ref|XP_001771533.1|  predicted protein                                62.4    1e-07   
ref|XP_004304637.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    1e-07   Fragaria vesca subsp. vesca
emb|CDM81540.1|  unnamed protein product                              62.0    1e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    1e-07   Brachypodium distachyon [annual false brome]
ref|XP_010550155.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_010029150.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  62.0    1e-07   Eucalyptus grandis [rose gum]
ref|XP_008654141.1|  PREDICTED: ATP-dependent RNA helicase-like p...  58.5    1e-07   Zea mays [maize]
ref|XP_009375127.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    1e-07   Pyrus x bretschneideri [bai li]
gb|EPB85904.1|  hypothetical protein HMPREF1544_07320                 61.6    2e-07   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008379232.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    2e-07   
ref|XP_009334108.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    2e-07   Pyrus x bretschneideri [bai li]
gb|KHN25107.1|  DEAD-box ATP-dependent RNA helicase 20                61.2    2e-07   Glycine soja [wild soybean]
ref|XP_006675622.1|  hypothetical protein BATDEDRAFT_29115            60.8    3e-07   Batrachochytrium dendrobatidis JAM81
ref|XP_004141097.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  61.2    3e-07   
ref|XP_008341438.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.2    3e-07   Malus domestica [apple tree]
ref|XP_008443543.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.2    3e-07   Cucumis melo [Oriental melon]
ref|XP_004164821.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.2    3e-07   
gb|KIP10983.1|  hypothetical protein PHLGIDRAFT_171911                57.8    3e-07   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_002970463.1|  hypothetical protein SELMODRAFT_441099           61.2    3e-07   
gb|EYU21378.1|  hypothetical protein MIMGU_mgv1a004869mg              60.8    3e-07   Erythranthe guttata [common monkey flower]
ref|XP_003032253.1|  hypothetical protein SCHCODRAFT_82297            60.5    3e-07   Schizophyllum commune H4-8
ref|XP_002455005.1|  hypothetical protein SORBIDRAFT_03g002860        60.5    4e-07   
ref|XP_010534902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    4e-07   Tarenaya hassleriana [spider flower]
ref|XP_002521446.1|  dead box ATP-dependent RNA helicase, putative    60.8    4e-07   Ricinus communis
gb|KDP46436.1|  hypothetical protein JCGZ_10276                       60.5    4e-07   Jatropha curcas
ref|XP_010534903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    4e-07   Tarenaya hassleriana [spider flower]
gb|EXX56938.1|  Dbp2p                                                 60.1    5e-07   Rhizophagus irregularis DAOM 197198w
dbj|GAN02653.1|  ATP-dependent RNA helicase dbp-2                     60.5    5e-07   Mucor ambiguus
emb|CDO77180.1|  hypothetical protein BN946_scf184705.g5              57.4    6e-07   Trametes cinnabarina
ref|XP_004349647.1|  ATPdependent RNA helicase dbp2, putative         60.1    6e-07   Acanthamoeba castellanii str. Neff
ref|XP_002972931.1|  hypothetical protein SELMODRAFT_98552            59.7    7e-07   
ref|XP_008230577.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.1    7e-07   Prunus mume [ume]
ref|XP_007217002.1|  hypothetical protein PRUPE_ppa002303mg           60.1    7e-07   Prunus persica
gb|KHN23518.1|  DEAD-box ATP-dependent RNA helicase 46                60.1    7e-07   Glycine soja [wild soybean]
emb|CDS08010.1|  hypothetical protein LRAMOSA01959                    60.1    7e-07   Lichtheimia ramosa
ref|XP_007217003.1|  hypothetical protein PRUPE_ppa002303mg           60.1    7e-07   
emb|CCM04686.1|  predicted protein                                    60.1    7e-07   Fibroporia radiculosa
ref|XP_002987999.1|  hypothetical protein SELMODRAFT_269342           59.7    8e-07   
ref|XP_003524550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    8e-07   Glycine max [soybeans]
ref|XP_006579766.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    8e-07   Glycine max [soybeans]
gb|KHN27447.1|  DEAD-box ATP-dependent RNA helicase 46                59.7    8e-07   Glycine soja [wild soybean]
ref|XP_008439374.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.3    1e-06   
ref|XP_005710055.1|  ATP-dependent RNA helicase DBP2, putative        59.3    1e-06   Chondrus crispus [carageen]
gb|KIM40445.1|  hypothetical protein M413DRAFT_73199                  59.3    1e-06   Hebeloma cylindrosporum h7
ref|XP_002455105.1|  hypothetical protein SORBIDRAFT_03g004420        59.3    1e-06   Sorghum bicolor [broomcorn]
gb|KIM84767.1|  hypothetical protein PILCRDRAFT_96565                 58.9    1e-06   Piloderma croceum F 1598
gb|KHN85192.1|  putative ATP-dependent RNA helicase DDX17             59.3    1e-06   Toxocara canis
ref|XP_010524303.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.3    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_006958620.1|  p68 RNA helicase                                 58.9    1e-06   Wallemia mellicola CBS 633.66
emb|CBI34896.3|  unnamed protein product                              59.3    1e-06   Vitis vinifera
ref|XP_008039863.1|  DEAD-domain-containing protein                   58.9    1e-06   Trametes versicolor FP-101664 SS1
ref|XP_003745440.1|  PREDICTED: probable ATP-dependent RNA helica...  58.9    1e-06   Galendromus occidentalis
ref|XP_736707.1|  helicase                                            56.2    1e-06   
gb|KII89609.1|  hypothetical protein PLICRDRAFT_158683                58.9    2e-06   Plicaturopsis crispa FD-325 SS-3
ref|XP_007151015.1|  hypothetical protein PHAVU_004G011600g           58.9    2e-06   Phaseolus vulgaris [French bean]
ref|XP_744215.1|  helicase                                            56.6    2e-06   
ref|XP_006459201.1|  hypothetical protein AGABI2DRAFT_65810           58.5    2e-06   Agaricus bisporus var. bisporus H97
ref|XP_007330446.1|  hypothetical protein AGABI1DRAFT_100622          58.5    2e-06   Agaricus bisporus var. burnettii JB137-S8
ref|XP_002273908.2|  PREDICTED: ATP-dependent RNA helicase-like p...  58.9    2e-06   Vitis vinifera
gb|EPS60732.1|  hypothetical protein M569_14070                       58.5    2e-06   Genlisea aurea
ref|XP_010660890.1|  PREDICTED: ATP-dependent RNA helicase-like p...  58.5    2e-06   Vitis vinifera
ref|XP_004159856.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  58.9    2e-06   
ref|XP_011047343.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.5    2e-06   Populus euphratica
ref|XP_007414813.1|  hypothetical protein MELLADRAFT_78893            58.5    2e-06   Melampsora larici-populina 98AG31
ref|XP_005705091.1|  DEAD-box family RNA-dependent helicase           55.8    2e-06   Galdieria sulphuraria
ref|XP_001760431.1|  predicted protein                                58.5    2e-06   
ref|XP_003618185.1|  DEAD-box ATP-dependent RNA helicase              58.5    2e-06   Medicago truncatula
ref|XP_008439373.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.5    2e-06   
gb|KGN57060.1|  hypothetical protein Csa_3G151370                     58.5    2e-06   
gb|KGN59687.1|  hypothetical protein Csa_3G838660                     58.5    2e-06   
ref|XP_006408522.1|  hypothetical protein EUTSA_v10020294mg           58.2    3e-06   Eutrema salsugineum [saltwater cress]
ref|XP_003618186.1|  DEAD-box ATP-dependent RNA helicase              58.2    3e-06   
dbj|BAF00715.1|  DRH1 DEAD box protein - like                         58.2    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001690022.1|  DEAD-box RNA helicase                            58.2    3e-06   Chlamydomonas reinhardtii
ref|XP_006408521.1|  hypothetical protein EUTSA_v10020294mg           58.2    3e-06   
ref|XP_004134467.1|  PREDICTED: uncharacterized protein LOC101206109  58.2    3e-06   
ref|NP_001190309.1|  DEAD-box ATP-dependent RNA helicase 46           58.2    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871624.1|  ATP binding protein                              58.2    3e-06   
ref|XP_009124816.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    3e-06   Brassica rapa
gb|KHJ83794.1|  hypothetical protein OESDEN_16503                     54.7    3e-06   Oesophagostomum dentatum [nodule worm]
emb|CDX91943.1|  BnaC03g32450D                                        57.8    3e-06   
gb|AAN31934.1|  putative RNA helicase, DRH1                           57.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196965.2|  DEAD-box ATP-dependent RNA helicase 46              57.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87628.1|  DRH1 DEAD box protein-like                           57.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492272.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    4e-06   Camelina sativa [gold-of-pleasure]
emb|CDM81987.1|  unnamed protein product                              57.8    4e-06   Triticum aestivum [Canadian hard winter wheat]
ref|NP_850492.1|  RNA helicase DRH1                                   57.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32669.1|  RNA helicase, DRH1                                    57.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CBK21212.2|  unnamed protein product                              57.8    4e-06   Blastocystis hominis
gb|KJA13443.1|  hypothetical protein HYPSUDRAFT_73013                 57.8    4e-06   Hypholoma sublateritium FD-334 SS-4
ref|XP_010492271.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    4e-06   Camelina sativa [gold-of-pleasure]
tpg|DAA42421.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  57.8    4e-06   
ref|NP_566141.1|  RNA helicase DRH1                                   57.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420106.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    4e-06   Camelina sativa [gold-of-pleasure]
gb|AAY84883.1|  DEAD-box ATPase-RNA-helicase                          57.4    4e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009134609.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    4e-06   Brassica rapa
gb|KIZ00407.1|  ATP-dependent RNA helicase DDX5/DBP2                  57.8    4e-06   Monoraphidium neglectum
emb|CDX74304.1|  BnaA03g27430D                                        57.8    4e-06   
ref|XP_008668268.1|  PREDICTED: uncharacterized protein LOC100381...  57.8    4e-06   
ref|XP_010420104.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006287260.1|  hypothetical protein CARUB_v10000450mg           57.8    4e-06   
ref|XP_008776302.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    4e-06   
ref|XP_006287261.1|  hypothetical protein CARUB_v10000450mg           57.8    4e-06   
ref|XP_011270510.1|  hypothetical protein CAOG_08856                  57.4    4e-06   Capsaspora owczarzaki ATCC 30864
gb|AGE46032.1|  dead-box ATP-dependent RNA helicase                   57.4    4e-06   
ref|XP_002882175.1|  hypothetical protein ARALYDRAFT_477362           57.8    4e-06   
emb|CDR95325.1|  p68-like protein, putative                           57.4    4e-06   
ref|XP_010248506.1|  PREDICTED: ATP-dependent RNA helicase-like p...  57.8    4e-06   
gb|KDQ24573.1|  hypothetical protein PLEOSDRAFT_1090372               57.4    4e-06   
ref|XP_010492273.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    4e-06   
ref|XP_010420107.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    4e-06   
gb|EYU34729.1|  hypothetical protein MIMGU_mgv1a002636mg              57.4    4e-06   
dbj|BAK00243.1|  predicted protein                                    57.4    4e-06   
dbj|BAD73320.1|  putative ethylene-responsive RNA helicase            57.4    4e-06   
emb|CAH89939.1|  hypothetical protein                                 56.6    4e-06   
emb|CDH49080.1|  atp-dependent rna helicase dbp2                      57.4    5e-06   
emb|CDI80731.1|  hypothetical protein, conserved                      55.8    5e-06   
gb|EIE79143.1|  hypothetical protein RO3G_03848                       54.3    5e-06   
emb|CDY28671.1|  BnaCnng05570D                                        57.4    5e-06   
emb|CEJ03535.1|  Putative ATP-dependent RNA helicase dbp2 (Fragment)  55.5    5e-06   
emb|CDI51261.1|  p68-like protein                                     54.3    5e-06   
ref|NP_001082679.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17           57.4    5e-06   
dbj|BAJ94202.1|  predicted protein                                    57.4    5e-06   
ref|NP_001016781.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17           57.4    5e-06   
ref|NP_690019.2|  probable ATP-dependent RNA helicase DDX17 isofo...  56.6    5e-06   
ref|XP_007031512.1|  DEAD-box ATP-dependent RNA helicase 46 isofo...  57.4    5e-06   
ref|NP_001015018.1|  probable ATP-dependent RNA helicase DDX17        56.6    5e-06   
ref|XP_007031513.1|  DEAD-box ATP-dependent RNA helicase 46 isofo...  57.4    5e-06   
gb|EDM15799.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  56.6    6e-06   
ref|XP_010940176.1|  PREDICTED: ATP-dependent RNA helicase-like p...  57.4    6e-06   
ref|XP_764197.1|  RNA helicase                                        57.0    6e-06   
gb|KJB33798.1|  hypothetical protein B456_006G031200                  57.0    6e-06   
gb|EMS23120.1|  ATP-dependent rna helicase dbp2                       57.0    6e-06   
ref|XP_010940175.1|  PREDICTED: ATP-dependent RNA helicase-like p...  57.4    6e-06   
gb|KIK10334.1|  hypothetical protein K443DRAFT_146564                 55.8    6e-06   
gb|EJU04549.1|  DEAD-domain-containing protein                        57.0    6e-06   
ref|XP_004489252.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    6e-06   
gb|KJE94426.1|  hypothetical protein CAOG_008856                      57.0    6e-06   
gb|KIM24458.1|  hypothetical protein M408DRAFT_75932                  57.0    6e-06   
gb|KJB33795.1|  hypothetical protein B456_006G031200                  57.0    7e-06   
gb|KDN48860.1|  DEAD-domain-containing protein                        57.0    7e-06   
gb|KJB33797.1|  hypothetical protein B456_006G031200                  57.0    7e-06   
gb|KIK28896.1|  hypothetical protein PISMIDRAFT_90259                 57.0    7e-06   
gb|EMS57490.1|  DEAD-box ATP-dependent RNA helicase 14                57.0    7e-06   
gb|EGN99017.1|  hypothetical protein SERLA73DRAFT_137127              56.6    7e-06   
ref|XP_006521353.1|  PREDICTED: probable ATP-dependent RNA helica...  56.6    7e-06   
ref|XP_011405456.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    7e-06   
gb|EMT04160.1|  DEAD-box ATP-dependent RNA helicase 14                56.6    8e-06   
ref|XP_678450.1|  helicase                                            54.7    8e-06   
ref|XP_010453591.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    8e-06   
gb|KIK57769.1|  hypothetical protein GYMLUDRAFT_45959                 56.6    8e-06   
ref|XP_010453589.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    8e-06   
ref|XP_007318616.1|  hypothetical protein SERLADRAFT_449372           56.6    8e-06   
gb|ABN12070.1|  putative RNA-dependent helicase p68                   56.2    8e-06   
ref|XP_007370735.1|  DEAD-domain-containing protein                   56.6    9e-06   
ref|XP_008555058.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    9e-06   
ref|XP_008555059.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    9e-06   
ref|XP_003746167.1|  PREDICTED: probable ATP-dependent RNA helica...  56.6    9e-06   
gb|EYU44765.1|  hypothetical protein MIMGU_mgv1a003026mg              56.6    9e-06   
gb|KHG16462.1|  DEAD-box ATP-dependent RNA helicase 46 -like protein  56.6    1e-05   
emb|CDR15320.1|  helicase, putative                                   56.2    1e-05   
gb|EMS55994.1|  DEAD-box ATP-dependent RNA helicase 20                56.2    1e-05   
ref|XP_010611222.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  55.8    1e-05   
gb|KIL67445.1|  hypothetical protein M378DRAFT_159266                 56.2    1e-05   
ref|XP_008565102.1|  PREDICTED: probable ATP-dependent RNA helica...  56.2    1e-05   
ref|XP_008565101.1|  PREDICTED: probable ATP-dependent RNA helica...  56.2    1e-05   
ref|XP_953213.1|  DEAD-box family RNA-dependent helicase              56.2    1e-05   
emb|CCN25578.1|  DEAD-box ATP-dependent RNA helicase, putative        56.2    1e-05   
ref|XP_001880766.1|  predicted protein                                56.2    1e-05   
gb|EMS68918.1|  DEAD-box ATP-dependent RNA helicase 40                56.2    1e-05   
gb|KIJ66791.1|  hypothetical protein HYDPIDRAFT_180508                55.8    1e-05   
gb|EDM15798.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  56.2    1e-05   
ref|XP_003706564.1|  PREDICTED: probable ATP-dependent RNA helica...  56.2    1e-05   
ref|XP_004232309.1|  PREDICTED: ATP-dependent RNA helicase-like p...  56.2    1e-05   
emb|CBW54880.1|  putative DEAD box ATP-dependent RNA helicase         53.5    1e-05   
emb|CEP17640.1|  hypothetical protein                                 56.2    1e-05   
ref|XP_005994328.1|  PREDICTED: probable ATP-dependent RNA helica...  56.2    1e-05   
ref|XP_005994327.1|  PREDICTED: probable ATP-dependent RNA helica...  56.2    1e-05   
gb|KIR72047.1|  ATP-dependent RNA helicase DBP2-A                     55.8    1e-05   
ref|XP_002300045.2|  hypothetical protein POPTR_0001s35150g           56.2    1e-05   
gb|KGB75854.1|  ATP-dependent RNA helicase DBP2-A                     55.8    1e-05   
gb|KIR99876.1|  ATP-dependent RNA helicase DBP2-A                     55.8    1e-05   
ref|XP_010694397.1|  PREDICTED: ATP-dependent RNA helicase-like p...  55.8    1e-05   
ref|XP_008067650.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
gb|ETE72827.1|  putative ATP-dependent RNA helicase DDX17             55.8    1e-05   
ref|XP_009473564.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  55.8    1e-05   
ref|XP_010408888.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
gb|EAW60248.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...  55.8    1e-05   
ref|XP_009436590.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_007622847.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_007622846.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_010013794.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_002164829.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_008634834.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_006174954.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_004311417.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_009951301.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
gb|EOB03912.1|  Putative ATP-dependent RNA helicase DDX17             55.8    1e-05   
ref|XP_010185205.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_004700310.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
gb|EUC64866.1|  ATP-dependent RNA helicase DBP2                       55.8    1e-05   
ref|XP_003321253.2|  hypothetical protein PGTG_02295                  55.8    1e-05   
ref|XP_008939400.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_005446839.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_009805513.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_009880187.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
gb|EPY88394.1|  putative ATP-dependent RNA helicase DDX17             55.8    1e-05   
ref|XP_007008272.1|  hypothetical protein TREMEDRAFT_46029            55.8    1e-05   
ref|XP_005514775.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_006259008.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_004610567.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_005527672.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_009566745.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    1e-05   
ref|XP_010565532.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_010145760.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008142844.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008142845.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005488678.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005488677.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_009584901.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_010710490.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_009330949.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006029913.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005232953.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_002195734.2|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_416260.2|  PREDICTED: probable ATP-dependent RNA helicase ...  55.8    2e-05   
ref|XP_010341891.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_010126497.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_009933308.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|NP_001267194.1|  probable ATP-dependent RNA helicase DDX17        55.8    2e-05   
ref|XP_009481222.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_010225318.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006865247.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006865246.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005150407.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  55.8    2e-05   
ref|XP_010132422.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005016061.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_729738.1|  hypothetical protein                                54.3    2e-05   
ref|XP_003264799.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005354345.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008494759.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_001630124.1|  predicted protein                                55.8    2e-05   
ref|XP_003514725.2|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006102491.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004485165.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...  55.8    2e-05   
ref|XP_007652929.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004007674.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008849476.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008849475.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008209140.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005883260.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_001092491.2|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005883259.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_003783252.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_003821639.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_010694509.1|  PREDICTED: ATP-dependent RNA helicase-like p...  55.8    2e-05   
ref|XP_010004139.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005567355.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005567354.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_007939858.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_007189120.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|NP_001035277.1|  probable ATP-dependent RNA helicase DDX17 is...  55.8    2e-05   
ref|XP_004883536.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008067649.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006155420.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_007939857.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_007189119.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004883535.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|NP_951062.1|  probable ATP-dependent RNA helicase DDX17 isofo...  55.8    2e-05   
ref|XP_009085184.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008067648.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006155419.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_009900873.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_001605420.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006752810.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
gb|EMT09661.1|  DEAD-box ATP-dependent RNA helicase 20                55.5    2e-05   
ref|XP_006914795.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005379316.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_003470541.2|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004650369.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_010288347.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005379315.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005003904.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004650368.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004410825.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004134468.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_007441609.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008255265.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006071393.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006979214.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004589558.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008977411.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
gb|AAP88874.1|  DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17, ...  55.8    2e-05   
ref|XP_004675717.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006071392.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006979213.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004589559.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008977406.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004743517.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_004675716.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008929884.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_010085938.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_010208864.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  55.8    2e-05   
ref|XP_005681228.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_010168247.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_009646040.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005322311.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|NP_001095463.1|  probable ATP-dependent RNA helicase DDX17        55.8    2e-05   
ref|XP_003126098.2|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005322310.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_009502718.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_009972429.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
gb|EMS48902.1|  DEAD-box ATP-dependent RNA helicase 40                55.8    2e-05   
ref|XP_007099364.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...  55.8    2e-05   
ref|XP_007111784.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005066907.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  55.8    2e-05   
ref|XP_004279534.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
emb|CAH10627.2|  hypothetical protein                                 55.8    2e-05   
ref|XP_005302557.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_007503261.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
dbj|BAD88051.1|  putative ATP-dependent RNA helicase DB10             55.8    2e-05   
ref|XP_006890184.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_005040018.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_008849477.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   
ref|XP_006890183.1|  PREDICTED: probable ATP-dependent RNA helica...  55.8    2e-05   



>emb|CBI14966.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA TFFTH NAKFAR+L+KILQ+AGQ+V
Sbjct  22   KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAITFFTHSNAKFARDLIKILQEAGQVV  81

Query  357  PPQLSALA---CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P LSA+A         SGGN       G FGNRG ISGSNT+PLGA+R W
Sbjct  82   SPALSAMARSSGSAFGGSGGNFRSRGRGGSFGNRGLISGSNTIPLGARRPW  132



>ref|XP_006344459.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Solanum tuberosum]
Length=648

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTA+TFFTH NAKF REL+KILQQAGQIV
Sbjct  540  KDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAYTFFTHANAKFTRELIKILQQAGQIV  599

Query  357  PPQLSALA  334
            PPQLSALA
Sbjct  600  PPQLSALA  607



>ref|XP_004236255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Solanum lycopersicum]
Length=651

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAKF REL+KILQQAGQIV
Sbjct  542  KDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKFTRELIKILQQAGQIV  601

Query  357  PPQLSALA  334
            PPQLSALA
Sbjct  602  PPQLSALA  609



>ref|XP_011071940.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Sesamum indicum]
Length=600

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAF+FFTHGNAK+AR+L+KILQQAGQ+V
Sbjct  491  KDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTAFSFFTHGNAKYARDLIKILQQAGQVV  550

Query  357  PPQLSALA  334
            PPQL+ALA
Sbjct  551  PPQLAALA  558



>ref|XP_011071939.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Sesamum indicum]
Length=626

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAF+FFTHGNAK+AR+L+KILQQAGQ+V
Sbjct  517  KDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTAFSFFTHGNAKYARDLIKILQQAGQVV  576

Query  357  PPQLSALA  334
            PPQL+ALA
Sbjct  577  PPQLAALA  584



>ref|XP_006439905.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53145.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=389

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+KILQ+AGQIV
Sbjct  280  KDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLIKILQEAGQIV  339

Query  357  PPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+KR W
Sbjct  340  SPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSKRLW  389



>ref|XP_009594348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=646

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAK+ R+L+KILQQAGQIV
Sbjct  540  KDIKCVINYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKYTRQLIKILQQAGQIV  599

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
            PPQLSALA   G S+GG+NFRSRGRGGFGNR   SGSN +PLG +R W
Sbjct  600  PPQLSALAGSTGPSTGGSNFRSRGRGGFGNRDQKSGSNVIPLG-RRPW  646



>gb|KDO69502.1| hypothetical protein CISIN_1g013176mg [Citrus sinensis]
Length=448

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+KILQ+AGQIV
Sbjct  339  KDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLIKILQEAGQIV  398

Query  357  PPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+KR W
Sbjct  399  SPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSKRLW  448



>ref|XP_009769444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=646

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP+ LEDY+HRIGRTGRAGA GTAFTFFTH NAK+ R+L+KILQQAGQIV
Sbjct  540  KDIKCVVNYDFPSSLEDYIHRIGRTGRAGATGTAFTFFTHANAKYTRQLIKILQQAGQIV  599

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
            PPQLSALA     S+GG+NFRSRGRGGFGNR   SGSN +PLG +R W
Sbjct  600  PPQLSALAGSTSHSTGGSNFRSRGRGGFGNRDQKSGSNVIPLG-RRPW  646



>ref|XP_006439909.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53149.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=599

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+KILQ+AGQIV
Sbjct  490  KDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLIKILQEAGQIV  549

Query  357  PPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P LS LA      F   G NFRSRGRGGFG R S+SGSNT+PLG+KR W
Sbjct  550  SPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSMSGSNTIPLGSKRLW  599



>ref|XP_009112063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Brassica rapa]
Length=591

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  478  KDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFARELIKILQEAGQVV  537

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  538  PPTLSAL  544



>emb|CDY16735.1| BnaA09g06470D [Brassica napus]
Length=591

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  479  KDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFARELIKILQEAGQVV  538

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  539  PPTLSAL  545



>emb|CDY48128.1| BnaCnng15700D [Brassica napus]
Length=594

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG A TFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  481  KDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAMTFFTHDNAKFARELIKILQEAGQVV  540

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  541  PPTLSAL  547



>gb|KFK25761.1| hypothetical protein AALP_AA8G156100 [Arabis alpina]
Length=582

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  471  KDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQVV  530

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  531  PPTLSAL  537



>ref|XP_006394312.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
 gb|ESQ31598.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
Length=596

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  483  KDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQVV  542

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  543  PPTLSAL  549



>gb|AFW97645.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
 gb|AHZ57094.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
Length=595

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  479  KDIKCVVNYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQVV  538

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  539  PPTLSAL  545



>ref|XP_006476870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Citrus sinensis]
Length=599

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 92/110 (84%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDYVHRIGRTGRAGA+GTAFTFFTH NAKFAR+L+KILQ+AGQIV
Sbjct  490  KDIKCVVNYDFPTSLEDYVHRIGRTGRAGARGTAFTFFTHSNAKFARDLIKILQEAGQIV  549

Query  357  PPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P LS LA      F   G NFRSRGRGGFG R SISGSNT+PLG+KR W
Sbjct  550  SPALSGLARSAAPSFGGSGGNFRSRGRGGFGIRSSISGSNTIPLGSKRLW  599



>emb|CDP12744.1| unnamed protein product [Coffea canephora]
Length=624

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 82/108 (76%), Gaps = 1/108 (1%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAFTFFTH NAKFAR+L+KIL+ AGQI+
Sbjct  518  KDIKCVVNYDFPSSLEDYVHRIGRTGRAGATGTAFTFFTHANAKFARDLIKILRDAGQII  577

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
            PP LSA+A     S+ G N       G      ISGSNT+PLGAK+ W
Sbjct  578  PPDLSAMAR-STGSTMGGNNFRSRGRGGFGNRGISGSNTIPLGAKKPW  624



>ref|XP_011046220.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Populus 
euphratica]
Length=612

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTA TFFT  NAKFAR+L+KILQ+AGQIV
Sbjct  507  KDIKCVVNYDFPSSLEDYVHRIGRTGRAGASGTALTFFTESNAKFARDLIKILQEAGQIV  566

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
            PP LSA+       S G NFRSRGRGGF NR  ISGSNTVPLGA R W
Sbjct  567  PPSLSAMT--RSAGSFGGNFRSRGRGGFSNRRMISGSNTVPLGAGRPW  612



>ref|XP_007210287.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
 gb|EMJ11486.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
Length=638

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  531  KDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARELIKILQEAGQVV  590

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P L+A++   G   G          G G    ISGSNTVP+G KR W
Sbjct  591  SPALAAMSRSSGSFGGSGGNFRNRGRGGGFGNRISGSNTVPIGYKRPW  638



>ref|XP_010678860.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=643

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDY+HRIGRTGRAGAKGTA+TFFTH NAKF REL+KIL++AGQ++
Sbjct  538  KDIKCVINYDFPTSLEDYIHRIGRTGRAGAKGTAYTFFTHSNAKFTRELIKILREAGQMI  597

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
            PP LSA+A   G + GG NFRSRGRGGFGNR   SGSNT+P+G  R W
Sbjct  598  PPALSAMAQSSGSNFGGGNFRSRGRGGFGNRSQKSGSNTIPVG--RRW  643



>ref|XP_008239580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Prunus mume]
Length=609

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  502  KDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARELIKILQEAGQVV  561

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P L+A++   G   G          G G    ISGSNTVP+G KR W
Sbjct  562  SPALAAMSRSSGSFGGSGGNFRNRGRGGGFGNRISGSNTVPIGYKRPW  609



>ref|NP_974985.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
 sp|Q8W4R3.2|RH30_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis 
thaliana]
 dbj|BAE98724.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AED97706.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
Length=591

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFARELVKILQ+AGQ+V
Sbjct  477  KDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELVKILQEAGQVV  536

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  537  PPTLSAL  543



>dbj|BAB10554.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=564

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFARELVKILQ+AGQ+V
Sbjct  450  KDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELVKILQEAGQVV  509

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  510  PPTLSAL  516



>emb|CAN78903.1| hypothetical protein VITISV_026451 [Vitis vinifera]
Length=692

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA TFFTH NAKFAR+L+KILQ+AGQ+V
Sbjct  582  KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAITFFTHSNAKFARDLIKILQEAGQVV  641

Query  357  PPQLSALA---CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P LSA+A         SGGN       G FGNRG ISGSNT+PLGA+R W
Sbjct  642  SPALSAMARSSGSAFGGSGGNFRSRGRGGSFGNRGLISGSNTIPLGARRPW  692



>ref|XP_010102487.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXB93551.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=625

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTA TFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  516  KDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTALTFFTHANAKFARELIKILQEAGQVV  575

Query  357  PPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P LSAL           G +FRSRGRGGFGNR   SGSNTVPLG KR W
Sbjct  576  TPALSALVRSAGSSGGGSGGSFRSRGRGGFGNRALKSGSNTVPLGNKRSW  625



>ref|XP_010663104.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
Length=718

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA TFFTH NAKFAR+L+KILQ+AGQ+V
Sbjct  608  KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAITFFTHSNAKFARDLIKILQEAGQVV  667

Query  357  PPQLSALA---CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P LSA+A         SGGN       G FGNRG ISGSNT+PLGA+R W
Sbjct  668  SPALSAMARSSGSAFGGSGGNFRSRGRGGSFGNRGLISGSNTIPLGARRPW  718



>ref|XP_010484038.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=594

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  479  KDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQVV  538

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  539  PPTLSAL  545



>ref|XP_010444189.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=591

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  477  KDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQVV  536

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  537  PPTLSAL  543



>ref|XP_010459851.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Camelina sativa]
Length=598

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  483  KDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQVV  542

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  543  PPTLSAL  549



>ref|XP_002866536.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42795.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ+V
Sbjct  474  KDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQVV  533

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  534  PPTLSAL  540



>gb|KDP31038.1| hypothetical protein JCGZ_11414 [Jatropha curcas]
Length=627

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 92/109 (84%), Gaps = 1/109 (1%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDY+HRIGRTGRAGA+GTA TFFTH NAKFAR+L+KILQ+A QI+
Sbjct  519  KDIKCVINYDFPSSLEDYIHRIGRTGRAGARGTAITFFTHANAKFARDLIKILQEARQIL  578

Query  357  PPQLSALA-CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
            PP LSA+A   G     G NFRSRGRGGFGNR  ISGSNT+PLG++R W
Sbjct  579  PPTLSAMARSAGTHGGSGGNFRSRGRGGFGNRSLISGSNTIPLGSRRPW  627



>ref|XP_002322195.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
 gb|EEF06322.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
Length=609

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 91/108 (84%), Gaps = 2/108 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP+ LEDYVHRIGRTGRAGA+GTA TFFT  NAKFAR+L+KILQ+AGQIV
Sbjct  504  KDIKCVVNYDFPSSLEDYVHRIGRTGRAGARGTALTFFTESNAKFARDLIKILQEAGQIV  563

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
            PP LSA+       S G NFRSRGRGGFGNRG ISGSNTVPLGA R W
Sbjct  564  PPSLSAMT--RSAGSFGGNFRSRGRGGFGNRGMISGSNTVPLGAGRPW  609



>ref|XP_007155472.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27466.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
Length=603

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTHGNAKFAR+L+KILQ AGQ+V
Sbjct  491  KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHGNAKFARDLIKILQDAGQVV  550

Query  357  PPQLSAL  337
             P LSAL
Sbjct  551  SPALSAL  557



>ref|XP_011047813.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Populus euphratica]
Length=625

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTAFTFFT  NAKFAR L++ILQ++GQIV
Sbjct  516  KDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTAFTFFTDSNAKFARGLIRILQESGQIV  575

Query  357  PPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
            PP LSALA        S GN       G FGNRGSISGSNTVPLGA+R W
Sbjct  576  PPALSALARSSGSFGGSAGNFRSRGRGGSFGNRGSISGSNTVPLGARRPW  625



>ref|XP_002318665.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
 gb|EEE96885.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
Length=543

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 87/110 (79%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGA+GTAFTFFT  NAKFAR L++ILQ++GQIV
Sbjct  434  KDIKCVINYDFPSSLEDYVHRIGRTGRAGARGTAFTFFTDSNAKFARGLIRILQESGQIV  493

Query  357  PPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
            PP LSALA        S GN       G FGNRGSISGSNTVPLGA+R W
Sbjct  494  PPALSALARSSGSFGGSAGNFRSRGRGGSFGNRGSISGSNTVPLGARRPW  543



>ref|XP_006845267.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
 gb|ERN06942.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
Length=670

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT+ NA+FAREL+KILQ+AGQ V
Sbjct  563  KDIKCVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTNANARFARELIKILQEAGQAV  622

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             PQL+AL    G    G         G+GNR  ISGSNT+P+G KR W
Sbjct  623  SPQLAALGRSSGGGGSGGGNFRSRGRGYGNRSLISGSNTIPIGGKRPW  670



>gb|KHG00891.1| DEAD-box ATP-dependent RNA helicase 30 [Gossypium arboreum]
Length=127

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR+L+K+LQ AGQ+V
Sbjct  17   KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYARDLIKLLQDAGQVV  76

Query  357  PPQLSALA  334
             P LS LA
Sbjct  77   SPALSTLA  84



>gb|KGN63543.1| hypothetical protein Csa_1G004090 [Cucumis sativus]
Length=131

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR+L+KIL++AGQIV
Sbjct  22   KDIKCVINFDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHARDLIKILREAGQIV  81

Query  357  PPQLSALA  334
             P LSALA
Sbjct  82   TPALSALA  89



>ref|XP_006280218.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
 gb|EOA13116.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
Length=594

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP  LEDY+HRIGRTGRAGAKG AFTFFTH NAKFAREL+KILQ+AGQ V
Sbjct  478  KDIKCVVNYDFPNTLEDYIHRIGRTGRAGAKGMAFTFFTHDNAKFARELIKILQEAGQAV  537

Query  357  PPQLSAL  337
            PP LSAL
Sbjct  538  PPTLSAL  544



>ref|XP_010550696.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Tarenaya hassleriana]
Length=576

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDY+HRIGRTGRAGAKG AFTFFTH NA+FAREL+KIL +AGQ+V
Sbjct  471  KDIKCVINYDFPTSLEDYIHRIGRTGRAGAKGMAFTFFTHDNARFARELIKILHEAGQVV  530

Query  357  PPQLSAL  337
            PP LS L
Sbjct  531  PPSLSDL  537



>ref|XP_008807455.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Phoenix 
dactylifera]
Length=683

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA TFFTH NA+FAR+L+KILQ+AG+ V
Sbjct  578  KDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTALTFFTHANARFARDLIKILQEAGKSV  637

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P L+++A       G          G+GNR  ISGSNTVPLG +R W
Sbjct  638  TPALASMA--RSAGGGSVGNFRSRGRGYGNRSLISGSNTVPLGGRRAW  683



>gb|KHN34349.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+KILQ AGQ+V
Sbjct  405  KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLIKILQDAGQVV  464

Query  357  PPQLSAL  337
             P LSAL
Sbjct  465  SPALSAL  471



>ref|XP_006579582.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=605

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+KILQ AGQ+V
Sbjct  493  KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLIKILQDAGQVV  552

Query  357  PPQLSAL  337
             P LSAL
Sbjct  553  SPALSAL  559



>ref|XP_004299135.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=606

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFT  N KFAREL+KILQ+AGQ+V
Sbjct  502  KDIKCVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTESNGKFARELIKILQEAGQVV  561

Query  357  PPQLSALA  334
             P LSA+A
Sbjct  562  SPALSAMA  569



>gb|KHN18420.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+KILQ AGQ V
Sbjct  405  KDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLIKILQDAGQTV  464

Query  357  PPQLSAL--ACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P L+AL  +   G    G  FRSRGRGG+GNRG  SGSN +PLG+KR W
Sbjct  465  SPALTALVRSAGSGQFGSGGGFRSRGRGGYGNRGLTSGSNAIPLGSKRPW  514



>ref|XP_010932245.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Elaeis 
guineensis]
Length=701

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFPT LEDYVHRIGRTGRAGAKGTAFTFFTH NA+FAR+L+KILQ+AGQ V
Sbjct  596  KDIKCVVNYDFPTSLEDYVHRIGRTGRAGAKGTAFTFFTHANARFARDLIKILQEAGQSV  655

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P L+++A       G          G+GNR  +SGSN+VPLG +R W
Sbjct  656  TPALASMA--RSAGGGSGGNFRSRGRGYGNRALMSGSNSVPLGGRRPW  701



>ref|XP_008365657.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Malus 
domestica]
Length=643

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKF R+L+KILQ+AGQ+V
Sbjct  534  KDIKCVINYDFPSSLEDYVHRIGRTGRAGAAGTALTFFTHANAKFTRDLIKILQEAGQVV  593

Query  357  PPQLSALA  334
             P L+A+A
Sbjct  594  SPALAAMA  601



>ref|XP_003549600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=602

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDYVHRIGRTGRAGAKGTA+TFFTH NAKFAR+L+KILQ AGQ V
Sbjct  490  KDIKCVINYDFPTSLEDYVHRIGRTGRAGAKGTAYTFFTHANAKFARDLIKILQDAGQTV  549

Query  357  PPQLSAL--ACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P L+AL  +   G    G  FRSRGRGG+GNRG  SGSN +PLG+KR W
Sbjct  550  SPALTALVRSAGSGQFGSGGGFRSRGRGGYGNRGLTSGSNAIPLGSKRPW  599



>ref|XP_007036326.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY20827.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=626

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR+L+K+LQ AGQ+V
Sbjct  517  KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYARDLIKLLQDAGQVV  576

Query  357  PPQLSALA--CPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P LS LA      F     NFRSRGRGG+GNR SISGSNT+PLGA+R W
Sbjct  577  SPALSTLARSAASSFGGSRGNFRSRGRGGYGNRSSISGSNTIPLGARRPW  626



>ref|NP_001172705.1| Os01g0911100 [Oryza sativa Japonica Group]
 dbj|BAH91435.1| Os01g0911100, partial [Oryza sativa Japonica Group]
Length=117

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R LVKIL++AGQ+V
Sbjct  14   KDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLVKILREAGQVV  73

Query  357  PPQLSALA  334
             P L ++A
Sbjct  74   NPALESMA  81



>ref|XP_009345779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=612

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIK VINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR+L+KILQ+AGQ+V
Sbjct  503  KDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARDLIKILQEAGQVV  562

Query  357  PPQLSALA  334
             P L+A+A
Sbjct  563  SPALAAMA  570



>ref|XP_009363040.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Pyrus 
x bretschneideri]
Length=611

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIK VINYDFP+ LEDYVHRIGRTGRAGA GTA TFFTH NAKFAR+L+KILQ+AGQ+V
Sbjct  502  KDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFTHANAKFARDLIKILQEAGQVV  561

Query  357  PPQLSALA  334
             P L+A+A
Sbjct  562  SPALAAMA  569



>ref|XP_006646592.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Oryza 
brachyantha]
Length=547

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ+V
Sbjct  444  KDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHSNAKFSRNLVKILREAGQVV  503

Query  357  PPQLSALA  334
             P L ++A
Sbjct  504  NPALESMA  511



>tpg|DAA56213.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=571

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ+V
Sbjct  465  KDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQVV  524

Query  357  PPQLSALA  334
             P L +++
Sbjct  525  NPALESMS  532



>ref|XP_004138092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
 ref|XP_004168110.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
Length=622

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR+L+KIL++AGQIV
Sbjct  513  KDIKCVINFDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHARDLIKILREAGQIV  572

Query  357  PPQLSALA  334
             P LSALA
Sbjct  573  TPALSALA  580



>ref|NP_001105241.1| DEAD box RNA helicase1 [Zea mays]
 gb|AAR29370.1| DEAD box RNA helicase [Zea mays]
Length=566

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ+V
Sbjct  462  KDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQVV  521

Query  357  PPQLSALA  334
             P L +++
Sbjct  522  NPALESMS  529



>ref|XP_010251083.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Nelumbo 
nucifera]
Length=719

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGA+G AFTFFTH NA+FAR+L+KILQ  GQ+V
Sbjct  608  KDIKCVINYDFPSSLEDYVHRIGRTGRAGARGNAFTFFTHANARFARDLIKILQDCGQVV  667

Query  357  PPQLSALA  334
             P L+A+A
Sbjct  668  NPALAAMA  675



>ref|XP_008464517.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Cucumis melo]
Length=622

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFTH NAK AR+L+KIL++AGQIV
Sbjct  513  KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTHENAKHARDLIKILREAGQIV  572

Query  357  PPQLSALA  334
             P LS LA
Sbjct  573  TPALSTLA  580



>gb|KEH31793.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=625

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP+ LEDYVHRIGRTGRAGAKGTA++FFT  NAK+AR+L+KILQ AGQIV
Sbjct  513  KDIKCVVNYDFPSSLEDYVHRIGRTGRAGAKGTAYSFFTSANAKYARDLIKILQDAGQIV  572

Query  357  PPQLSALA  334
             P LSAL 
Sbjct  573  SPALSALT  580



>gb|EMT04443.1| DEAD-box ATP-dependent RNA helicase 30 [Aegilops tauschii]
Length=210

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R LVKIL++AGQ+V
Sbjct  44   KDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSRNLVKILREAGQVV  103

Query  357  PPQLSA  340
             P L A
Sbjct  104  NPALEA  109



>gb|KJB40103.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
Length=623

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP+ LEDYVHRIGRTGRAGAKGTAFTFFT  NAK+AR+L+K+LQ AGQ+V
Sbjct  513  KDIKCVINYDFPSSLEDYVHRIGRTGRAGAKGTAFTFFTQANAKYARDLIKLLQDAGQVV  572

Query  357  PPQLSALA  334
             P LS LA
Sbjct  573  SPALSTLA  580



>ref|XP_009412685.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Musa 
acuminata subsp. malaccensis]
Length=695

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+N+DFPT LEDYVHRIGRTGRAGAKGTAFTFFT  N +FARELVKILQ AGQ V
Sbjct  592  KDIKCVVNFDFPTSLEDYVHRIGRTGRAGAKGTAFTFFTQANIRFARELVKILQDAGQNV  651

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
             P L+++A     S GG+    R RG      SISGSNT+PLG +R W
Sbjct  652  SPALASMA----RSGGGSGGNFRSRGRGNGNRSISGSNTIPLGGRRPW  695



>ref|XP_004515873.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Cicer arietinum]
Length=622

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP+ LEDYVHRIGRTGRAGAKGTA++FFT  NAKFAR+L+KILQ AGQ+V
Sbjct  509  KDIKCVVNYDFPSSLEDYVHRIGRTGRAGAKGTAYSFFTRANAKFARDLIKILQDAGQVV  568

Query  357  PPQLSALA  334
             P LS L+
Sbjct  569  SPALSELS  576



>ref|XP_010027294.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Eucalyptus 
grandis]
 gb|KCW83292.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
Length=624

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTAFTFFT  N++FA EL+KILQ AGQ+V
Sbjct  509  KDIKCVINYDFPMTLEDYVHRIGRTGRAGAKGTAFTFFTDSNSRFAGELLKILQDAGQVV  568

Query  357  PPQLSALA  334
            PP LS LA
Sbjct  569  PPALSDLA  576



>ref|XP_004971011.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Setaria italica]
Length=569

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ+V
Sbjct  463  KDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQVV  522

Query  357  PPQL  346
             P L
Sbjct  523  NPAL  526



>gb|EYU22173.1| hypothetical protein MIMGU_mgv1a003417mg [Erythranthe guttata]
Length=586

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCV+NYDFP+ LEDYVHRIGRTGRAGA GTAFTFFTH N K A  L+KILQQA Q V
Sbjct  480  KDIKCVVNYDFPSSLEDYVHRIGRTGRAGATGTAFTFFTHANVKSAGHLIKILQQARQAV  539

Query  357  PPQLSALA  334
            PPQL+ALA
Sbjct  540  PPQLAALA  547



>ref|XP_004971010.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Setaria italica]
Length=596

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ+V
Sbjct  463  KDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQVV  522

Query  357  PPQL  346
             P L
Sbjct  523  NPAL  526



>ref|XP_002458964.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
 gb|EES04084.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
Length=578

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFPT LEDY+HRIGRTGRAGA GTAFTFFTH NAKF+R LVKIL++AGQ V
Sbjct  471  KDIKCVINYDFPTTLEDYIHRIGRTGRAGASGTAFTFFTHANAKFSRNLVKILREAGQAV  530

Query  357  PPQLSAL  337
             P L ++
Sbjct  531  NPALESM  537



>gb|EMS66298.1| DEAD-box ATP-dependent RNA helicase 30 [Triticum urartu]
Length=587

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R LVKIL++AGQ+V
Sbjct  466  KDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSRNLVKILREAGQVV  525

Query  357  PPQLSALA  334
             P L A++
Sbjct  526  NPALEAMS  533



>emb|CDM85602.1| unnamed protein product [Triticum aestivum]
Length=574

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH NAK++R LVKIL++AGQ+V
Sbjct  466  KDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNAKYSRNLVKILREAGQVV  525

Query  357  PPQLSALA  334
             P L A++
Sbjct  526  NPALEAMS  533



>ref|XP_003564892.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Brachypodium 
distachyon]
Length=571

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFPT +EDY+HRIGRTGRAGA G AFTFFTH N+K++R LVKIL++AGQ+V
Sbjct  469  KDIKCVINFDFPTTIEDYIHRIGRTGRAGATGMAFTFFTHSNSKYSRNLVKILREAGQVV  528

Query  357  PPQLSALA  334
             P L A++
Sbjct  529  NPALEAMS  536



>dbj|BAD82427.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 dbj|BAD82339.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 gb|EEE55863.1| hypothetical protein OsJ_04500 [Oryza sativa Japonica Group]
Length=571

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R LVKIL++AGQ+V
Sbjct  468  KDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLVKILREAGQVV  527

Query  357  PPQLSALA  334
             P L ++A
Sbjct  528  NPALESMA  535



>gb|ACN39916.1| unknown [Picea sitchensis]
Length=593

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  N +FARELV ILQ+AGQ V
Sbjct  482  KDIKCVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANGRFARELVGILQEAGQRV  541

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  542  NPELAAMT  549



>sp|Q5N7W4.2|RH30_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Oryza sativa 
Japonica Group]
Length=666

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVIN+DFPT LEDY+HRIGRTGRAGA GTAFTFFT  NAKF+R LVKIL++AGQ+V
Sbjct  563  KDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFFTLSNAKFSRNLVKILREAGQVV  622

Query  357  PPQLSALA  334
             P L ++A
Sbjct  623  NPALESMA  630



>ref|XP_006385358.1| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|ERP63155.1| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=497

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT GNA+FA+ELV IL++AGQ V
Sbjct  403  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAGNARFAKELVTILEEAGQKV  462

Query  357  PPQLSALA  334
             P+L+A+A
Sbjct  463  SPELTAMA  470



>ref|XP_011000790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Populus euphratica]
Length=506

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  +EDYVHRIGRTGRAGAKGTA+TFFT GNA+FA+ELV IL++AGQ V
Sbjct  412  KDVKYVINYDFPGSIEDYVHRIGRTGRAGAKGTAYTFFTAGNARFAKELVTILEEAGQKV  471

Query  357  PPQLSALA  334
             P+L+A+A
Sbjct  472  SPELTAMA  479



>gb|ABR16327.1| unknown [Picea sitchensis]
Length=504

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP  +EDYVHRIGRTGRAGAKGTA+T+FT  NA+FAR+L+KIL++AGQ +
Sbjct  411  KDIKCVINYDFPGSMEDYVHRIGRTGRAGAKGTAYTYFTAANARFARDLIKILEEAGQSI  470

Query  357  PPQLSALA  334
             P L+ + 
Sbjct  471  SPSLAEMG  478



>ref|XP_009336746.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
 ref|XP_009336748.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=140

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ V
Sbjct  46   KDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQKV  105

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  106  SPELAAMG  113



>gb|AAG51573.1|AC027034_19 RNA helicase, 5' partial; 101954-101280 [Arabidopsis thaliana]
Length=155

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  ILQ+AGQ V
Sbjct  65   KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEAGQKV  124

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  125  SPELASMG  132



>emb|CAA09209.1| RNA helicase [Arabidopsis thaliana]
Length=187

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  ILQ+AGQ V
Sbjct  97   KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEAGQKV  156

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  157  SPELASMG  164



>gb|EPS60527.1| hypothetical protein M569_14276, partial [Genlisea aurea]
Length=230

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NAKFA+EL+ IL++AGQ V
Sbjct  138  KDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANAKFAKELINILREAGQKV  197

Query  357  PPQLSALA  334
             P+L A+ 
Sbjct  198  SPELVAMG  205



>ref|XP_006392683.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29969.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=501

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ ILQ+AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELISILQEAGQKV  470

Query  357  PPQLSALA  334
             P+LS++ 
Sbjct  471  SPELSSMG  478



>ref|XP_006392681.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 ref|XP_006392682.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29967.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29968.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=429

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ ILQ+AGQ V
Sbjct  339  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELISILQEAGQKV  398

Query  357  PPQLSALA  334
             P+LS++ 
Sbjct  399  SPELSSMG  406



>ref|XP_004486821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Cicer arietinum]
Length=501

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV IL++AGQ V
Sbjct  409  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELVSILEEAGQRV  468

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  469  SPELAAMG  476



>ref|XP_010542432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Tarenaya hassleriana]
Length=503

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELISILEEAGQRV  470

Query  357  PPQLSAL  337
             P+L+A+
Sbjct  471  SPELAAM  477



>ref|XP_002527412.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF34978.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=505

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAKELISILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_006426523.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39763.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=473

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  380  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  439

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  440  SPELAAMG  447



>ref|XP_004486820.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Cicer arietinum]
Length=546

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV IL++AGQ V
Sbjct  409  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELVSILEEAGQRV  468

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  469  SPELAAMG  476



>gb|KDO65284.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=473

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  380  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  439

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  440  SPELAAMG  447



>ref|XP_006426525.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39765.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=505

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_006426526.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39766.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=495

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  402  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  461

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  462  SPELAAMG  469



>ref|XP_010262147.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X3 [Nelumbo nucifera]
Length=505

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  412  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  471

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  472  SPELAAMG  479



>gb|KDP40778.1| hypothetical protein JCGZ_24777 [Jatropha curcas]
Length=503

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  410  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTASNARFAKELITILEEAGQKV  469

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  470  SPELAAMG  477



>ref|XP_010262145.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Nelumbo nucifera]
Length=512

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  419  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  478

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  479  SPELAAMG  486



>ref|XP_006466041.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Citrus sinensis]
 gb|KDO65282.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=505

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_006466042.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Citrus sinensis]
 gb|KDO65283.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=504

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_006426524.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39764.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=504

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>gb|KDO65287.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=491

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  398  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  457

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  458  SPELAAMG  465



>ref|XP_010262146.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Nelumbo nucifera]
Length=511

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  418  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  477

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  478  SPELAAMG  485



>ref|XP_010242202.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nelumbo nucifera]
Length=512

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  418  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  477

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  478  SPELAAMG  485



>gb|KHG24204.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=505

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>gb|KDO65286.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=498

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  405  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQKV  464

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  465  SPELAAMG  472



>ref|XP_003529884.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Glycine max]
Length=507

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+ IL++AGQ V
Sbjct  413  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELIAILEEAGQKV  472

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  473  SPELAAMG  480



>ref|XP_006583016.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Glycine max]
Length=496

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+ IL++AGQ V
Sbjct  413  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELIAILEEAGQKV  472

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  473  SPELAAMG  480



>gb|KJB56888.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
 gb|KJB56891.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=505

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_006858286.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
 gb|ERN19753.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
Length=501

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  N +FA+EL+ ILQ+AGQ V
Sbjct  407  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANGRFAKELISILQEAGQKV  466

Query  357  PPQLSAL  337
             P+L+A+
Sbjct  467  SPELAAM  473



>gb|KJB56890.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=487

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_002279117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
 emb|CBI35942.3| unnamed protein product [Vitis vinifera]
Length=506

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  412  KDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELITILEEAGQRV  471

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  472  APELAAMG  479



>ref|XP_007135556.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
 gb|ESW07550.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
Length=507

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  413  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILEEAGQKV  472

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  473  SPELAAMG  480



>ref|XP_010686087.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  410  KDVKFVINYDFPGSLEDYVHRIGRTGRAGATGTAYTFFTAANARFAKELIAILEEAGQKV  469

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  470  NPELAAMG  477



>gb|KHN39300.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=433

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+ IL++AGQ V
Sbjct  339  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELIAILEEAGQKV  398

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  399  SPELAAMG  406



>gb|KJB70270.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
 gb|KJB70271.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
Length=505

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILKEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_008447604.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Cucumis melo]
Length=505

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIGILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>gb|KHF98903.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=519

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIAILKEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_004146825.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 ref|XP_004154799.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Cucumis 
sativus]
 gb|KGN59824.1| hypothetical protein Csa_3G848820 [Cucumis sativus]
Length=505

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIGILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_003531619.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Glycine 
max]
 gb|KHN11290.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=507

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K V+NYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA+EL+ IL++AGQ V
Sbjct  413  KDVKYVVNYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTAANARFAKELIAILEEAGQKV  472

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  473  SPELAAMG  480



>gb|KCW53605.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
 gb|KCW53606.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
Length=485

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELISILEEAGQKV  470

Query  357  PPQLSALA  334
             P L+A+ 
Sbjct  471  SPDLAAMG  478



>ref|XP_010033787.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
 ref|XP_010033788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
Length=504

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELISILEEAGQKV  470

Query  357  PPQLSALA  334
             P L+A+ 
Sbjct  471  SPDLAAMG  478



>ref|XP_007024450.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
 gb|EOY27072.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
Length=505

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIVILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|NP_175911.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
 sp|Q9C718.1|RH20_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis 
thaliana]
 gb|AAG50841.1|AC073944_8 ethylene-responsive RNA helicase, putative [Arabidopsis thaliana]
 gb|AAL32823.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91186.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33192.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
Length=501

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  ILQ+AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEAGQKV  470

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  471  SPELASMG  478



>ref|XP_010501121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Camelina 
sativa]
Length=502

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  412  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELINILEEAGQKV  471

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  472  SPELASMG  479



>ref|XP_008805785.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Phoenix dactylifera]
Length=530

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ V
Sbjct  436  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKV  495

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  496  SPELAAMG  503



>ref|XP_008228305.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X3 
[Prunus mume]
Length=504

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ V
Sbjct  410  KDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQKV  469

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  470  SPELAAMG  477



>ref|XP_007215261.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
 gb|EMJ16460.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
Length=504

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ V
Sbjct  410  KDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQKV  469

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  470  SPELAAMG  477



>ref|XP_008228303.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Prunus mume]
Length=504

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ V
Sbjct  410  KDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQKV  469

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  470  SPELAAMG  477



>ref|XP_008805786.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Phoenix dactylifera]
Length=498

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ V
Sbjct  404  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKV  463

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  464  SPELAAMG  471



>ref|XP_010480028.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Camelina sativa]
Length=502

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  412  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELINILEEAGQKV  471

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  472  SPELASMG  479



>ref|XP_010480030.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Camelina sativa]
Length=464

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  374  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELINILEEAGQKV  433

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  434  SPELASMG  441



>ref|XP_008391321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Malus domestica]
Length=505

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ V
Sbjct  411  KDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_009367550.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Pyrus x bretschneideri]
Length=505

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ +L++AGQ V
Sbjct  411  KDVKFVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  471  SPELAAMG  478



>ref|XP_010106662.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXC11111.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=494

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ V
Sbjct  406  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLITILEEAGQKV  465

Query  357  PPQLSALA  334
             P+L+A+ 
Sbjct  466  SPELAAMG  473



>emb|CDO97919.1| unnamed protein product [Coffea canephora]
Length=500

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ ILQ+AGQ V
Sbjct  410  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKDLINILQEAGQKV  469

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  470  SPELASMG  477



>ref|XP_010462358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Camelina sativa]
Length=502

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  412  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELMNILEEAGQKV  471

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  472  SPELASMG  479



>ref|XP_009380443.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+KIL++AGQ V
Sbjct  407  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLIKILEEAGQKV  466

Query  357  PPQLSAL  337
             P+L+ +
Sbjct  467  NPELAKM  473



>ref|XP_010462359.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Camelina sativa]
Length=464

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  374  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELMNILEEAGQKV  433

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  434  SPELASMG  441



>ref|XP_004297601.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=505

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA TFFT  NA+FA+EL+ +L++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAHTFFTAANARFAKELIGLLEEAGQKV  470

Query  357  PPQLSALA  334
             P L+A+ 
Sbjct  471  SPDLAAMG  478



>ref|XP_004968530.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Setaria italica]
Length=492

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  401  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELINILEEAGQKV  460

Query  357  PPQLSALA  334
              +L+A+ 
Sbjct  461  SSELAAMG  468



>ref|NP_001142117.1| uncharacterized protein LOC100274281 [Zea mays]
 gb|ACF86539.1| unknown [Zea mays]
 gb|ACF87679.1| unknown [Zea mays]
 tpg|DAA52978.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=494

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  403  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELINILEEAGQKV  462

Query  357  PPQLSALA  334
              +L+A+ 
Sbjct  463  SSELAAMG  470



>ref|XP_011011886.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
14-like [Populus euphratica]
Length=788

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+LQ A Q+V
Sbjct  473  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGVAYTFFGDQDAKYASDLIKVLQGANQLV  532

Query  357  PPQLSALAC  331
            PP++ A+A 
Sbjct  533  PPEIRAMAS  541



>ref|XP_003597619.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 ref|XP_003636418.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|ABN08415.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES67870.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=499

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  407  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELISILEEAGQRV  466

Query  357  PPQLSALA  334
              +L+A+ 
Sbjct  467  SSELAAMG  474



>ref|XP_002891814.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68073.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL  IL++AGQ V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELSNILEEAGQKV  470

Query  357  PPQLSALA  334
             P+L+++ 
Sbjct  471  SPELASMG  478



>ref|XP_011072507.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Sesamum indicum]
Length=507

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ V
Sbjct  414  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKV  473

Query  357  PPQLSALA  334
             P+L A+ 
Sbjct  474  SPELVAMG  481



>ref|XP_010314157.1| PREDICTED: ethylene-responsive RNA helicase isoform X1 [Solanum 
lycopersicum]
Length=501

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++LV IL++AGQ V
Sbjct  408  KDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLVNILEEAGQKV  467

Query  357  PPQLSAL  337
             P+L+ +
Sbjct  468  SPELAKM  474



>ref|XP_008673096.1| PREDICTED: putative DEAD-box ATP-dependent RNA helicase family 
protein isoform X1 [Zea mays]
Length=539

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+A+TFF   ++K+A ELVKIL+ A Q V
Sbjct  335  KDIRIVVNYDFPTGVEDYVHRIGRTGRAGATGSAYTFFGDQDSKYASELVKILEGANQSV  394

Query  357  PPQLSALA  334
            PPQL  +A
Sbjct  395  PPQLKEMA  402



>gb|AFK42127.1| unknown [Medicago truncatula]
Length=499

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIG+TGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  407  KDVKYVINYDFPGSLEDYVHRIGKTGRAGAKGTAYTFFTAANARFAKELISILEEAGQRV  466

Query  357  PPQLSALA  334
              +L+A+ 
Sbjct  467  SSELAAMG  474



>ref|XP_004968529.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Setaria italica]
Length=517

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+EL+ IL++AGQ V
Sbjct  401  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELINILEEAGQKV  460

Query  357  PPQLSALA  334
              +L+A+ 
Sbjct  461  SSELAAMG  468



>ref|NP_001234650.1| ethylene-responsive RNA helicase [Solanum lycopersicum]
 gb|AAD46404.1|AF096248_1 ethylene-responsive RNA helicase [Solanum lycopersicum]
Length=474

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++LV IL++AGQ V
Sbjct  381  KDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLVNILEEAGQKV  440

Query  357  PPQLSAL  337
             P+L+ +
Sbjct  441  SPELAKM  447



>ref|NP_001168054.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
 gb|ACN26946.1| unknown [Zea mays]
 tpg|DAA53249.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=672

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+A+TFF   ++K+A ELVKIL+ A Q V
Sbjct  468  KDIRIVVNYDFPTGVEDYVHRIGRTGRAGATGSAYTFFGDQDSKYASELVKILEGANQSV  527

Query  357  PPQLSALA  334
            PPQL  +A
Sbjct  528  PPQLKEMA  535



>ref|XP_006366150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006366151.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Solanum tuberosum]
Length=501

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++LV IL++AGQ V
Sbjct  408  KDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFFTAANARFAKDLVNILEEAGQKV  467

Query  357  PPQLSAL  337
             P+L+ +
Sbjct  468  GPELAKM  474



>gb|EEE54050.1| hypothetical protein OsJ_00740 [Oryza sativa Japonica Group]
Length=468

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ V
Sbjct  377  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKV  436

Query  357  PPQLSALA  334
             P+L+ + 
Sbjct  437  SPELANMG  444



>gb|EEC70110.1| hypothetical protein OsI_00766 [Oryza sativa Indica Group]
Length=470

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ V
Sbjct  379  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKV  438

Query  357  PPQLSALA  334
             P+L+ + 
Sbjct  439  SPELANMG  446



>ref|XP_005850349.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
 gb|EFN58247.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
Length=551

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIK VINYD P+C EDYVHRIGRTGRAGA G A++FFT  N + AR+LV+IL++A Q V
Sbjct  440  KDIKMVINYDMPSCAEDYVHRIGRTGRAGASGAAYSFFTAANGRMARQLVQILEEASQAV  499

Query  357  PPQLSALAC  331
            PP+L   A 
Sbjct  500  PPELRQFAM  508



>ref|XP_009802114.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=501

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+T+FT  NA+FA++L+ IL++AGQ V
Sbjct  408  KDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTYFTAANARFAKDLINILEEAGQKV  467

Query  357  PPQLSAL  337
             P+L+ +
Sbjct  468  SPELAKM  474



>ref|XP_009625322.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=501

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+T+FT  NA+FA++L+ IL++AGQ V
Sbjct  408  KDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTYFTAANARFAKDLINILEEAGQKV  467

Query  357  PPQLSAL  337
             P+L+ +
Sbjct  468  SPELAKM  474



>sp|Q5QMN3.2|RH20_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Oryza sativa 
Japonica Group]
Length=494

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ V
Sbjct  403  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKV  462

Query  357  PPQLSALA  334
             P+L+ + 
Sbjct  463  SPELANMG  470



>ref|XP_006645603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Oryza 
brachyantha]
Length=485

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ V
Sbjct  394  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKV  453

Query  357  PPQLSALA  334
             P+L+ + 
Sbjct  454  SPELANMG  461



>gb|KCW55996.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
Length=246

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q V
Sbjct  83   KDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQRV  142

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  143  PPEIRNMAS  151



>ref|XP_002324002.1| hypothetical protein POPTR_0017s10760g [Populus trichocarpa]
 gb|EEF04135.1| hypothetical protein POPTR_0017s10760g [Populus trichocarpa]
Length=726

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q+V
Sbjct  465  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGVAYTFFGDQDAKYASDLIKVLEGANQLV  524

Query  357  PPQLSALAC  331
            PP++ A+A 
Sbjct  525  PPEIRAMAS  533



>gb|KCW55995.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
Length=267

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q V
Sbjct  104  KDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQRV  163

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  164  PPEIRNMAS  172



>ref|XP_009106904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brassica rapa]
Length=499

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+ELV IL++AGQ V
Sbjct  409  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELVSILEEAGQKV  468

Query  357  PPQLSALA  334
              +L+++ 
Sbjct  469  SHELASMG  476



>emb|CDY02459.1| BnaA08g00660D [Brassica napus]
Length=499

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+ELV IL++AGQ V
Sbjct  409  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELVSILEEAGQKV  468

Query  357  PPQLSALA  334
              +L+++ 
Sbjct  469  SHELASMG  476



>ref|XP_010915213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Elaeis guineensis]
Length=498

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA++L+ IL++AGQ V
Sbjct  404  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKV  463

Query  357  PPQLSALA  334
              +L+A+ 
Sbjct  464  SSELAAMG  471



>gb|KCW55992.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
 gb|KCW55993.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
Length=320

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q V
Sbjct  83   KDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQRV  142

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  143  PPEIRNMAS  151



>gb|KCW55994.1| hypothetical protein EUGRSUZ_I01775 [Eucalyptus grandis]
Length=349

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q V
Sbjct  83   KDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQRV  142

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  143  PPEIRNMAS  151



>ref|XP_006306418.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
 gb|EOA39316.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
Length=499

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV IL++AGQ V
Sbjct  409  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELVNILEEAGQKV  468

Query  357  PPQLSALA  334
              +L+++ 
Sbjct  469  SHELASMG  476



>emb|CDY10596.1| BnaC03g70180D [Brassica napus]
Length=499

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+EL+ IL++AGQ V
Sbjct  409  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELISILEEAGQKV  468

Query  357  PPQLSALA  334
              +L+++ 
Sbjct  469  SHELASMG  476



>ref|XP_004968358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X5 [Setaria italica]
Length=672

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q V
Sbjct  468  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQSV  527

Query  357  PPQLSALA  334
            PPQL  +A
Sbjct  528  PPQLKEMA  535



>ref|XP_006840690.1| hypothetical protein AMTR_s00096p00079870 [Amborella trichopoda]
 gb|ERN02365.1| hypothetical protein AMTR_s00096p00079870 [Amborella trichopoda]
Length=766

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G ++TFF+  +AK+A +L+K+L+ AGQ V
Sbjct  471  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGISYTFFSDQDAKYASDLIKVLEGAGQRV  530

Query  357  PPQLSALAC  331
            PP +  +A 
Sbjct  531  PPDIRNMAS  539



>ref|XP_001763089.1| predicted protein [Physcomitrella patens]
 gb|EDQ71966.1| predicted protein [Physcomitrella patens]
Length=514

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIKCVINYDFP   EDYVHRIGRTGRAGAKG A+TFFT  NAK A+ELV IL +AGQ V
Sbjct  406  KDIKCVINYDFPGSCEDYVHRIGRTGRAGAKGAAYTFFTAANAKHAKELVSILVEAGQPV  465

Query  357  PPQLSALACPggfssggnnfrsrgrggfgnrgsisgsNTVPLGAKRHW  214
              QL A+        GG   R RG GG G     SGSNT+PLG +R W
Sbjct  466  SSQLQAMVGSSRGGGGGGFHRGRGFGGRGFGVQQSGSNTIPLGGQR-W  512



>ref|XP_004968356.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X3 [Setaria italica]
Length=668

 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q V
Sbjct  468  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQSV  527

Query  357  PPQLSALA  334
            PPQL  +A
Sbjct  528  PPQLKEMA  535



>ref|XP_004968357.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X4 [Setaria italica]
Length=667

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q V
Sbjct  468  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQSV  527

Query  357  PPQLSALA  334
            PPQL  +A
Sbjct  528  PPQLKEMA  535



>ref|XP_004968355.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X2 [Setaria italica]
Length=668

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q V
Sbjct  468  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQSV  527

Query  357  PPQLSALA  334
            PPQL  +A
Sbjct  528  PPQLKEMA  535



>gb|KFK38698.1| hypothetical protein AALP_AA3G148400 [Arabis alpina]
Length=499

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+  VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+FA+ELV ILQ+AGQ V
Sbjct  409  KDVMYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELVNILQEAGQKV  468

Query  357  PPQLSALA  334
              +L+++ 
Sbjct  469  SSELASMG  476



>ref|XP_004968354.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like isoform 
X1 [Setaria italica]
Length=702

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+AFTFF   ++K+A +LVKIL+ A Q V
Sbjct  468  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAFTFFGDQDSKYASDLVKILEGADQSV  527

Query  357  PPQLSALA  334
            PPQL  +A
Sbjct  528  PPQLKEMA  535



>ref|XP_001771533.1| predicted protein [Physcomitrella patens]
 gb|EDQ63733.1| predicted protein [Physcomitrella patens]
Length=684

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF+  + K+A+EL+K+L+ A Q V
Sbjct  461  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGLAYTFFSEQDGKYAKELIKVLEGANQKV  520

Query  357  PPQLSALAC  331
            PP+L  +A 
Sbjct  521  PPELKDIAS  529



>ref|XP_004304637.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14 isoform X1 
[Fragaria vesca subsp. vesca]
Length=678

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A EL+K+L+ A Q V
Sbjct  479  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYAAELIKVLEGANQRV  538

Query  357  PPQLSALAC  331
            PP++  LA 
Sbjct  539  PPEIRDLAS  547



>emb|CDM81540.1| unnamed protein product [Triticum aestivum]
Length=496

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGA GTA++FFT  NA+FA++L+ IL +AGQ V
Sbjct  405  KDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYSFFTAANARFAKDLISILVEAGQKV  464

Query  357  PPQLSALA  334
             P+L+ + 
Sbjct  465  SPELANMG  472



>ref|XP_003564953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brachypodium 
distachyon]
Length=496

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGA GTA+TFFT  NA+FA++L+ IL +AGQ V
Sbjct  405  KDVKYVINYDFPGSLEDYVHRIGRTGRAGATGTAYTFFTAANARFAKDLINILVEAGQKV  464

Query  357  PPQLSALA  334
             P+L+ + 
Sbjct  465  SPELANMG  472



>ref|XP_010550155.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14 [Tarenaya hassleriana]
Length=653

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G AFTF    +AK A +L+KIL+ A Q V
Sbjct  479  KDIRVVINYDFPTGIEDYVHRIGRTGRAGATGMAFTFLGEQDAKHASDLIKILEGASQKV  538

Query  357  PPQLSALAC  331
            PPQ+  +A 
Sbjct  539  PPQIREMAS  547



>ref|XP_010029150.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
14 [Eucalyptus grandis]
Length=707

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF+  +AK+A EL+K+L+ A Q V
Sbjct  470  KDIRVVINYDFPTGVEDYVHRIGRTGRAGASGLAHTFFSDQDAKYAAELIKVLEGANQRV  529

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  530  PPEIRNMAS  538



>ref|XP_008654141.1| PREDICTED: ATP-dependent RNA helicase-like protein DB10 [Zea 
mays]
Length=130

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIK VINYDFPT +EDYVHRIGRTGRAGA G ++TFF+  + K A +LVK+LQ   Q V
Sbjct  55   KDIKVVINYDFPTGIEDYVHRIGRTGRAGATGVSYTFFSEHDWKHAGDLVKLLQGVNQHV  114

Query  357  PPQLSALAC  331
            PPQL  +A 
Sbjct  115  PPQLRDMAA  123



>ref|XP_009375127.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like [Pyrus 
x bretschneideri]
 ref|XP_009377198.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like [Pyrus 
x bretschneideri]
Length=667

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  474  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGANQRV  533

Query  357  PPQLSALAC  331
            PP++  LA 
Sbjct  534  PPEIRELAS  542



>gb|EPB85904.1| hypothetical protein HMPREF1544_07320 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=625

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFPT +EDYVHR+GRTGR G  G +FTFFT  NA+ ARELV ILQQ  Q+V
Sbjct  509  KDVKFVINYDFPTNIEDYVHRVGRTGRGGNTGHSFTFFTADNARQARELVDILQQTNQVV  568

Query  357  PPQLSAL  337
             P+L  L
Sbjct  569  DPRLQML  575



>ref|XP_008379232.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like [Malus 
domestica]
Length=673

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  475  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGANQRV  534

Query  357  PPQLSALAC  331
            PP++  LA 
Sbjct  535  PPEVRELAS  543



>ref|XP_009334108.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14 [Pyrus x bretschneideri]
Length=675

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  475  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGANQRV  534

Query  357  PPQLSALAC  331
            PP++  LA 
Sbjct  535  PPEVRELAS  543



>gb|KHN25107.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=378

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDF   LEDYVHRIGR GRAGAKGTA+ +FT  NA+FA++L+ IL++AGQ V
Sbjct  295  KDVKYVINYDFRGSLEDYVHRIGRIGRAGAKGTAYPYFTAANARFAKDLIAILEEAGQKV  354

Query  357  PPQLSALAC  331
             P+L+A+  
Sbjct  355  SPELAAMGS  363



>ref|XP_006675622.1| hypothetical protein BATDEDRAFT_29115 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83025.1| hypothetical protein BATDEDRAFT_29115 [Batrachochytrium dendrobatidis 
JAM81]
Length=483

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VIN+DFP  +EDYVHRIGRTGRA  KGTA+T F+  N K AR+LVKIL++AGQ+V
Sbjct  369  KDVKFVINFDFPNNIEDYVHRIGRTGRANNKGTAYTLFSPDNFKSARDLVKILEEAGQVV  428

Query  357  PPQLSALA  334
             PQL   A
Sbjct  429  DPQLHDFA  436



>ref|XP_004141097.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
46-like [Cucumis sativus]
Length=785

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFP+ +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+KIL+ A Q V
Sbjct  479  KDIRVVINYDFPSGVEDYVHRIGRTGRAGATGIAYTFFGEQDAKYASDLIKILEGANQRV  538

Query  357  PPQLSALAC  331
            PP+L  +A 
Sbjct  539  PPELRDMAS  547



>ref|XP_008341438.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14-like [Malus 
domestica]
Length=667

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  474  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGANQCV  533

Query  357  PPQLSALAC  331
            PP++  LA 
Sbjct  534  PPEVRELAS  542



>ref|XP_008443543.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 46 [Cucumis melo]
Length=778

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFP+ +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+KIL+ A Q V
Sbjct  475  KDIRVVINYDFPSGVEDYVHRIGRTGRAGATGIAYTFFGEQDAKYASDLIKILEGANQRV  534

Query  357  PPQLSALAC  331
            PP+L  +A 
Sbjct  535  PPELRDMAS  543



>ref|XP_004164821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 46-like [Cucumis 
sativus]
Length=778

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFP+ +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+KIL+ A Q V
Sbjct  472  KDIRVVINYDFPSGVEDYVHRIGRTGRAGATGIAYTFFGEQDAKYASDLIKILEGANQRV  531

Query  357  PPQLSALAC  331
            PP+L  +A 
Sbjct  532  PPELRDMAS  540



>gb|KIP10983.1| hypothetical protein PHLGIDRAFT_171911 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=116

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL++A  IV
Sbjct  34   KDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTDNAKSARELITILREAKAIV  93

Query  357  PPQLSALA  334
            PPQL  ++
Sbjct  94   PPQLEEMS  101



>ref|XP_002970463.1| hypothetical protein SELMODRAFT_441099 [Selaginella moellendorffii]
 gb|EFJ28593.1| hypothetical protein SELMODRAFT_441099 [Selaginella moellendorffii]
Length=1198

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TFF   + K+AR+L+K+L+ A Q V
Sbjct  491  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAHTFFAEQDGKYARDLIKVLEGANQKV  550

Query  357  PPQLSALA  334
            PP+L  +A
Sbjct  551  PPELREMA  558



>gb|EYU21378.1| hypothetical protein MIMGU_mgv1a004869mg [Erythranthe guttata]
Length=506

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+T+FT  NA+FA++L+ IL++AGQ V
Sbjct  415  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTYFTVANARFAKDLINILEEAGQKV  474

Query  357  PPQLSALA  334
              +L A+ 
Sbjct  475  SSELVAMG  482



>ref|XP_003032253.1| hypothetical protein SCHCODRAFT_82297 [Schizophyllum commune 
H4-8]
 gb|EFI97350.1| hypothetical protein SCHCODRAFT_82297 [Schizophyllum commune 
H4-8]
Length=488

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI  VINYDFP   EDY+HRIGRTGRAGAKGTA+T+FT  NAK ARELV IL +A Q+V
Sbjct  374  KDIGYVINYDFPNNCEDYIHRIGRTGRAGAKGTAYTYFTTENAKSARELVSILTEAKQVV  433

Query  357  PPQLSALAC  331
            PP+L  +A 
Sbjct  434  PPELQEMAA  442



>ref|XP_002455005.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
 gb|EES00125.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
Length=488

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -1

Query  531  IKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIVPP  352
            +K VINYDFP  LEDYVHRIGRTGRAGAKGTA++FFT  NA+FA+EL+ IL++AGQ V  
Sbjct  401  VKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAANARFAKELISILEEAGQKVSS  460

Query  351  QLSALA  334
            +L+A+ 
Sbjct  461  ELAAMG  466



>ref|XP_010534902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Tarenaya hassleriana]
Length=504

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+F ++L+ IL++A Q V
Sbjct  411  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFVKDLINILEEAEQRV  470

Query  357  PPQLSAL  337
             P+L+A+
Sbjct  471  SPELAAM  477



>ref|XP_002521446.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF40936.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=781

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  474  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFGDQDAKYASDLIKVLEGASQRV  533

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  534  PPEIRDMAS  542



>gb|KDP46436.1| hypothetical protein JCGZ_10276 [Jatropha curcas]
Length=765

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  471  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFGDQDAKYASDLIKVLEGASQRV  530

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  531  PPEIRDMAS  539



>ref|XP_010534903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Tarenaya hassleriana]
Length=432

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  LEDYVHRIGRTGRAGAKGTA+TFFT  NA+F ++L+ IL++A Q V
Sbjct  339  KDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTAANARFVKDLINILEEAEQRV  398

Query  357  PPQLSAL  337
             P+L+A+
Sbjct  399  SPELAAM  405



>gb|EXX56938.1| Dbp2p [Rhizophagus irregularis DAOM 197198w]
Length=601

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFPT +EDYVHRIGRTGR GAKG+A TFFT  NAK A++LV IL++A Q V
Sbjct  507  KDVKLVINYDFPTNVEDYVHRIGRTGRGGAKGSATTFFTMDNAKQAKDLVNILREANQEV  566

Query  357  PPQLSALA  334
             P+L+ LA
Sbjct  567  DPKLADLA  574



>dbj|GAN02653.1| ATP-dependent RNA helicase dbp-2 [Mucor ambiguus]
Length=880

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFPT +EDYVHR+GRTGR G  G +FTFFT  NA+ ARE+V ILQQ  Q+V
Sbjct  509  KDVKFVINYDFPTNIEDYVHRVGRTGRGGNTGHSFTFFTADNARQAREMVDILQQTNQVV  568

Query  357  PPQLSAL  337
             P+L  L
Sbjct  569  DPRLQML  575



>emb|CDO77180.1| hypothetical protein BN946_scf184705.g5 [Trametes cinnabarina]
Length=148

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD++ VINYDFP   EDY+HRIGRTGRAG  GT++T+FT  NAK AREL+ IL++A   V
Sbjct  37   KDVRYVINYDFPNNCEDYIHRIGRTGRAGMTGTSYTYFTTDNAKQARELIGILKEANAQV  96

Query  357  PPQLSALA  334
            PPQL  +A
Sbjct  97   PPQLEEMA  104



>ref|XP_004349647.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR22559.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
Length=706

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD++ VINYDF +  EDYVHRIGRTGRAGA GTA++FFT G+ K A+ L+K+L +AGQ V
Sbjct  514  KDVRYVINYDFASTAEDYVHRIGRTGRAGATGTAYSFFTSGDFKLAKRLIKVLSEAGQEV  573

Query  357  PPQLSALAC  331
            PPQL   A 
Sbjct  574  PPQLHQFAV  582



>ref|XP_002972931.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
 gb|EFJ26152.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
Length=534

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFP   EDYVHRIGRTGRAGAKGTA+TFFT  NAK ARELV IL +AGQ +
Sbjct  402  KDIRYVINYDFPGSCEDYVHRIGRTGRAGAKGTAYTFFTVSNAKHARELVSILSEAGQRI  461

Query  357  PPQLSAL  337
             P+L ++
Sbjct  462  TPELQSM  468



>ref|XP_008230577.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 46 [Prunus mume]
Length=688

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   ++K+A +L+K+L+ A Q V
Sbjct  476  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDSKYASDLIKVLEGANQRV  535

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  536  PPEIREMAT  544



>ref|XP_007217002.1| hypothetical protein PRUPE_ppa002303mg [Prunus persica]
 gb|EMJ18201.1| hypothetical protein PRUPE_ppa002303mg [Prunus persica]
Length=688

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   ++K+A +L+K+L+ A Q V
Sbjct  476  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDSKYASDLIKVLEGANQRV  535

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  536  PPEIREMAT  544



>gb|KHN23518.1| DEAD-box ATP-dependent RNA helicase 46 [Glycine soja]
Length=768

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  470  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGANQKV  529

Query  357  PPQLSALAC  331
            PP+L  ++ 
Sbjct  530  PPELRDMSS  538



>emb|CDS08010.1| hypothetical protein LRAMOSA01959 [Absidia idahoensis var. thermophila]
Length=633

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFPT +EDYVHR+GRTGR GAKG AFTFFT  NA+ ARELV IL++  Q++
Sbjct  517  KDVKFVINYDFPTNIEDYVHRVGRTGRGGAKGQAFTFFTTDNARQARELVGILRETNQVI  576

Query  357  PPQLSALAC  331
             P+L  ++ 
Sbjct  577  DPRLEMMST  585



>ref|XP_007217003.1| hypothetical protein PRUPE_ppa002303mg [Prunus persica]
 gb|EMJ18202.1| hypothetical protein PRUPE_ppa002303mg [Prunus persica]
Length=690

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   ++K+A +L+K+L+ A Q V
Sbjct  478  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDSKYASDLIKVLEGANQRV  537

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  538  PPEIREMAT  546



>emb|CCM04686.1| predicted protein [Fibroporia radiculosa]
Length=755

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL++A  IV
Sbjct  640  KDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGTSYTYFTTDNAKSARELISILREAKAIV  699

Query  357  PPQLSALAC  331
            PPQL  +A 
Sbjct  700  PPQLEEMAM  708



>ref|XP_002987999.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
 gb|EFJ10791.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
Length=505

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFP   EDYVHRIGRTGRAGAKGTA+TFFT  NAK ARELV IL +AGQ +
Sbjct  397  KDIRYVINYDFPGSCEDYVHRIGRTGRAGAKGTAYTFFTVSNAKHARELVSILSEAGQRI  456

Query  357  PPQLSAL  337
             P+L ++
Sbjct  457  TPELQSM  463



>ref|XP_003524550.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 46-like isoform 
X1 [Glycine max]
Length=774

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  479  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDHDAKYASDLIKVLEGANQKV  538

Query  357  PPQLSALAC  331
            PP+L  ++ 
Sbjct  539  PPELRDMSS  547



>ref|XP_006579766.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 46-like isoform 
X2 [Glycine max]
Length=775

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  480  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDHDAKYASDLIKVLEGANQKV  539

Query  357  PPQLSALAC  331
            PP+L  ++ 
Sbjct  540  PPELRDMSS  548



>gb|KHN27447.1| DEAD-box ATP-dependent RNA helicase 46 [Glycine soja]
Length=775

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  480  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDHDAKYASDLIKVLEGANQKV  539

Query  357  PPQLSALAC  331
            PP+L  ++ 
Sbjct  540  PPELRDMSS  548



>ref|XP_008439374.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 40-like, partial 
[Cucumis melo]
Length=603

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF+  + KFA +L+K+L+ A Q V
Sbjct  257  KDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVAYTFFSEQDWKFAADLIKVLEGAEQPV  316

Query  357  PPQLSALA  334
            PP+L  +A
Sbjct  317  PPELQNMA  324



>ref|XP_005710055.1| ATP-dependent RNA helicase DBP2, putative [Chondrus crispus]
 emb|CDF39761.1| ATP-dependent RNA helicase DBP2, putative [Chondrus crispus]
Length=585

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            K ++CVIN+DFP  +EDYVHRIGRTGRAGAKGT+ T FT  N+K AR+L+++++ AGQ +
Sbjct  489  KAVQCVINFDFPNNVEDYVHRIGRTGRAGAKGTSITLFTSNNSKSARDLIQLMRDAGQEI  548

Query  357  PPQLSALA  334
            PP+L  LA
Sbjct  549  PPKLEELA  556



>gb|KIM40445.1| hypothetical protein M413DRAFT_73199 [Hebeloma cylindrosporum 
h7]
Length=489

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK AREL+ IL++A  IV
Sbjct  374  KDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELIGILREAKAIV  433

Query  357  PPQLSALAC  331
            PPQL  +A 
Sbjct  434  PPQLEEMAS  442



>ref|XP_002455105.1| hypothetical protein SORBIDRAFT_03g004420 [Sorghum bicolor]
 gb|EES00225.1| hypothetical protein SORBIDRAFT_03g004420 [Sorghum bicolor]
Length=673

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G+A+TFF   ++K+A +LVKIL+ A Q V
Sbjct  468  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGSAYTFFGDQDSKYASDLVKILEGANQSV  527

Query  357  PPQLSALA  334
            P QL  +A
Sbjct  528  PQQLKEMA  535



>gb|KIM84767.1| hypothetical protein PILCRDRAFT_96565 [Piloderma croceum F 1598]
Length=482

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK ARELV IL++A  +V
Sbjct  374  KDVGYVINYDFPNNCEDYIHRIGRTGRAGMKGISYTYFTTDNAKSARELVTILREAKAVV  433

Query  357  PPQLSALAC  331
            PPQL  +A 
Sbjct  434  PPQLEEMAM  442



>gb|KHN85192.1| putative ATP-dependent RNA helicase DDX17 [Toxocara canis]
Length=763

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  534  DIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIVP  355
            DIK VINYD+P   EDYVHRIGRT R   KGTA+TFFT  NA  AR+L+K++Q+A Q+VP
Sbjct  640  DIKFVINYDYPNNSEDYVHRIGRTARCEKKGTAYTFFTPSNAPKARDLIKVMQEANQVVP  699

Query  354  PQLSALA  334
            PQL  LA
Sbjct  700  PQLMELA  706



>ref|XP_010524303.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 14 [Tarenaya hassleriana]
Length=639

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A TF    + K A +L+KIL+ A Q V
Sbjct  480  KDIRVVINYDFPTGIEDYVHRIGRTGRAGATGLAHTFIGEQDGKHASDLIKILEGANQRV  539

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  540  PPEIREMAS  548



>ref|XP_006958620.1| p68 RNA helicase [Wallemia sebi CBS 633.66]
 gb|EIM21267.1| p68 RNA helicase [Wallemia sebi CBS 633.66]
Length=546

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI  VINYDF + +EDY+HRIGRTGRAG KGT+ TFFT  NAK +R+LVKIL++A Q V
Sbjct  434  KDIGYVINYDFSSNVEDYIHRIGRTGRAGTKGTSITFFTTENAKSSRDLVKILREANQNV  493

Query  357  PPQLSALAC  331
            PP+L  +A 
Sbjct  494  PPELEEMAS  502



>emb|CBI34896.3| unnamed protein product [Vitis vinifera]
Length=1180

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +LVK+L+ A Q V
Sbjct  333  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFAEQDAKYASDLVKVLEGANQRV  392

Query  357  PPQLSALA  334
            PP++  +A
Sbjct  393  PPEIRDMA  400



>ref|XP_008039863.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW57832.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=494

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD++ VINYDFP   EDY+HRIGRTGRAG  GT+FT+FT  NAK AREL+ IL++A  +V
Sbjct  374  KDVRYVINYDFPNNCEDYIHRIGRTGRAGTTGTSFTYFTTDNAKQARELIGILKEAKAVV  433

Query  357  PPQLSALAC  331
            PPQL  ++ 
Sbjct  434  PPQLEEMSM  442



>ref|XP_003745440.1| PREDICTED: probable ATP-dependent RNA helicase DDX5-like [Metaseiulus 
occidentalis]
Length=510

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -1

Query  534  DIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIVP  355
            D+K VINYD+P C EDYVHRIGRT R+   GTA+TFFT  NAK A+EL+ +LQ+A Q+V 
Sbjct  404  DVKFVINYDYPNCSEDYVHRIGRTARSNKTGTAYTFFTSNNAKQAQELIDVLQEAKQVVN  463

Query  354  PQLSALA  334
            P+L  LA
Sbjct  464  PKLYELA  470



>ref|XP_736707.1| helicase [Plasmodium chabaudi chabaudi]
 emb|CAH85853.1| helicase, putative [Plasmodium chabaudi chabaudi]
Length=158

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKIL+++ Q +
Sbjct  73   KDVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKILRESEQPI  132

Query  357  PPQLSALA  334
            PPQL  ++
Sbjct  133  PPQLEKIS  140



>gb|KII89609.1| hypothetical protein PLICRDRAFT_158683 [Plicaturopsis crispa 
FD-325 SS-3]
Length=493

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+  VINYDFP   EDY+HRIGRTGRAG KG ++T+FT  NAK ARELV IL++A  ++
Sbjct  374  KDVGYVINYDFPNNCEDYIHRIGRTGRAGNKGISYTYFTTDNAKSARELVGILREANAVI  433

Query  357  PPQLSALAC  331
            PPQL  +A 
Sbjct  434  PPQLEEMAM  442



>ref|XP_007151015.1| hypothetical protein PHAVU_004G011600g [Phaseolus vulgaris]
 gb|ESW23009.1| hypothetical protein PHAVU_004G011600g [Phaseolus vulgaris]
Length=757

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+K+L+ A Q V
Sbjct  478  KDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKYASDLIKVLEGADQKV  537

Query  357  PPQLSALA  334
            PP+L  ++
Sbjct  538  PPELRDMS  545



>ref|XP_744215.1| helicase  [Plasmodium chabaudi chabaudi]
 emb|CAH74440.1| helicase, truncated, putative [Plasmodium chabaudi chabaudi]
Length=186

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  +EDYVHRIGRTGRAGA G +FTF T    + A+ELVKIL+++ Q +
Sbjct  86   KDVKFVINYDFPNQIEDYVHRIGRTGRAGAHGASFTFLTSDKYRLAKELVKILRESEQPI  145

Query  357  PPQLSALA  334
            PPQL  ++
Sbjct  146  PPQLEKIS  153



>ref|XP_006459201.1| hypothetical protein AGABI2DRAFT_65810 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV49124.1| hypothetical protein AGABI2DRAFT_65810 [Agaricus bisporus var. 
bisporus H97]
Length=494

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL++A  ++
Sbjct  374  KDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTENAKAARELINILREAKAVI  433

Query  357  PPQLSALAC  331
            PPQL  +A 
Sbjct  434  PPQLEEMAA  442



>ref|XP_007330446.1| hypothetical protein AGABI1DRAFT_100622 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78570.1| hypothetical protein AGABI1DRAFT_100622 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=494

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+  VINYDFP   EDY+HRIGRTGRAG KGT++T+FT  NAK AREL+ IL++A  ++
Sbjct  374  KDVGYVINYDFPNNCEDYIHRIGRTGRAGLKGTSYTYFTTENAKAARELINILREAKAVI  433

Query  357  PPQLSALAC  331
            PPQL  +A 
Sbjct  434  PPQLEEMAA  442



>ref|XP_002273908.2| PREDICTED: ATP-dependent RNA helicase-like protein DB10 isoform 
X1 [Vitis vinifera]
Length=863

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +LVK+L+ A Q V
Sbjct  474  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFAEQDAKYASDLVKVLEGANQRV  533

Query  357  PPQLSALA  334
            PP++  +A
Sbjct  534  PPEIRDMA  541



>gb|EPS60732.1| hypothetical protein M569_14070, partial [Genlisea aurea]
Length=563

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            +DI+ VINYDFPT +EDYVHRIGRTGRAGA G ++TFF+  + K+A +L+K+L+ A Q+V
Sbjct  298  RDIRVVINYDFPTGIEDYVHRIGRTGRAGATGISYTFFSEHDWKYAPDLIKLLEGANQVV  357

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  358  PPEIRDIAS  366



>ref|XP_010660890.1| PREDICTED: ATP-dependent RNA helicase-like protein DB10 isoform 
X2 [Vitis vinifera]
Length=862

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK+A +LVK+L+ A Q V
Sbjct  473  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFAEQDAKYASDLVKVLEGANQRV  532

Query  357  PPQLSALA  334
            PP++  +A
Sbjct  533  PPEIRDMA  540



>ref|XP_004159856.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
40-like [Cucumis sativus]
Length=1142

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VIN+DFPT +EDYVHRIGRTGRAGA G A+TFF+  + KFA +L+K+L+ AGQ V
Sbjct  806  KDIRVVINFDFPTGIEDYVHRIGRTGRAGATGVAYTFFSEQDWKFASDLIKVLEGAGQPV  865

Query  357  PPQLSALA  334
            PP+L  +A
Sbjct  866  PPELRNMA  873



>ref|XP_011047343.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 46 [Populus euphratica]
Length=784

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF   +AK A +L+K+L+ A Q V
Sbjct  476  KDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAYTFFGDQDAKHASDLIKVLEGANQQV  535

Query  357  PPQLSALAC  331
            PP++  +A 
Sbjct  536  PPEIRDMAS  544



>ref|XP_007414813.1| hypothetical protein MELLADRAFT_78893 [Melampsora larici-populina 
98AG31]
 gb|EGG01979.1| hypothetical protein MELLADRAFT_78893 [Melampsora larici-populina 
98AG31]
Length=537

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+  VINYD P  +EDY+HRIGRTGRAG  GTA+++ +    K ARELVKILQ A Q+V
Sbjct  420  KDVAYVINYDMPNGIEDYIHRIGRTGRAGRTGTAYSYISADQGKLARELVKILQDAKQVV  479

Query  357  PPQLSALAC  331
            PP L  L+ 
Sbjct  480  PPALVELSS  488



>ref|XP_005705091.1| DEAD-box family RNA-dependent helicase [Galdieria sulphuraria]
 gb|EME28571.1| DEAD-box family RNA-dependent helicase [Galdieria sulphuraria]
Length=160

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KD+K VINYDFP  +EDYVHRIGRTGRAGA G + TFFT    + A+ELV +L++AGQ V
Sbjct  47   KDVKYVINYDFPHTIEDYVHRIGRTGRAGALGKSHTFFTPDKFRVAKELVNLLREAGQDV  106

Query  357  PPQLSAL  337
            PP+L+ L
Sbjct  107  PPELARL  113



>ref|XP_001760431.1| predicted protein [Physcomitrella patens]
 gb|EDQ74822.1| predicted protein [Physcomitrella patens]
Length=675

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFPT +EDYVHRIGRTGRAGA G A+TFF+  + K+A+EL+K+L+ A Q V
Sbjct  466  KDIRFVVNYDFPTGVEDYVHRIGRTGRAGATGLAYTFFSEQDGKYAKELIKVLEGANQKV  525

Query  357  PPQLSALAC  331
            P +L  +A 
Sbjct  526  PQELKDIAS  534



>ref|XP_003618185.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES74403.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=718

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+N+DFPT +EDYVHRIGRTGRAGA G A+TFF   +AK A +L+KIL+ A Q V
Sbjct  475  KDIRVVVNFDFPTGVEDYVHRIGRTGRAGATGIAYTFFGDQDAKHASDLIKILEGANQRV  534

Query  357  PPQLSALAC  331
            PP+L  L+ 
Sbjct  535  PPELRELSS  543



>ref|XP_008439373.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 40-like [Cucumis 
melo]
Length=1106

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFPT +EDYVHRIGRTGRAGA G A+TFF+  + KF+ +L+K+L+ AGQ V
Sbjct  760  KDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVAYTFFSEQDWKFSSDLIKVLEGAGQPV  819

Query  357  PPQLSALA  334
            PP+L  +A
Sbjct  820  PPELRNMA  827



>gb|KGN57060.1| hypothetical protein Csa_3G151370 [Cucumis sativus]
Length=1193

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VIN+DFPT +EDYVHRIGRTGRAGA G A+TFF+  + KFA +L+K+L+ AGQ V
Sbjct  857  KDIRVVINFDFPTGIEDYVHRIGRTGRAGATGVAYTFFSEQDWKFASDLIKVLEGAGQPV  916

Query  357  PPQLSALA  334
            PP+L  +A
Sbjct  917  PPELRNMA  924



>gb|KGN59687.1| hypothetical protein Csa_3G838660 [Cucumis sativus]
Length=840

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 44/68 (65%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFP+ +EDYVHRIGRTGRAGA G A+TFF   +AK+A +L+KIL+ A Q V
Sbjct  534  KDIRVVINYDFPSGVEDYVHRIGRTGRAGATGIAYTFFGEQDAKYASDLIKILEGANQRV  593

Query  357  PPQLSALA  334
            PP+L  +A
Sbjct  594  PPELRDMA  601



>ref|XP_006408522.1| hypothetical protein EUTSA_v10020294mg [Eutrema salsugineum]
 gb|ESQ49975.1| hypothetical protein EUTSA_v10020294mg [Eutrema salsugineum]
Length=629

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFP  +EDYVHRIGRTGRAGA G AFTFF   ++K A +L+KIL+ A Q V
Sbjct  478  KDIRAVINYDFPNGVEDYVHRIGRTGRAGATGQAFTFFGDQDSKHASDLIKILEGANQRV  537

Query  357  PPQLSALAC  331
            PPQ+  +A 
Sbjct  538  PPQIREMAT  546



>ref|XP_003618186.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=619

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+N+DFPT +EDYVHRIGRTGRAGA G A+TFF   +AK A +L+KIL+ A Q V
Sbjct  475  KDIRVVVNFDFPTGVEDYVHRIGRTGRAGATGIAYTFFGDQDAKHASDLIKILEGANQRV  534

Query  357  PPQLSALAC  331
            PP+L  L+ 
Sbjct  535  PPELRELSS  543



>dbj|BAF00715.1| DRH1 DEAD box protein - like [Arabidopsis thaliana]
Length=450

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ V+NYDFP  +EDYVHRIGRTGRAGA G A+TFF   +AK A +L+KIL+ A Q V
Sbjct  277  KDIRVVVNYDFPNGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKHASDLIKILEGANQKV  336

Query  357  PPQLSALAC  331
            PPQ+  +A 
Sbjct  337  PPQVREMAT  345



>ref|XP_001690022.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP09760.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
Length=513

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDIK V+NYD P   EDYVHRIGRTGRAGA GTA++FFT+G+A+ AR++V ++Q+AGQ  
Sbjct  421  KDIKVVVNYDMPKTAEDYVHRIGRTGRAGATGTAYSFFTNGDARLARQVVDVMQEAGQQP  480

Query  357  PPQLSAL  337
            PP+L  +
Sbjct  481  PPELMQM  487



>ref|XP_006408521.1| hypothetical protein EUTSA_v10020294mg [Eutrema salsugineum]
 gb|ESQ49974.1| hypothetical protein EUTSA_v10020294mg [Eutrema salsugineum]
Length=627

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  537  KDIKCVINYDFPTCLEDYVHrigrtgragakgtaftffTHGNAKFARELVKILQQAGQIV  358
            KDI+ VINYDFP  +EDYVHRIGRTGRAGA G AFTFF   ++K A +L+KIL+ A Q V
Sbjct  478  KDIRAVINYDFPNGVEDYVHRIGRTGRAGATGQAFTFFGDQDSKHASDLIKILEGANQRV  537

Query  357  PPQLSALAC  331
            PPQ+  +A 
Sbjct  538  PPQIREMAT  546



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553719916385