BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF019C04

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089660.1|  PREDICTED: galacturonosyltransferase 8-like        427   1e-143   Sesamum indicum [beniseed]
ref|XP_009775386.1|  PREDICTED: galacturonosyltransferase 8             425   3e-143   Nicotiana sylvestris
gb|EYU40627.1|  hypothetical protein MIMGU_mgv1a003761mg                425   4e-143   Erythranthe guttata [common monkey flower]
ref|XP_009614844.1|  PREDICTED: galacturonosyltransferase 8             424   5e-143   Nicotiana tomentosiformis
emb|CAJ34814.1|  glycosyltransferase                                    415   9e-143   Plantago major [cart-track plant]
gb|KDP26352.1|  hypothetical protein JCGZ_17510                         423   1e-142   Jatropha curcas
ref|XP_010246719.1|  PREDICTED: galacturonosyltransferase 8             421   2e-141   Nelumbo nucifera [Indian lotus]
ref|XP_003552108.1|  PREDICTED: galacturonosyltransferase 8-like        419   6e-141   Glycine max [soybeans]
ref|XP_007140673.1|  hypothetical protein PHAVU_008G132200g             419   6e-141   Phaseolus vulgaris [French bean]
gb|ABK92560.1|  unknown                                                 418   1e-140   Populus trichocarpa [western balsam poplar]
ref|XP_011024611.1|  PREDICTED: galacturonosyltransferase 8             418   1e-140   Populus euphratica
ref|XP_002301803.1|  hypothetical protein POPTR_0002s24790g             418   1e-140   Populus trichocarpa [western balsam poplar]
ref|XP_006584621.1|  PREDICTED: uncharacterized protein LOC100817...    417   3e-140   
emb|CBI25666.3|  unnamed protein product                                415   3e-140   Vitis vinifera
ref|XP_004515038.1|  PREDICTED: galacturonosyltransferase 8-like        417   5e-140   Cicer arietinum [garbanzo]
ref|XP_002273962.2|  PREDICTED: galacturonosyltransferase 8             417   6e-140   Vitis vinifera
ref|XP_004242412.1|  PREDICTED: galacturonosyltransferase 8-like        417   6e-140   Solanum lycopersicum
gb|KDO65982.1|  hypothetical protein CISIN_1g008561mg                   416   9e-140   Citrus sinensis [apfelsine]
ref|NP_001242612.1|  uncharacterized protein LOC100817076               416   1e-139   
ref|XP_006479231.1|  PREDICTED: galacturonosyltransferase 8-like        416   1e-139   Citrus sinensis [apfelsine]
gb|KHG16505.1|  Galacturonosyltransferase 8 -like protein               416   1e-139   Gossypium arboreum [tree cotton]
ref|XP_002532733.1|  Glycosyltransferase QUASIMODO1, putative           416   1e-139   Ricinus communis
gb|KJB08801.1|  hypothetical protein B456_001G104800                    410   2e-139   Gossypium raimondii
ref|XP_006352682.1|  PREDICTED: galacturonosyltransferase 8-like        416   2e-139   Solanum tuberosum [potatoes]
gb|ABD65461.1|  transferring glycosyl protein                           402   3e-139   Gossypium hirsutum [American cotton]
ref|XP_006418657.1|  hypothetical protein EUTSA_v10002465mg             415   3e-139   Eutrema salsugineum [saltwater cress]
ref|XP_003622860.1|  Glycosyltransferase CAZy family GT8                410   3e-139   
gb|KHG21596.1|  Galacturonosyltransferase 8 -like protein               415   4e-139   Gossypium arboreum [tree cotton]
emb|CDY61593.1|  BnaC03g74220D                                          414   4e-139   Brassica napus [oilseed rape]
emb|CDX93049.1|  BnaA03g37710D                                          414   5e-139   
ref|XP_009136103.1|  PREDICTED: galacturonosyltransferase 8             414   5e-139   Brassica rapa
gb|KJB10196.1|  hypothetical protein B456_001G188500                    409   5e-139   Gossypium raimondii
ref|XP_009102430.1|  PREDICTED: galacturonosyltransferase 8-like        415   5e-139   Brassica rapa
gb|KJB08802.1|  hypothetical protein B456_001G104800                    414   6e-139   Gossypium raimondii
ref|XP_010513952.1|  PREDICTED: galacturonosyltransferase 8-like        414   7e-139   Camelina sativa [gold-of-pleasure]
ref|XP_010488624.1|  PREDICTED: galacturonosyltransferase 8-like        414   7e-139   Camelina sativa [gold-of-pleasure]
ref|XP_010466934.1|  PREDICTED: galacturonosyltransferase 8             414   8e-139   Camelina sativa [gold-of-pleasure]
ref|XP_006297348.1|  hypothetical protein CARUB_v10013367mg             414   9e-139   Capsella rubella
ref|XP_010036787.1|  PREDICTED: galacturonosyltransferase 8             414   9e-139   Eucalyptus grandis [rose gum]
ref|XP_002863088.1|  hypothetical protein ARALYDRAFT_497166             414   1e-138   Arabidopsis lyrata subsp. lyrata
ref|XP_010104168.1|  Galacturonosyltransferase 8                        414   1e-138   Morus notabilis
ref|NP_189150.1|  Galacturonosyltransferase 8                           413   1e-138   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10198.1|  hypothetical protein B456_001G188500                    413   1e-138   Gossypium raimondii
emb|CDX77366.1|  BnaA07g05040D                                          412   2e-138   
gb|KJB10199.1|  hypothetical protein B456_001G188500                    413   2e-138   Gossypium raimondii
gb|KJB10200.1|  hypothetical protein B456_001G188500                    413   4e-138   Gossypium raimondii
ref|XP_010527263.1|  PREDICTED: galacturonosyltransferase 8             412   6e-138   Tarenaya hassleriana [spider flower]
ref|XP_010696262.1|  PREDICTED: galacturonosyltransferase 8             411   9e-138   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008382600.1|  PREDICTED: galacturonosyltransferase 8-like        410   1e-137   Malus domestica [apple tree]
ref|XP_010532909.1|  PREDICTED: galacturonosyltransferase 8-like        409   5e-137   Tarenaya hassleriana [spider flower]
ref|XP_009372229.1|  PREDICTED: galacturonosyltransferase 8-like        409   5e-137   Pyrus x bretschneideri [bai li]
ref|XP_008235436.1|  PREDICTED: galacturonosyltransferase 8             409   7e-137   Prunus mume [ume]
ref|XP_004149774.1|  PREDICTED: galacturonosyltransferase 8-like        408   1e-136   Cucumis sativus [cucumbers]
ref|XP_008458050.1|  PREDICTED: galacturonosyltransferase 8             408   2e-136   Cucumis melo [Oriental melon]
emb|CDP03909.1|  unnamed protein product                                407   3e-136   Coffea canephora [robusta coffee]
ref|XP_010257858.1|  PREDICTED: probable galacturonosyltransferase 9    407   4e-136   Nelumbo nucifera [Indian lotus]
ref|XP_007201169.1|  hypothetical protein PRUPE_ppa003603mg             406   1e-135   Prunus persica
ref|XP_009404224.1|  PREDICTED: galacturonosyltransferase 8-like        405   1e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007142473.1|  hypothetical protein PHAVU_008G283600g             405   1e-135   Phaseolus vulgaris [French bean]
ref|XP_008372509.1|  PREDICTED: galacturonosyltransferase 8             406   1e-135   
ref|XP_009372029.1|  PREDICTED: galacturonosyltransferase 8-like        405   3e-135   Pyrus x bretschneideri [bai li]
ref|XP_008778166.1|  PREDICTED: galacturonosyltransferase 8-like        404   4e-135   Phoenix dactylifera
ref|XP_008803497.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    404   8e-135   Phoenix dactylifera
ref|XP_007049694.1|  Nucleotide-diphospho-sugar transferases supe...    403   1e-134   
ref|XP_008457595.1|  PREDICTED: galacturonosyltransferase 8-like        403   2e-134   Cucumis melo [Oriental melon]
ref|XP_010913084.1|  PREDICTED: galacturonosyltransferase 8             402   3e-134   Elaeis guineensis
ref|XP_006841268.1|  hypothetical protein AMTR_s00135p00111710          400   1e-133   Amborella trichopoda
ref|XP_009379995.1|  PREDICTED: galacturonosyltransferase 8-like        399   3e-133   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010908797.1|  PREDICTED: galacturonosyltransferase 8-like        399   4e-133   Elaeis guineensis
ref|XP_004290178.1|  PREDICTED: galacturonosyltransferase 8             399   7e-133   Fragaria vesca subsp. vesca
ref|NP_001168623.1|  uncharacterized protein LOC100382408               387   2e-132   Zea mays [maize]
gb|AID53187.1|  galacturonosyltransferase 8-like protein                396   7e-132   Dendrobium officinale
gb|AFW71494.1|  hypothetical protein ZEAMMB73_252708                    394   2e-131   
ref|XP_002453869.1|  hypothetical protein SORBIDRAFT_04g020140          393   6e-131   Sorghum bicolor [broomcorn]
ref|XP_004952528.1|  PREDICTED: galacturonosyltransferase 8-like        392   2e-130   Setaria italica
ref|XP_006384242.1|  hypothetical protein POPTR_0004s10980g             392   4e-130   Populus trichocarpa [western balsam poplar]
ref|XP_011012259.1|  PREDICTED: probable galacturonosyltransferase 9    390   1e-129   Populus euphratica
ref|XP_006373520.1|  hypothetical protein POPTR_0017s144802g            388   2e-129   
gb|KDP24309.1|  hypothetical protein JCGZ_25605                         389   5e-129   Jatropha curcas
ref|XP_006482345.1|  PREDICTED: probable galacturonosyltransferas...    389   5e-129   Citrus sinensis [apfelsine]
ref|XP_006430887.1|  hypothetical protein CICLE_v10011396mg             389   5e-129   Citrus clementina [clementine]
ref|XP_006648647.1|  PREDICTED: galacturonosyltransferase 8-like        383   8e-129   Oryza brachyantha
ref|XP_011021133.1|  PREDICTED: probable galacturonosyltransferase 9    388   1e-128   Populus euphratica
emb|CDP02368.1|  unnamed protein product                                388   1e-128   Coffea canephora [robusta coffee]
ref|XP_008230332.1|  PREDICTED: probable galacturonosyltransferase 9    387   3e-128   Prunus mume [ume]
gb|EEC73220.1|  hypothetical protein OsI_07307                          386   3e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_002530802.1|  Glycosyltransferase QUASIMODO1, putative           387   4e-128   Ricinus communis
dbj|BAD23465.1|  putative glycosyl transferase                          385   4e-128   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046899.1|  Os02g0498700                                       387   4e-128   
gb|KJB10201.1|  hypothetical protein B456_001G188500                    385   1e-127   Gossypium raimondii
gb|EMS51766.1|  Galacturonosyltransferase 8                             373   6e-127   Triticum urartu
ref|XP_002987448.1|  Quasimodo1-like protein                            380   3e-126   
ref|XP_003572545.1|  PREDICTED: galacturonosyltransferase 8-like        380   3e-126   Brachypodium distachyon [annual false brome]
ref|XP_008379476.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    381   6e-126   
ref|XP_002980055.1|  Quasimodo1-like protein                            379   1e-125   
ref|XP_009373741.1|  PREDICTED: probable galacturonosyltransferase 9    380   1e-125   Pyrus x bretschneideri [bai li]
ref|XP_008341825.1|  PREDICTED: probable galacturonosyltransferase 9    380   1e-125   
dbj|BAK03588.1|  predicted protein                                      380   2e-125   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009603685.1|  PREDICTED: probable galacturonosyltransferase 9    377   1e-124   Nicotiana tomentosiformis
ref|XP_009792003.1|  PREDICTED: probable galacturonosyltransferase 9    377   2e-124   Nicotiana sylvestris
ref|XP_010100891.1|  putative galacturonosyltransferase 9               378   3e-124   
ref|XP_006338312.1|  PREDICTED: probable galacturonosyltransferas...    375   8e-124   Solanum tuberosum [potatoes]
ref|XP_007032944.1|  Glycosyltransferase isoform 2                      373   9e-124   
ref|XP_004232120.1|  PREDICTED: probable galacturonosyltransferase 9    375   1e-123   
ref|XP_007032943.1|  Glycosyltransferase isoform 1                      374   3e-123   
ref|XP_010029444.1|  PREDICTED: probable galacturonosyltransferase 9    370   1e-121   Eucalyptus grandis [rose gum]
ref|XP_010660537.1|  PREDICTED: probable galacturonosyltransferase 9    368   3e-121   Vitis vinifera
gb|AFV46220.1|  hypothetical protein                                    357   7e-121   Scutellaria baicalensis [Baikal skullcap]
ref|XP_010558537.1|  PREDICTED: probable galacturonosyltransferase 9    368   1e-120   Tarenaya hassleriana [spider flower]
ref|XP_010549958.1|  PREDICTED: probable galacturonosyltransferas...    367   2e-120   Tarenaya hassleriana [spider flower]
emb|CAN73730.1|  hypothetical protein VITISV_022574                     365   3e-120   Vitis vinifera
gb|KHG03994.1|  putative galacturonosyltransferase 9 -like protein      365   5e-120   Gossypium arboreum [tree cotton]
gb|AFK41629.1|  unknown                                                 355   6e-120   Lotus japonicus
ref|XP_003635905.1|  Glycosyltransferase                                364   2e-119   
gb|KJB48245.1|  hypothetical protein B456_008G059800                    362   3e-119   Gossypium raimondii
ref|XP_010694564.1|  PREDICTED: probable galacturonosyltransferase 9    363   3e-119   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB48243.1|  hypothetical protein B456_008G059800                    363   6e-119   Gossypium raimondii
gb|KJB10520.1|  hypothetical protein B456_001G205700                    360   6e-119   Gossypium raimondii
ref|XP_006593710.1|  PREDICTED: probable galacturonosyltransferas...    362   7e-119   
ref|XP_007151434.1|  hypothetical protein PHAVU_004G045900g             362   9e-119   Phaseolus vulgaris [French bean]
ref|XP_010549955.1|  PREDICTED: probable galacturonosyltransferas...    362   1e-118   Tarenaya hassleriana [spider flower]
gb|KHN02656.1|  Putative galacturonosyltransferase 9                    362   1e-118   Glycine soja [wild soybean]
ref|XP_006603944.1|  PREDICTED: probable galacturonosyltransferas...    361   2e-118   Glycine max [soybeans]
ref|XP_002310951.2|  hypothetical protein POPTR_0008s01050g             361   2e-118   
gb|KJB10519.1|  hypothetical protein B456_001G205700                    361   4e-118   Gossypium raimondii
ref|XP_011085570.1|  PREDICTED: probable galacturonosyltransferase 9    360   5e-118   Sesamum indicum [beniseed]
ref|XP_011033002.1|  PREDICTED: galacturonosyltransferase 8-like        360   1e-117   Populus euphratica
gb|KHG26626.1|  putative galacturonosyltransferase 9 -like protein      359   1e-117   Gossypium arboreum [tree cotton]
ref|XP_004507267.1|  PREDICTED: probable galacturonosyltransferas...    358   3e-117   Cicer arietinum [garbanzo]
gb|EYU39355.1|  hypothetical protein MIMGU_mgv1a003891mg                355   5e-116   Erythranthe guttata [common monkey flower]
dbj|BAD94466.1|  hypothetical protein                                   343   7e-116   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37701.1|  hypothetical protein AALP_AA3G017600                    352   9e-115   Arabis alpina [alpine rockcress]
ref|XP_011099072.1|  PREDICTED: probable galacturonosyltransferase 9    352   9e-115   Sesamum indicum [beniseed]
ref|XP_010463640.1|  PREDICTED: probable galacturonosyltransferase 9    352   9e-115   Camelina sativa [gold-of-pleasure]
gb|ABD96904.1|  hypothetical protein                                    350   2e-114   Tarenaya spinosa
gb|AHL38785.1|  glycosyltransferase                                     352   2e-114   Arabidopsis thaliana [mouse-ear cress]
gb|EPS65125.1|  glycosyltransferase                                     351   2e-114   Genlisea aurea
ref|NP_566170.1|  putative galacturonosyltransferase 9                  351   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882224.1|  hypothetical protein ARALYDRAFT_477468             351   2e-114   
ref|XP_006408424.1|  hypothetical protein EUTSA_v10020416mg             351   2e-114   Eutrema salsugineum [saltwater cress]
ref|XP_006297346.1|  hypothetical protein CARUB_v10013365mg             351   3e-114   
ref|XP_008455575.1|  PREDICTED: probable galacturonosyltransferase 9    350   4e-114   Cucumis melo [Oriental melon]
ref|XP_009378304.1|  PREDICTED: probable galacturonosyltransferase 9    350   5e-114   Pyrus x bretschneideri [bai li]
ref|XP_004137150.1|  PREDICTED: probable galacturonosyltransferas...    349   1e-113   Cucumis sativus [cucumbers]
ref|XP_009134662.1|  PREDICTED: probable galacturonosyltransferas...    348   1e-113   Brassica rapa
ref|XP_010476066.1|  PREDICTED: probable galacturonosyltransferase 9    349   2e-113   Camelina sativa [gold-of-pleasure]
emb|CDX91987.1|  BnaC03g32890D                                          348   3e-113   
ref|XP_009134660.1|  PREDICTED: probable galacturonosyltransferas...    348   3e-113   Brassica rapa
ref|XP_010485478.1|  PREDICTED: probable galacturonosyltransferase 9    348   3e-113   Camelina sativa [gold-of-pleasure]
emb|CDX74263.1|  BnaA03g27840D                                          348   3e-113   
emb|CDY34723.1|  BnaA01g33020D                                          346   4e-113   Brassica napus [oilseed rape]
emb|CDY00812.1|  BnaCnng00120D                                          344   5e-113   
ref|XP_004304175.1|  PREDICTED: probable galacturonosyltransferase 9    346   1e-112   Fragaria vesca subsp. vesca
ref|XP_009117942.1|  PREDICTED: probable galacturonosyltransferase 9    346   1e-112   
ref|XP_010326484.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    332   2e-107   Solanum lycopersicum
ref|XP_009409999.1|  PREDICTED: probable galacturonosyltransferase 9    323   7e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001131608.1|  uncharacterized protein LOC100192958               313   8e-104   
gb|AFW67949.1|  hypothetical protein ZEAMMB73_846223                    313   1e-103   
gb|AFW67950.1|  hypothetical protein ZEAMMB73_846223                    317   3e-103   
ref|XP_010937117.1|  PREDICTED: probable galacturonosyltransferase 9    322   4e-103   Elaeis guineensis
gb|AFW67951.1|  hypothetical protein ZEAMMB73_846223                    320   6e-103   
ref|XP_008802618.1|  PREDICTED: probable galacturonosyltransferase 9    320   9e-103   Phoenix dactylifera
gb|ACF78990.1|  unknown                                                 312   1e-102   Zea mays [maize]
ref|XP_006657336.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    322   1e-102   Oryza brachyantha
ref|NP_001169332.1|  hypothetical protein precursor                     321   3e-102   Zea mays [maize]
ref|XP_008650863.1|  PREDICTED: uncharacterized protein LOC100192...    321   4e-102   Zea mays [maize]
gb|EEC81302.1|  hypothetical protein OsI_24438                          320   4e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_008784292.1|  PREDICTED: probable galacturonosyltransferase 9    318   6e-102   Phoenix dactylifera
ref|XP_008671920.1|  PREDICTED: uncharacterized protein LOC100191...    318   1e-101   Zea mays [maize]
ref|XP_001785716.1|  predicted protein                                  307   1e-101   
ref|XP_010939506.1|  PREDICTED: probable galacturonosyltransferase 9    317   2e-101   Elaeis guineensis
ref|XP_008650862.1|  PREDICTED: uncharacterized protein LOC100192...    321   2e-101   
gb|EEC84934.1|  hypothetical protein OsI_32147                          322   2e-101   Oryza sativa Indica Group [Indian rice]
ref|XP_004982129.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   2e-101   
ref|NP_001063757.1|  Os09g0531900                                       321   2e-101   
ref|NP_001130678.1|  uncharacterized protein LOC100191781 precursor     318   3e-101   Zea mays [maize]
tpg|DAA50750.1|  TPA: hypothetical protein ZEAMMB73_194342              318   4e-101   
ref|XP_002466644.1|  hypothetical protein SORBIDRAFT_01g011560          317   7e-101   Sorghum bicolor [broomcorn]
ref|XP_006660882.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   8e-101   Oryza brachyantha
ref|XP_008650861.1|  PREDICTED: uncharacterized protein LOC100192...    321   9e-101   Zea mays [maize]
ref|XP_002462717.1|  hypothetical protein SORBIDRAFT_02g030820          320   1e-100   Sorghum bicolor [broomcorn]
emb|CDX71763.1|  BnaC08g31110D                                          319   1e-100   
emb|CDY52336.1|  BnaA09g38850D                                          319   1e-100   Brassica napus [oilseed rape]
ref|XP_009116771.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    319   1e-100   Brassica rapa
ref|XP_010523706.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    319   2e-100   Tarenaya hassleriana [spider flower]
ref|XP_009381434.1|  PREDICTED: probable galacturonosyltransferase 9    313   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS50352.1|  Alpha-1,4-galacturonosyltransferase 1                   313   3e-100   Triticum urartu
ref|XP_006375320.1|  hypothetical protein POPTR_0014s06970g             311   5e-100   
dbj|BAJ99110.1|  predicted protein                                      315   6e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578496.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   7e-100   
ref|XP_008670350.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    314   7e-100   
ref|XP_004957448.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    317   8e-100   Setaria italica
ref|XP_002320745.2|  glycosyl transferase family 8 family protein       312   9e-100   
ref|XP_010231443.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    314   1e-99    Brachypodium distachyon [annual false brome]
ref|XP_006828896.1|  hypothetical protein AMTR_s00001p00190810          317   1e-99    
ref|XP_010512443.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    317   1e-99    Camelina sativa [gold-of-pleasure]
emb|CDY42486.1|  BnaC04g21950D                                          316   1e-99    Brassica napus [oilseed rape]
ref|XP_010512445.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   1e-99    Camelina sativa [gold-of-pleasure]
emb|CDX89098.1|  BnaA04g00880D                                          316   1e-99    
ref|XP_010469034.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010512446.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010272612.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   2e-99    Nelumbo nucifera [Indian lotus]
ref|XP_011460082.1|  PREDICTED: probable galacturonosyltransferas...    315   2e-99    Fragaria vesca subsp. vesca
ref|XP_010512444.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_011460081.1|  PREDICTED: probable galacturonosyltransferas...    315   2e-99    Fragaria vesca subsp. vesca
ref|XP_008670348.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    314   2e-99    
ref|XP_010413456.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_011460080.1|  PREDICTED: probable galacturonosyltransferas...    315   2e-99    Fragaria vesca subsp. vesca
gb|EMT14751.1|  Glycosyltransferase QUASIMODO1                          313   3e-99    
ref|XP_008670347.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    314   3e-99    
ref|XP_006339506.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   3e-99    Solanum tuberosum [potatoes]
ref|XP_002962728.1|  GAUT1, alpha-1,4-galaturonosyltransferase-li...    311   4e-99    
ref|XP_001779123.1|  predicted protein                                  311   4e-99    
ref|XP_010056256.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    315   4e-99    Eucalyptus grandis [rose gum]
ref|XP_002980359.1|  Glycosyltransferase, CAZy family GT8               311   5e-99    
ref|XP_006402518.1|  hypothetical protein EUTSA_v10005820mg             315   5e-99    Eutrema salsugineum [saltwater cress]
ref|XP_002876594.1|  GAUT1/LGT1                                         315   5e-99    
ref|XP_004229870.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    315   5e-99    Solanum lycopersicum
gb|KHN04100.1|  Alpha-1,4-galacturonosyltransferase 1                   315   5e-99    Glycine soja [wild soybean]
ref|XP_006576391.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    315   5e-99    Glycine max [soybeans]
ref|NP_191672.1|  alpha-1,4-galacturonosyltransferase 1                 315   6e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290325.1|  hypothetical protein CARUB_v10016785mg             315   6e-99    
ref|XP_008776919.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    315   8e-99    Phoenix dactylifera
ref|XP_011002081.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    314   9e-99    Populus euphratica
ref|XP_007051985.1|  Galacturonosyltransferase 1                        314   9e-99    
ref|XP_002511763.1|  transferase, transferring glycosyl groups, p...    315   9e-99    
ref|XP_011002080.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    314   1e-98    Populus euphratica
gb|KJB41168.1|  hypothetical protein B456_007G093500                    314   1e-98    Gossypium raimondii
ref|XP_004172284.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    314   1e-98    
ref|XP_004144992.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    313   2e-98    
ref|XP_008670346.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    313   2e-98    Zea mays [maize]
ref|XP_008232828.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    313   2e-98    Prunus mume [ume]
ref|XP_008232829.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    313   2e-98    Prunus mume [ume]
gb|KDP28715.1|  hypothetical protein JCGZ_14486                         313   2e-98    Jatropha curcas
ref|XP_009107093.1|  PREDICTED: probable galacturonosyltransferase 4    312   2e-98    Brassica rapa
dbj|BAJ53137.1|  JHL05D22.8                                             314   2e-98    Jatropha curcas
ref|XP_008460145.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    313   2e-98    
ref|XP_009138790.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    313   2e-98    
ref|XP_011469111.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    313   3e-98    Fragaria vesca subsp. vesca
ref|XP_009418721.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    312   3e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007220901.1|  hypothetical protein PRUPE_ppa002418mg             313   3e-98    Prunus persica
ref|XP_008670345.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    313   3e-98    Zea mays [maize]
ref|XP_010934420.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    313   4e-98    
ref|XP_002302550.1|  hypothetical protein POPTR_0002s15270g             311   4e-98    
ref|XP_001770653.1|  predicted protein                                  308   5e-98    
gb|KHN04587.1|  Alpha-1,4-galacturonosyltransferase 1                   312   6e-98    Glycine soja [wild soybean]
ref|XP_006445203.1|  hypothetical protein CICLE_v10019146mg             312   6e-98    Citrus clementina [clementine]
ref|XP_010910637.1|  PREDICTED: probable galacturonosyltransferas...    308   6e-98    Elaeis guineensis
ref|XP_006583368.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    311   6e-98    Glycine max [soybeans]
ref|XP_009589124.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    312   6e-98    Nicotiana tomentosiformis
gb|KDO85920.1|  hypothetical protein CISIN_1g005683mg                   312   6e-98    Citrus sinensis [apfelsine]
ref|XP_004168876.1|  PREDICTED: probable galacturonosyltransferas...    311   7e-98    
ref|XP_011014842.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    312   7e-98    Populus euphratica
ref|XP_011014841.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    312   7e-98    Populus euphratica
ref|XP_009418719.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    312   7e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010647084.1|  PREDICTED: probable galacturonosyltransferase 4    311   8e-98    Vitis vinifera
gb|KJB67441.1|  hypothetical protein B456_010G190800                    303   8e-98    Gossypium raimondii
ref|XP_010667722.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    312   8e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009785495.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    312   9e-98    Nicotiana sylvestris
ref|XP_011040799.1|  PREDICTED: probable galacturonosyltransferas...    310   1e-97    Populus euphratica
ref|XP_009375839.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    311   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_009375840.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    311   1e-97    
ref|XP_010538434.1|  PREDICTED: probable galacturonosyltransferase 4    311   1e-97    Tarenaya hassleriana [spider flower]
ref|XP_006398488.1|  hypothetical protein EUTSA_v10000819mg             310   1e-97    Eutrema salsugineum [saltwater cress]
ref|XP_002882844.1|  hypothetical protein ARALYDRAFT_478777             309   1e-97    
ref|XP_007139968.1|  hypothetical protein PHAVU_008G074000g             311   1e-97    Phaseolus vulgaris [French bean]
gb|KGN65009.1|  hypothetical protein Csa_1G179740                       310   1e-97    Cucumis sativus [cucumbers]
ref|XP_010647027.1|  PREDICTED: probable galacturonosyltransferas...    310   1e-97    Vitis vinifera
ref|XP_010661600.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    311   1e-97    Vitis vinifera
ref|XP_007147564.1|  hypothetical protein PHAVU_006G135100g             311   1e-97    Phaseolus vulgaris [French bean]
ref|XP_010647025.1|  PREDICTED: probable galacturonosyltransferas...    310   2e-97    Vitis vinifera
ref|NP_568688.1|  probable galacturonosyltransferase 4                  309   2e-97    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11325.1|  unnamed protein product                                309   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386175.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    310   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006486598.1|  PREDICTED: probable galacturonosyltransferas...    308   2e-97    Citrus sinensis [apfelsine]
ref|XP_007213869.1|  hypothetical protein PRUPE_ppa018681mg             310   2e-97    
ref|XP_010910636.1|  PREDICTED: probable galacturonosyltransferas...    310   2e-97    
ref|XP_004499343.1|  PREDICTED: probable galacturonosyltransferas...    310   2e-97    Cicer arietinum [garbanzo]
gb|AES80022.2|  CAZy family GT8 glycosyltransferase                     310   3e-97    Medicago truncatula
emb|CAB81547.1|  68 kDa protein                                         308   3e-97    
ref|XP_002308736.1|  hypothetical protein POPTR_0006s00320g             310   3e-97    
ref|XP_003623804.1|  Alpha-1,4-galacturonosyltransferase                310   3e-97    
ref|XP_010910633.1|  PREDICTED: probable galacturonosyltransferas...    310   3e-97    
gb|KHG15715.1|  Alpha-1,4-galacturonosyltransferase 1 -like protein     311   4e-97    
ref|XP_011040798.1|  PREDICTED: probable galacturonosyltransferas...    310   4e-97    
ref|XP_004510897.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    310   4e-97    
ref|XP_008775901.1|  PREDICTED: probable galacturonosyltransferase 4    309   4e-97    
ref|XP_006279595.1|  hypothetical protein CARUB_v10026096mg             308   4e-97    
ref|XP_008342952.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    310   4e-97    
ref|XP_011040102.1|  PREDICTED: probable galacturonosyltransferase 4    309   5e-97    
ref|XP_006422429.1|  hypothetical protein CICLE_v10027946mg             310   5e-97    
ref|XP_008464310.1|  PREDICTED: probable galacturonosyltransferase 4    309   5e-97    
ref|XP_011016525.1|  PREDICTED: probable galacturonosyltransferase 4    309   5e-97    
ref|XP_011086294.1|  PREDICTED: probable galacturonosyltransferase 4    310   5e-97    
ref|XP_009101378.1|  PREDICTED: probable galacturonosyltransferase 4    308   6e-97    
ref|XP_010495019.1|  PREDICTED: probable galacturonosyltransferas...    308   6e-97    
ref|XP_006486597.1|  PREDICTED: probable galacturonosyltransferas...    310   6e-97    
ref|XP_010495018.1|  PREDICTED: probable galacturonosyltransferas...    308   6e-97    
ref|XP_004134994.1|  PREDICTED: probable galacturonosyltransferas...    308   6e-97    
gb|KJB79717.1|  hypothetical protein B456_013G063700                    305   7e-97    
ref|XP_009407928.1|  PREDICTED: probable galacturonosyltransferase 4    309   7e-97    
gb|EPS66373.1|  hypothetical protein M569_08404                         308   7e-97    
ref|XP_011083645.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    310   8e-97    
emb|CAN70213.1|  hypothetical protein VITISV_038741                     311   8e-97    
ref|XP_010918998.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    310   8e-97    
ref|XP_010441404.1|  PREDICTED: probable galacturonosyltransferas...    307   8e-97    
ref|XP_002970865.1|  Glycosyltransferase, CAZy family GT8               305   8e-97    
ref|XP_004492659.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    309   8e-97    
ref|XP_010255603.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    308   8e-97    
gb|EYU32902.1|  hypothetical protein MIMGU_mgv1a002354mg                309   8e-97    
ref|XP_010441403.1|  PREDICTED: probable galacturonosyltransferas...    307   8e-97    
gb|KDO78639.1|  hypothetical protein CISIN_1g005035mg                   306   9e-97    
gb|KDO78642.1|  hypothetical protein CISIN_1g005035mg                   308   9e-97    
ref|XP_006656516.1|  PREDICTED: probable galacturonosyltransferas...    304   9e-97    
ref|XP_010481273.1|  PREDICTED: probable galacturonosyltransferas...    307   9e-97    
ref|XP_004158838.1|  PREDICTED: probable galacturonosyltransferas...    308   1e-96    
ref|XP_010481267.1|  PREDICTED: probable galacturonosyltransferas...    307   1e-96    
ref|XP_010481265.1|  PREDICTED: probable galacturonosyltransferas...    307   1e-96    
gb|KJB67440.1|  hypothetical protein B456_010G190800                    307   1e-96    
ref|XP_010481270.1|  PREDICTED: probable galacturonosyltransferas...    307   1e-96    
ref|XP_006449976.1|  hypothetical protein CICLE_v10014426mg             308   1e-96    
ref|XP_006467237.1|  PREDICTED: probable galacturonosyltransferas...    308   1e-96    
ref|XP_003594361.1|  Galacturonosyltransferase                          308   1e-96    
gb|KJB67437.1|  hypothetical protein B456_010G190800                    307   1e-96    
gb|KJB67439.1|  hypothetical protein B456_010G190800                    306   1e-96    
gb|KHF97487.1|  putative galacturonosyltransferase 4 -like protein      306   1e-96    
ref|XP_010106747.1|  Alpha-1,4-galacturonosyltransferase 1              308   1e-96    
ref|XP_006843539.1|  hypothetical protein AMTR_s00007p00049440          300   2e-96    
gb|KDP42036.1|  hypothetical protein JCGZ_03099                         308   2e-96    
gb|ABN08854.1|  Glycosyl transferase, family 8                          308   2e-96    
ref|XP_007134929.1|  hypothetical protein PHAVU_010G087600g             308   2e-96    
ref|XP_011005782.1|  PREDICTED: probable galacturonosyltransferas...    308   2e-96    
ref|XP_008440950.1|  PREDICTED: probable galacturonosyltransferas...    307   2e-96    
gb|KDP29029.1|  hypothetical protein JCGZ_16418                         307   2e-96    
gb|KJB24654.1|  hypothetical protein B456_004G155600                    308   2e-96    
ref|XP_011005780.1|  PREDICTED: probable galacturonosyltransferas...    308   2e-96    
gb|KJB09887.1|  hypothetical protein B456_001G172800                    308   2e-96    
ref|XP_010255599.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    308   2e-96    
gb|KJB24655.1|  hypothetical protein B456_004G155600                    308   2e-96    
ref|XP_010255602.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    308   3e-96    
ref|XP_008349398.1|  PREDICTED: probable galacturonosyltransferase 4    304   3e-96    
dbj|BAJ86220.1|  predicted protein                                      308   3e-96    
ref|XP_006384847.1|  hypothetical protein POPTR_0004s21600g             307   3e-96    
ref|XP_010052508.1|  PREDICTED: probable galacturonosyltransferas...    307   3e-96    
ref|XP_010052503.1|  PREDICTED: probable galacturonosyltransferas...    307   3e-96    
ref|XP_008440947.1|  PREDICTED: probable galacturonosyltransferas...    306   3e-96    
gb|KHG09589.1|  putative galacturonosyltransferase 3 -like protein      306   3e-96    
ref|XP_010052506.1|  PREDICTED: probable galacturonosyltransferas...    307   3e-96    
gb|KHG03188.1|  putative galacturonosyltransferase 3 -like protein      299   3e-96    
ref|NP_001064438.1|  Os10g0363100                                       303   3e-96    
ref|XP_010272524.1|  PREDICTED: probable galacturonosyltransferase 4    307   4e-96    
ref|XP_006373556.1|  hypothetical protein POPTR_0016s00360g             307   4e-96    
gb|KHN29422.1|  Alpha-1,4-galacturonosyltransferase 1                   306   4e-96    
ref|XP_008782990.1|  PREDICTED: probable galacturonosyltransferase 4    307   4e-96    
ref|XP_006656515.1|  PREDICTED: probable galacturonosyltransferas...    305   4e-96    
gb|AIL52750.1|  polygalacturonate 4-alpha-galacturonosyltransfera...    308   5e-96    
ref|XP_008447845.1|  PREDICTED: probable galacturonosyltransferas...    304   5e-96    
ref|XP_007026431.1|  Galacturonosyltransferase 4 isoform 2              305   6e-96    
ref|XP_003533632.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    306   6e-96    
ref|XP_007026430.1|  Galacturonosyltransferase 4 isoform 1              305   7e-96    
ref|XP_007154076.1|  hypothetical protein PHAVU_003G088900g             306   7e-96    
ref|XP_006449975.1|  hypothetical protein CICLE_v10014426mg             308   7e-96    
gb|AFW60920.1|  transferase                                             306   7e-96    
ref|XP_007154077.1|  hypothetical protein PHAVU_003G088900g             306   7e-96    
ref|XP_008677252.1|  PREDICTED: transferase, transferring glycosy...    306   7e-96    
gb|KDO78641.1|  hypothetical protein CISIN_1g005035mg                   308   7e-96    
gb|AET04592.2|  CAZy family GT8 glycosyltransferase                     304   8e-96    
gb|KHN03164.1|  Alpha-1,4-galacturonosyltransferase 1                   303   8e-96    
ref|XP_008384326.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    303   9e-96    
gb|KJB79715.1|  hypothetical protein B456_013G063700                    305   9e-96    
ref|NP_001148932.1|  transferase, transferring glycosyl groups          306   9e-96    
ref|XP_002969595.1|  GAUT1, alpha-1,4-galacturonosyltransferase-l...    302   9e-96    
ref|XP_010942295.1|  PREDICTED: probable galacturonosyltransferase 4    306   9e-96    
ref|XP_002444200.1|  hypothetical protein SORBIDRAFT_07g014890          305   1e-95    
emb|CDP08918.1|  unnamed protein product                                306   1e-95    
gb|KHG01394.1|  Alpha-1,4-galacturonosyltransferase 1                   306   1e-95    
ref|XP_004144949.1|  PREDICTED: probable galacturonosyltransferas...    305   1e-95    
ref|XP_004154763.1|  PREDICTED: probable galacturonosyltransferas...    306   1e-95    
ref|XP_009382742.1|  PREDICTED: probable galacturonosyltransferase 3    305   1e-95    
ref|XP_004486385.1|  PREDICTED: probable galacturonosyltransferas...    305   1e-95    
gb|KJB79716.1|  hypothetical protein B456_013G063700                    306   1e-95    
ref|XP_011095865.1|  PREDICTED: probable galacturonosyltransferase 4    306   2e-95    
gb|KHG14424.1|  Alpha-1,4-galacturonosyltransferase 1 -like protein     305   2e-95    
ref|XP_008794741.1|  PREDICTED: probable galacturonosyltransferas...    305   2e-95    
ref|XP_011034886.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    306   2e-95    
ref|XP_008794742.1|  PREDICTED: probable galacturonosyltransferas...    305   2e-95    
gb|KGN43338.1|  hypothetical protein Csa_7G024120                       305   2e-95    
ref|XP_008224656.1|  PREDICTED: probable galacturonosyltransferase 4    305   2e-95    
ref|XP_008794737.1|  PREDICTED: probable galacturonosyltransferas...    305   2e-95    
emb|CAN79512.1|  hypothetical protein VITISV_014158                     305   2e-95    
ref|XP_008794738.1|  PREDICTED: probable galacturonosyltransferas...    305   2e-95    
ref|XP_008794739.1|  PREDICTED: probable galacturonosyltransferas...    305   2e-95    
ref|XP_008794740.1|  PREDICTED: probable galacturonosyltransferas...    305   2e-95    
ref|XP_002986778.1|  Glycosyltransferase, CAZy family GT8               298   3e-95    
ref|XP_008447844.1|  PREDICTED: probable galacturonosyltransferas...    305   4e-95    
ref|XP_008358828.1|  PREDICTED: probable galacturonosyltransferase 4    305   4e-95    
gb|AAM18739.1|AC092548_17  hypothetical protein                         303   4e-95    
ref|XP_006341726.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    303   4e-95    
ref|XP_010690224.1|  PREDICTED: probable galacturonosyltransferas...    303   4e-95    
gb|KJB12347.1|  hypothetical protein B456_002G013600                    303   4e-95    
dbj|BAK02036.1|  predicted protein                                      297   4e-95    
ref|XP_010028843.1|  PREDICTED: probable galacturonosyltransferase 3    303   5e-95    
ref|XP_010935289.1|  PREDICTED: probable galacturonosyltransferas...    303   5e-95    
ref|XP_010645848.1|  PREDICTED: probable galacturonosyltransferase 3    305   6e-95    
ref|XP_003551642.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    304   6e-95    
ref|XP_008809114.1|  PREDICTED: probable galacturonosyltransferase 3    299   6e-95    
gb|EYU27625.1|  hypothetical protein MIMGU_mgv1a004359mg                300   7e-95    
ref|XP_003535002.1|  PREDICTED: probable galacturonosyltransferas...    303   7e-95    
ref|XP_011074569.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    303   7e-95    
gb|KHN40761.1|  Putative galacturonosyltransferase 4                    303   7e-95    
ref|XP_003603462.1|  Alpha-1,4-galacturonosyltransferase                297   8e-95    
ref|XP_011088710.1|  PREDICTED: probable galacturonosyltransferase 3    304   8e-95    
ref|XP_010096508.1|  putative galacturonosyltransferase 4               303   8e-95    
ref|XP_006597630.1|  PREDICTED: probable galacturonosyltransferas...    303   9e-95    
ref|XP_004501287.1|  PREDICTED: probable galacturonosyltransferas...    301   9e-95    
ref|XP_009616855.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    303   9e-95    
ref|XP_008384215.1|  PREDICTED: probable galacturonosyltransferas...    303   9e-95    
ref|XP_008384214.1|  PREDICTED: probable galacturonosyltransferas...    303   1e-94    
ref|XP_004966516.1|  PREDICTED: probable galacturonosyltransferas...    304   1e-94    
ref|XP_010555175.1|  PREDICTED: probable galacturonosyltransferas...    303   1e-94    
ref|XP_010690223.1|  PREDICTED: probable galacturonosyltransferas...    304   1e-94    
ref|XP_010450980.1|  PREDICTED: probable galacturonosyltransferase 3    291   1e-94    
gb|EAY78177.1|  hypothetical protein OsI_33224                          303   1e-94    
ref|XP_006857626.1|  hypothetical protein AMTR_s00061p00126570          303   1e-94    
ref|XP_010555174.1|  PREDICTED: probable galacturonosyltransferas...    303   1e-94    
gb|KHG01393.1|  Alpha-1,4-galacturonosyltransferase 1                   305   1e-94    
gb|EAZ15816.1|  hypothetical protein OsJ_31235                          303   1e-94    
ref|XP_010935288.1|  PREDICTED: probable galacturonosyltransferas...    303   2e-94    
gb|EYU38036.1|  hypothetical protein MIMGU_mgv1a002760mg                302   2e-94    
ref|XP_010239537.1|  PREDICTED: probable galacturonosyltransferas...    301   2e-94    
gb|ABB47337.1|  Glycosyltransferase QUASIMODO1, putative, expressed     303   2e-94    
ref|XP_006364356.1|  PREDICTED: probable galacturonosyltransferas...    303   2e-94    
ref|XP_008645106.1|  PREDICTED: probable galacturonosyltransferas...    303   2e-94    
ref|XP_004231097.1|  PREDICTED: probable galacturonosyltransferase 3    303   2e-94    
gb|AFW69586.1|  hypothetical protein ZEAMMB73_786543                    303   2e-94    
ref|XP_009777396.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    303   2e-94    
ref|XP_004248575.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    302   2e-94    
ref|XP_006600275.1|  PREDICTED: probable galacturonosyltransferas...    302   2e-94    
ref|NP_001058636.2|  Os06g0727300                                       301   2e-94    
ref|XP_008645105.1|  PREDICTED: probable galacturonosyltransferas...    303   2e-94    
ref|XP_008645104.1|  PREDICTED: probable galacturonosyltransferas...    303   2e-94    
ref|XP_009374812.1|  PREDICTED: probable galacturonosyltransferase 4    303   2e-94    
gb|KFK31342.1|  hypothetical protein AALP_AA6G099900                    302   2e-94    
ref|XP_002969509.1|  Glycosyltransferase, CAZy family GT8               298   2e-94    
ref|XP_009623515.1|  PREDICTED: probable galacturonosyltransferas...    302   3e-94    
ref|XP_009623514.1|  PREDICTED: probable galacturonosyltransferas...    302   3e-94    
ref|XP_009363241.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    302   4e-94    
ref|XP_003525683.1|  PREDICTED: probable galacturonosyltransferas...    302   4e-94    
ref|XP_009766434.1|  PREDICTED: probable galacturonosyltransferas...    302   4e-94    
ref|XP_010239532.1|  PREDICTED: probable galacturonosyltransferas...    301   4e-94    
ref|XP_010234583.1|  PREDICTED: probable galacturonosyltransferas...    301   4e-94    
gb|EMS52040.1|  putative galacturonosyltransferase 3                    300   4e-94    
ref|XP_007137299.1|  hypothetical protein PHAVU_009G115700g             301   4e-94    
gb|KGN56570.1|  hypothetical protein Csa_3G124890                       301   4e-94    
ref|XP_009766433.1|  PREDICTED: probable galacturonosyltransferas...    302   5e-94    
ref|XP_009802392.1|  PREDICTED: probable galacturonosyltransferas...    302   5e-94    
ref|XP_003573698.1|  PREDICTED: probable galacturonosyltransferas...    301   5e-94    
ref|XP_009802396.1|  PREDICTED: probable galacturonosyltransferas...    302   6e-94    
ref|XP_007043045.1|  Galacturonosyltransferase 3 isoform 2              296   6e-94    
ref|XP_006579796.1|  PREDICTED: probable galacturonosyltransferas...    301   6e-94    
gb|KHN40223.1|  Putative galacturonosyltransferase 4                    301   7e-94    
emb|CAB37483.1|  putative protein                                       301   7e-94    
ref|XP_006584115.1|  PREDICTED: probable galacturonosyltransferas...    301   7e-94    
gb|KHN27481.1|  Putative galacturonosyltransferase 3                    301   7e-94    
ref|XP_010252974.1|  PREDICTED: probable galacturonosyltransferase 4    302   7e-94    
ref|XP_010111700.1|  putative galacturonosyltransferase 3               302   7e-94    
ref|XP_008438127.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    301   8e-94    
ref|XP_004501286.1|  PREDICTED: probable galacturonosyltransferas...    301   9e-94    
ref|XP_004973216.1|  PREDICTED: probable galacturonosyltransferas...    300   9e-94    
ref|XP_008438124.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    301   9e-94    
ref|NP_001190952.1|  galacturonosyltransferase 3                        301   9e-94    
ref|NP_195540.2|  galacturonosyltransferase 3                           301   9e-94    
ref|XP_008438125.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    300   1e-93    
gb|KEH35941.1|  polygalacturonate 4-alpha-galacturonosyltransferase     299   1e-93    
ref|XP_004134339.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    301   1e-93    
ref|XP_006660049.1|  PREDICTED: probable galacturonosyltransferas...    299   1e-93    
ref|XP_002525229.1|  Glycosyltransferase QUASIMODO1, putative           300   1e-93    
dbj|BAF00667.1|  hypothetical protein                                   301   1e-93    
ref|XP_010686598.1|  PREDICTED: probable galacturonosyltransferase 4    300   1e-93    
ref|XP_004155869.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    301   1e-93    
gb|KHG17315.1|  putative galacturonosyltransferase 4 -like protein      299   1e-93    
ref|XP_002439065.1|  hypothetical protein SORBIDRAFT_10g030870          301   2e-93    
gb|EPS65589.1|  hypothetical protein M569_09187                         299   2e-93    
gb|EEC83383.1|  hypothetical protein OsI_28798                          298   3e-93    
ref|XP_001756118.1|  predicted protein                                  295   3e-93    
gb|KHN03562.1|  Putative galacturonosyltransferase 4                    299   3e-93    
ref|XP_002533896.1|  Glycosyltransferase QUASIMODO1, putative           299   3e-93    
ref|XP_010942525.1|  PREDICTED: probable galacturonosyltransferas...    299   3e-93    
ref|XP_010942526.1|  PREDICTED: probable galacturonosyltransferas...    299   3e-93    
gb|EYU33824.1|  hypothetical protein MIMGU_mgv1a002625mg                299   3e-93    
ref|XP_010942524.1|  PREDICTED: probable galacturonosyltransferas...    299   4e-93    
ref|XP_003630117.1|  Nudix hydrolase                                    304   4e-93    
ref|NP_001061555.1|  Os08g0327100                                       299   4e-93    
ref|XP_003630116.1|  Nudix hydrolase                                    304   5e-93    
gb|AES73713.2|  polygalacturonate 4-alpha-galacturonosyltransferase     299   5e-93    
ref|XP_002866790.1|  hypothetical protein ARALYDRAFT_912279             299   5e-93    
ref|XP_006661357.1|  PREDICTED: probable galacturonosyltransferas...    300   5e-93    
ref|XP_010436923.1|  PREDICTED: probable galacturonosyltransferas...    296   5e-93    
ref|XP_006411618.1|  hypothetical protein EUTSA_v10024734mg             297   6e-93    
ref|XP_011458093.1|  PREDICTED: probable galacturonosyltransferas...    297   7e-93    



>ref|XP_011089660.1| PREDICTED: galacturonosyltransferase 8-like [Sesamum indicum]
Length=570

 Score =   427 bits (1097),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  366  RNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  425

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  426  SFHRYAQYMNFSHPLIKAKFSPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  485

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEI NAAV+HFNGNMKPWLDIAI
Sbjct  486  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEIKNAAVIHFNGNMKPWLDIAI  545

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTKYVDYENEY+QACNFGL
Sbjct  546  TQFRPLWTKYVDYENEYVQACNFGL  570



>ref|XP_009775386.1| PREDICTED: galacturonosyltransferase 8 [Nicotiana sylvestris]
Length=566

 Score =   425 bits (1093),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNH+RFYLPE+YPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  362  RNPKYLSILNHIRFYLPELYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  421

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EK TEEYHYWQ+LNENRTL
Sbjct  422  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKLTEEYHYWQSLNENRTL  481

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDIA+
Sbjct  482  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDIAM  541

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTKYVDYENEY+QACNFGL
Sbjct  542  NQFRPLWTKYVDYENEYVQACNFGL  566



>gb|EYU40627.1| hypothetical protein MIMGU_mgv1a003761mg [Erythranthe guttata]
Length=565

 Score =   425 bits (1093),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  361  RNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  420

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ +F+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  421  SFHRYAQYMNFSHPLIKARFSPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  480

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEINNAAV+HFNGNMKPWLDIAI
Sbjct  481  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVIHFNGNMKPWLDIAI  540

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTKYVDYENEY+Q CNFGL
Sbjct  541  TQFRPLWTKYVDYENEYVQTCNFGL  565



>ref|XP_009614844.1| PREDICTED: galacturonosyltransferase 8 [Nicotiana tomentosiformis]
Length=564

 Score =   424 bits (1091),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNH+RFYLPE+YPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  360  RNPKYLSILNHIRFYLPELYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  419

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EK TEEYHYWQ+LNENRTL
Sbjct  420  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKLTEEYHYWQSLNENRTL  479

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDIA+
Sbjct  480  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDIAM  539

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTKYVDYENEY+QACNFGL
Sbjct  540  NQFRPLWTKYVDYENEYVQACNFGL  564



>emb|CAJ34814.1| glycosyltransferase [Plantago major]
Length=318

 Score =   415 bits (1067),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  114  RNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  173

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  174  SFHRYAQYMNFSHPLIKAKFSPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  233

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPL KSWHVLGLGYNPSIS DEINNAAV+HFNGNMKPWLDIAI
Sbjct  234  WKLGTLPPGLITYYSTTKPLHKSWHVLGLGYNPSISMDEINNAAVIHFNGNMKPWLDIAI  293

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            +QFRPLW KYVDYENEY+Q CNFGL
Sbjct  294  SQFRPLWAKYVDYENEYVQTCNFGL  318



>gb|KDP26352.1| hypothetical protein JCGZ_17510 [Jatropha curcas]
Length=560

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  356  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  415

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLIR KFNPKACAWAYGMNFFDLDAWRKEKCTE+YHYWQ LNENRTL
Sbjct  416  SFHRYAQYMNFSHPLIREKFNPKACAWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENRTL  475

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDIA+
Sbjct  476  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEISNAAVVHFNGNMKPWLDIAM  535

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTKYVDYE E++Q+CNFGL
Sbjct  536  TQFKPLWTKYVDYEMEFVQSCNFGL  560



>ref|XP_010246719.1| PREDICTED: galacturonosyltransferase 8 [Nelumbo nucifera]
Length=569

 Score =   421 bits (1082),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  365  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  424

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKAC WAYGMNFFDLDAWR+EKCTE+YHYWQ LNENRTL
Sbjct  425  SFHRYAQYMNFSHPLIKEKFNPKACGWAYGMNFFDLDAWRREKCTEQYHYWQNLNENRTL  484

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  485  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  544

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTKYVDYENE+IQ CNFG+
Sbjct  545  NQFRPLWTKYVDYENEFIQQCNFGI  569



>ref|XP_003552108.1| PREDICTED: galacturonosyltransferase 8-like [Glycine max]
 gb|KHN41703.1| Galacturonosyltransferase 8 [Glycine soja]
Length=556

 Score =   419 bits (1077),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  352  RNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  411

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  412  SFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  471

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYY+TTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDIA+
Sbjct  472  WKLGTLPPGLITYYATTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDIAM  531

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            AQF+PLWTKYVDYE +++QACNFG+
Sbjct  532  AQFKPLWTKYVDYELDFVQACNFGI  556



>ref|XP_007140673.1| hypothetical protein PHAVU_008G132200g [Phaseolus vulgaris]
 gb|ESW12667.1| hypothetical protein PHAVU_008G132200g [Phaseolus vulgaris]
Length=556

 Score =   419 bits (1077),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  352  RNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  411

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  412  SFHRYAQYMNFSHPLIKAKFSPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  471

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDIA+
Sbjct  472  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDIAM  531

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            AQF+PLWTKYVDYE +++QACNFG+
Sbjct  532  AQFKPLWTKYVDYELDFVQACNFGI  556



>gb|ABK92560.1| unknown [Populus trichocarpa]
Length=554

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  350  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  409

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  410  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  469

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI +AAVVHFNGNMKPWLDIA+
Sbjct  470  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIQSAAVVHFNGNMKPWLDIAM  529

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTK+VDYE E++QACNFGL
Sbjct  530  TQFKPLWTKHVDYELEFVQACNFGL  554



>ref|XP_011024611.1| PREDICTED: galacturonosyltransferase 8 [Populus euphratica]
Length=554

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  350  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  409

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  410  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  469

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI +AAVVHFNGNMKPWLDIA+
Sbjct  470  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIQSAAVVHFNGNMKPWLDIAM  529

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTK+VDYE E++QACNFGL
Sbjct  530  TQFKPLWTKHVDYELEFVQACNFGL  554



>ref|XP_002301803.1| hypothetical protein POPTR_0002s24790g [Populus trichocarpa]
 gb|EEE81076.1| hypothetical protein POPTR_0002s24790g [Populus trichocarpa]
Length=554

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  350  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  409

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  410  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  469

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI +AAVVHFNGNMKPWLDIA+
Sbjct  470  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIQSAAVVHFNGNMKPWLDIAM  529

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTK+VDYE E++QACNFGL
Sbjct  530  TQFKPLWTKHVDYELEFVQACNFGL  554



>ref|XP_006584621.1| PREDICTED: uncharacterized protein LOC100817076 isoform X1 [Glycine 
max]
 gb|KHN10961.1| Galacturonosyltransferase 8 [Glycine soja]
Length=556

 Score =   417 bits (1072),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  352  RNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  411

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  412  SFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  471

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYY+TTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDIA+
Sbjct  472  WKLGTLPPGLITYYATTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDIAM  531

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTKYVDYE +++QACNFG+
Sbjct  532  TQFKPLWTKYVDYELDFVQACNFGI  556



>emb|CBI25666.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   415 bits (1067),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  299  ENPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  358

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKAC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENRTL
Sbjct  359  SFHRYAQYMNFSHPLIKEKFNPKACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENRTL  418

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDIA+
Sbjct  419  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIHNAAVVHFNGNMKPWLDIAM  478

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  479  NQFRPLWTKHVDYDMEFVQACNFGL  503



>ref|XP_004515038.1| PREDICTED: galacturonosyltransferase 8-like [Cicer arietinum]
Length=555

 Score =   417 bits (1071),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH++LFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  351  RNPKYLSILNHLRFYLPEMYPKLHKVLFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  410

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ +FNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  411  SFHRYAQYMNFSHPLIKARFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  470

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDIA+
Sbjct  471  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDIAM  530

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLW+KYVDYE E++QACNFG+
Sbjct  531  TQFKPLWSKYVDYELEFVQACNFGI  555



>ref|XP_002273962.2| PREDICTED: galacturonosyltransferase 8 [Vitis vinifera]
Length=558

 Score =   417 bits (1071),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  354  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  413

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKAC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENRTL
Sbjct  414  SFHRYAQYMNFSHPLIKEKFNPKACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENRTL  473

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDIA+
Sbjct  474  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIHNAAVVHFNGNMKPWLDIAM  533

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  534  NQFRPLWTKHVDYDMEFVQACNFGL  558



>ref|XP_004242412.1| PREDICTED: galacturonosyltransferase 8-like [Solanum lycopersicum]
Length=557

 Score =   417 bits (1071),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNH+RFYLPE+YPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  353  RNPKYLSILNHIRFYLPELYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI  KFNPKACAWAYGMNFFDLDAWR+EK TE+YHYWQ LNENRTL
Sbjct  413  SFHRYAQYMNFSHPLINSKFNPKACAWAYGMNFFDLDAWRREKLTEDYHYWQTLNENRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EINNAAVVHFNGNMKPWLDIA+
Sbjct  473  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEINNAAVVHFNGNMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            AQ+RPLW+KYVDYENEY+Q CNFG 
Sbjct  533  AQYRPLWSKYVDYENEYVQGCNFGF  557



>gb|KDO65982.1| hypothetical protein CISIN_1g008561mg [Citrus sinensis]
Length=561

 Score =   416 bits (1070),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  357  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  417  SFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIQNAAVVHFNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QF+PLWTKYVDY+ ++IQACNFG
Sbjct  537  NQFKPLWTKYVDYDLDFIQACNFG  560



>ref|NP_001242612.1| uncharacterized protein LOC100817076 [Glycine max]
 gb|ACU20809.1| unknown [Glycine max]
Length=547

 Score =   416 bits (1068),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH+ILFLDDDIV Q+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  343  RNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVAQKDLTGLWKIDMDGKVNGAVETCFG  402

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  403  SFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  462

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYY+TTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDIA+
Sbjct  463  WKLGTLPPGLITYYATTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDIAM  522

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTKYVDYE +++QACNFG+
Sbjct  523  TQFKPLWTKYVDYELDFVQACNFGI  547



>ref|XP_006479231.1| PREDICTED: galacturonosyltransferase 8-like [Citrus sinensis]
Length=561

 Score =   416 bits (1069),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  357  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  417  SFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIQNAAVVHFNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QF+PLWTKYVDY+ ++IQACNFG
Sbjct  537  NQFKPLWTKYVDYDLDFIQACNFG  560



>gb|KHG16505.1| Galacturonosyltransferase 8 -like protein [Gossypium arboreum]
Length=569

 Score =   416 bits (1070),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  365  RNPKYLSILNHLRFYLPEMYPTLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  424

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  425  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  484

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDIA+
Sbjct  485  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEISNAAVVHFNGNMKPWLDIAM  544

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTKYVDY+ E++QACNFG+
Sbjct  545  NQFKPLWTKYVDYDLEFVQACNFGV  569



>ref|XP_002532733.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF29635.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=566

 Score =   416 bits (1069),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  362  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  421

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWRKEKCTE+YHYWQ LNENRTL
Sbjct  422  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENRTL  481

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  482  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  541

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTK+VDY+ +++QACNFGL
Sbjct  542  TQFKPLWTKHVDYDLDFVQACNFGL  566



>gb|KJB08801.1| hypothetical protein B456_001G104800 [Gossypium raimondii]
Length=396

 Score =   410 bits (1053),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  192  RNPKYLSILNHLRFYLPEMYPTLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  251

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  252  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  311

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDIA+
Sbjct  312  WKLGTLPPGLITFYSTTKPLNKSWHVLGLGYNPSISMDEISNAAVVHFNGNMKPWLDIAM  371

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTKYVDY+ E++QACNFG+
Sbjct  372  NQFKPLWTKYVDYDLEFVQACNFGV  396



>ref|XP_006352682.1| PREDICTED: galacturonosyltransferase 8-like [Solanum tuberosum]
Length=557

 Score =   416 bits (1068),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNH+RFYLPE+YPKLHRILFLDDDIVVQ+DLTGLWKIDM GKVNGAVETCFG
Sbjct  353  RNPKYLSILNHIRFYLPELYPKLHRILFLDDDIVVQKDLTGLWKIDMGGKVNGAVETCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EK TEEYHYWQ  NENRTL
Sbjct  413  SFHRYAQYMNFSHPLIKSKFNPKACAWAYGMNFFDLDAWRREKLTEEYHYWQTRNENRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EINNAAVVHFNGNMKPWLDIA+
Sbjct  473  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEINNAAVVHFNGNMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            AQ+RPLWTKYVDYENEY+Q CNFG 
Sbjct  533  AQYRPLWTKYVDYENEYVQGCNFGF  557



>gb|ABD65461.1| transferring glycosyl protein [Gossypium hirsutum]
Length=207

 Score =   402 bits (1033),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  3    RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  62

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  63   SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  122

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  123  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  182

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLW+KYVD++ E++QACNFG+
Sbjct  183  NQFKPLWSKYVDFDLEFVQACNFGV  207



>ref|XP_006418657.1| hypothetical protein EUTSA_v10002465mg [Eutrema salsugineum]
 gb|ESQ37093.1| hypothetical protein EUTSA_v10002465mg [Eutrema salsugineum]
Length=562

 Score =   415 bits (1066),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGA+ETCFG
Sbjct  358  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAIETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  418  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  478  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  538  NQFRPLWTKHVDYDLEFVQACNFGL  562



>ref|XP_003622860.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
 gb|AES79078.1| glycosyltransferase Quasimodo protein, putative [Medicago truncatula]
 gb|KEH22795.1| glycosyltransferase Quasimodo protein, putative [Medicago truncatula]
Length=434

 Score =   410 bits (1054),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH++LFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  230  RNPKYLSILNHLRFYLPEMYPKLHKVLFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  289

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+ KCTEEYHYWQ LNENRTL
Sbjct  290  SFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRRVKCTEEYHYWQNLNENRTL  349

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDIA+
Sbjct  350  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDIAM  409

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLW+KYVD E E++QACNFG+
Sbjct  410  TQFKPLWSKYVDVELEFVQACNFGI  434



>gb|KHG21596.1| Galacturonosyltransferase 8 -like protein [Gossypium arboreum]
Length=564

 Score =   415 bits (1066),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  360  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  419

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  420  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  479

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  480  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  539

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLW+KYVD++ E++QACNFG+
Sbjct  540  NQFKPLWSKYVDFDLEFVQACNFGV  564



>emb|CDY61593.1| BnaC03g74220D [Brassica napus]
Length=553

 Score =   414 bits (1065),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  349  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  408

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR L
Sbjct  409  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRAL  468

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  469  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  528

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  529  NQFRPLWTKHVDYDLEFVQACNFGL  553



>emb|CDX93049.1| BnaA03g37710D [Brassica napus]
Length=553

 Score =   414 bits (1064),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  349  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  408

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR L
Sbjct  409  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRAL  468

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  469  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  528

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  529  NQFRPLWTKHVDYDLEFVQACNFGL  553



>ref|XP_009136103.1| PREDICTED: galacturonosyltransferase 8 [Brassica rapa]
Length=558

 Score =   414 bits (1065),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  354  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  413

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR L
Sbjct  414  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRAL  473

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  474  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  533

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  534  NQFRPLWTKHVDYDLEFVQACNFGL  558



>gb|KJB10196.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
 gb|KJB10197.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=396

 Score =   409 bits (1050),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETCFG
Sbjct  192  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETCFG  251

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  252  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  311

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  312  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  371

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLW+KYVD++ E++QACNFG+
Sbjct  372  NQFKPLWSKYVDFDLEFVQACNFGV  396



>ref|XP_009102430.1| PREDICTED: galacturonosyltransferase 8-like [Brassica rapa]
Length=569

 Score =   415 bits (1066),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  365  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  424

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  425  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  484

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  485  WKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  544

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VD++ E++QACNFGL
Sbjct  545  NQFRPLWTKHVDHDLEFVQACNFGL  569



>gb|KJB08802.1| hypothetical protein B456_001G104800 [Gossypium raimondii]
Length=569

 Score =   414 bits (1065),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  365  RNPKYLSILNHLRFYLPEMYPTLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  424

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  425  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  484

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDIA+
Sbjct  485  WKLGTLPPGLITFYSTTKPLNKSWHVLGLGYNPSISMDEISNAAVVHFNGNMKPWLDIAM  544

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTKYVDY+ E++QACNFG+
Sbjct  545  NQFKPLWTKYVDYDLEFVQACNFGV  569



>ref|XP_010513952.1| PREDICTED: galacturonosyltransferase 8-like [Camelina sativa]
Length=561

 Score =   414 bits (1064),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  357  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR L
Sbjct  417  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRAL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  537  NQFRPLWTKHVDYDLEFVQACNFGL  561



>ref|XP_010488624.1| PREDICTED: galacturonosyltransferase 8-like [Camelina sativa]
Length=561

 Score =   414 bits (1064),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  357  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR L
Sbjct  417  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRAL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  537  NQFRPLWTKHVDYDLEFVQACNFGL  561



>ref|XP_010466934.1| PREDICTED: galacturonosyltransferase 8 [Camelina sativa]
Length=561

 Score =   414 bits (1064),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  357  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR L
Sbjct  417  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRAL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  537  NQFRPLWTKHVDYDLEFVQACNFGL  561



>ref|XP_006297348.1| hypothetical protein CARUB_v10013367mg [Capsella rubella]
 gb|EOA30246.1| hypothetical protein CARUB_v10013367mg [Capsella rubella]
Length=561

 Score =   414 bits (1063),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  357  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR L
Sbjct  417  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRAL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  537  NQFRPLWTKHVDYDLEFVQACNFGL  561



>ref|XP_010036787.1| PREDICTED: galacturonosyltransferase 8 [Eucalyptus grandis]
 gb|KCW48431.1| hypothetical protein EUGRSUZ_K02133 [Eucalyptus grandis]
Length=555

 Score =   414 bits (1063),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  351  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  410

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  411  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  470

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  471  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISLEEIRNAAVVHFNGNMKPWLDIAM  530

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            + F+PLWTKYVDYE ++IQACNFG+
Sbjct  531  SLFKPLWTKYVDYELDFIQACNFGV  555



>ref|XP_002863088.1| hypothetical protein ARALYDRAFT_497166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39347.1| hypothetical protein ARALYDRAFT_497166 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  355  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  414

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR L
Sbjct  415  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRAL  474

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  475  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  534

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  535  NQFRPLWTKHVDYDLEFVQACNFGL  559



>ref|XP_010104168.1| Galacturonosyltransferase 8 [Morus notabilis]
 gb|EXB99100.1| Galacturonosyltransferase 8 [Morus notabilis]
Length=562

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  358  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  418  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  478  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTKYVDY+ +++QACNFG+
Sbjct  538  NQFKPLWTKYVDYDLDFVQACNFGI  562



>ref|NP_189150.1| Galacturonosyltransferase 8 [Arabidopsis thaliana]
 sp|Q9LSG3.1|GAUT8_ARATH RecName: Full=Galacturonosyltransferase 8; AltName: Full=Glycosyltransferase 
QUASIMODO1 [Arabidopsis thaliana]
 dbj|BAB02072.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20426.1| glycosyl transferase, putative [Arabidopsis thaliana]
 gb|AAQ56836.1| At3g25140 [Arabidopsis thaliana]
 gb|AEE76983.1| Galacturonosyltransferase 8 [Arabidopsis thaliana]
 gb|AHL38751.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=559

 Score =   413 bits (1062),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  355  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  414

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR L
Sbjct  415  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRAL  474

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  475  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  534

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VDY+ E++QACNFGL
Sbjct  535  NQFRPLWTKHVDYDLEFVQACNFGL  559



>gb|KJB10198.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=564

 Score =   413 bits (1062),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETCFG
Sbjct  360  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETCFG  419

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  420  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  479

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  480  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  539

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLW+KYVD++ E++QACNFG+
Sbjct  540  NQFKPLWSKYVDFDLEFVQACNFGV  564



>emb|CDX77366.1| BnaA07g05040D [Brassica napus]
Length=536

 Score =   412 bits (1059),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  332  KNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  391

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  392  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  451

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  452  WKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIAM  511

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRPLWTK+VD++ E++QACNFGL
Sbjct  512  NQFRPLWTKHVDHDLEFVQACNFGL  536



>gb|KJB10199.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=571

 Score =   413 bits (1062),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETCFG
Sbjct  360  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETCFG  419

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  420  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  479

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  480  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  539

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QF+PLW+KYVD++ E++QACNFG
Sbjct  540  NQFKPLWSKYVDFDLEFVQACNFG  563



>gb|KJB10200.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=591

 Score =   413 bits (1062),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETCFG
Sbjct  360  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETCFG  419

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  420  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  479

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  480  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  539

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QF+PLW+KYVD++ E++QACNFG
Sbjct  540  NQFKPLWSKYVDFDLEFVQACNFG  563



>ref|XP_010527263.1| PREDICTED: galacturonosyltransferase 8 [Tarenaya hassleriana]
Length=563

 Score =   412 bits (1058),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  359  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  418

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  419  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  478

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGN+KPWLDIA+
Sbjct  479  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNLKPWLDIAM  538

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFRPLWTK+VDY+ +++QACNFG
Sbjct  539  NQFRPLWTKHVDYDLDFVQACNFG  562



>ref|XP_010696262.1| PREDICTED: galacturonosyltransferase 8 [Beta vulgaris subsp. 
vulgaris]
Length=551

 Score =   411 bits (1056),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  347  RNPKYLSMLNHLRFYLPEMYPSLHRILFLDDDIVVQKDLTGLWEIDMDGKVNGAVETCFG  406

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWRKE CTE+YHYWQ +NENRTL
Sbjct  407  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRKEGCTEQYHYWQNMNENRTL  466

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  467  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISWDEIRNAAVVHFNGNMKPWLDIAM  526

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLWTKYVD ENEY+Q CNF L
Sbjct  527  GQFKPLWTKYVDNENEYVQGCNFAL  551



>ref|XP_008382600.1| PREDICTED: galacturonosyltransferase 8-like [Malus domestica]
Length=561

 Score =   410 bits (1055),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  357  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWRIDMDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWRK+ CT EYHYWQ LNENR+L
Sbjct  417  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRKQNCTAEYHYWQNLNENRSL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            +QF+PLW K+VDY+ E++QACNFGL
Sbjct  537  SQFKPLWEKHVDYDMEFVQACNFGL  561



>ref|XP_010532909.1| PREDICTED: galacturonosyltransferase 8-like [Tarenaya hassleriana]
Length=556

 Score =   409 bits (1051),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYP LHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  352  RNPKYLSILNHLRFYLPEMYPNLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  411

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  412  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  471

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  472  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  531

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFRPLWTK+VDY+ +++Q CNFG
Sbjct  532  NQFRPLWTKHVDYDLDFVQQCNFG  555



>ref|XP_009372229.1| PREDICTED: galacturonosyltransferase 8-like [Pyrus x bretschneideri]
Length=563

 Score =   409 bits (1052),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  359  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWRIDMDGKVNGAVETCFG  418

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWRK+ CT EYHYWQ LNENR+L
Sbjct  419  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRKQNCTAEYHYWQNLNENRSL  478

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  479  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  538

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+PLW K+VDY+ E++QACNFGL
Sbjct  539  NQFKPLWEKHVDYDMEFVQACNFGL  563



>ref|XP_008235436.1| PREDICTED: galacturonosyltransferase 8 [Prunus mume]
Length=562

 Score =   409 bits (1051),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  358  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWR++ CT EYHYWQ LNENR+L
Sbjct  418  SFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRRQNCTAEYHYWQNLNENRSL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  478  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            +QFRPLW K+VDY+ E++QACNFGL
Sbjct  538  SQFRPLWEKHVDYDMEFVQACNFGL  562



>ref|XP_004149774.1| PREDICTED: galacturonosyltransferase 8-like [Cucumis sativus]
 ref|XP_004170840.1| PREDICTED: galacturonosyltransferase 8-like [Cucumis sativus]
 gb|KGN44629.1| hypothetical protein Csa_7G352420 [Cucumis sativus]
Length=566

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  362  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  421

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ +NENRTL
Sbjct  422  SFHRYAQYMNFSHPLIKEKFDPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNMNENRTL  481

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS  EI NAAVVHFNGNMKPWLDIAI
Sbjct  482  WKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISKGEIENAAVVHFNGNMKPWLDIAI  541

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRP WTKYVDY  E++QACN GL
Sbjct  542  TQFRPYWTKYVDYGLEFVQACNLGL  566



>ref|XP_008458050.1| PREDICTED: galacturonosyltransferase 8 [Cucumis melo]
Length=566

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  362  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  421

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ +NENRTL
Sbjct  422  SFHRYAQYMNFSHPLIKEKFDPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNMNENRTL  481

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS  EI NAAVVHFNGNMKPWLDIAI
Sbjct  482  WKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISKGEIENAAVVHFNGNMKPWLDIAI  541

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFRP WTKYVDY  E++QACN GL
Sbjct  542  TQFRPYWTKYVDYGLEFVQACNLGL  566



>emb|CDP03909.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   407 bits (1047),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  362  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  421

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI  KFNP ACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  422  SFHRYKQYMNFSHPLINAKFNPNACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  481

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNP I   EI NAAVVHFNGN+KPWLDI +
Sbjct  482  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPFIDKAEITNAAVVHFNGNLKPWLDIGM  541

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q+RPLWTKYVDYENE+IQACNFGL
Sbjct  542  LQYRPLWTKYVDYENEHIQACNFGL  566



>ref|XP_010257858.1| PREDICTED: probable galacturonosyltransferase 9 [Nelumbo nucifera]
Length=569

 Score =   407 bits (1046),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYP LHRILFLDDD+VVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  365  RNPKYLSMLNHLRFYLPEMYPNLHRILFLDDDVVVQKDLTGLWKIDMDGKVNGAVETCFG  424

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLIR +FNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ+LNENRTL
Sbjct  425  SFHRYAQYMNFSHPLIRERFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQSLNENRTL  484

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLDIA+
Sbjct  485  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISIDEIKRAAVIHYNGNMKPWLDIAM  544

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q+RP W+KYVDYE E++Q CNFGL
Sbjct  545  NQYRPFWSKYVDYEMEFVQGCNFGL  569



>ref|XP_007201169.1| hypothetical protein PRUPE_ppa003603mg [Prunus persica]
 gb|EMJ02368.1| hypothetical protein PRUPE_ppa003603mg [Prunus persica]
Length=562

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW IDMDGKVNGAVETCFG
Sbjct  358  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWNIDMDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWR++ CT EYHYWQ LNENR+L
Sbjct  418  SFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRRQNCTAEYHYWQNLNENRSL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  478  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            +QFRPLW K+VDY+ E++QACNFG+
Sbjct  538  SQFRPLWEKHVDYDMEFVQACNFGI  562



>ref|XP_009404224.1| PREDICTED: galacturonosyltransferase 8-like [Musa acuminata subsp. 
malaccensis]
Length=557

 Score =   405 bits (1042),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEM+PKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  353  RNPKYLSMLNHLRFYLPEMHPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNPKAC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENRTL
Sbjct  413  SFHRYAQYMNFSHPLIKEKFNPKACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EINNAAVVHFNGNMKPWLDIA+
Sbjct  473  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEINNAAVVHFNGNMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY+ E+++ CNF 
Sbjct  533  NQFRHLWTKYVDYDMEFVRQCNFA  556



>ref|XP_007142473.1| hypothetical protein PHAVU_008G283600g [Phaseolus vulgaris]
 gb|ESW14467.1| hypothetical protein PHAVU_008G283600g [Phaseolus vulgaris]
Length=547

 Score =   405 bits (1041),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  343  RNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  402

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+ KCTEEYHYWQ LNENRTL
Sbjct  403  SFHRYAQYMNFSHPLIKEKFSPKACAWAYGMNFFDLDAWRRTKCTEEYHYWQNLNENRTL  462

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLITYYSTTKPL KSWHVLGLGYNPSI  DEI NAAVVHFNGNMKPWLDIA+
Sbjct  463  WKLGTLPPGLITYYSTTKPLHKSWHVLGLGYNPSIGMDEIKNAAVVHFNGNMKPWLDIAM  522

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +QF+PLWTKYVDYE ++++ACNF
Sbjct  523  SQFKPLWTKYVDYELDFVRACNF  545



>ref|XP_008372509.1| PREDICTED: galacturonosyltransferase 8 [Malus domestica]
Length=563

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  359  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWRIDMDGKVNGAVETCFG  418

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWRK+ CT EYHYWQ LNENR+L
Sbjct  419  SFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRKQNCTAEYHYWQNLNENRSL  478

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  479  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  538

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            +QF+PLW K+V Y+ E++QACNFGL
Sbjct  539  SQFKPLWEKHVSYDMEFVQACNFGL  563



>ref|XP_009372029.1| PREDICTED: galacturonosyltransferase 8-like [Pyrus x bretschneideri]
Length=575

 Score =   405 bits (1041),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  371  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWRIDMDGKVNGAVETCFG  430

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWRK+ CT EYHYWQ LNENR+L
Sbjct  431  SFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRKQNCTAEYHYWQNLNENRSL  490

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  491  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  550

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            +QF+PLW K+V Y+ E++QACNFGL
Sbjct  551  SQFKPLWEKHVSYDMEFVQACNFGL  575



>ref|XP_008778166.1| PREDICTED: galacturonosyltransferase 8-like [Phoenix dactylifera]
Length=559

 Score =   404 bits (1039),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  355  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  414

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ +FNPKAC WAYGMNFFDLDAWR+EKCTE+YHYWQ LNENRTL
Sbjct  415  SFHRYAQYMNFSHPLIKERFNPKACGWAYGMNFFDLDAWRREKCTEQYHYWQNLNENRTL  474

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  475  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIAM  534

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDYE E+I+ CNF 
Sbjct  535  NQFRHLWTKYVDYEMEFIRQCNFA  558



>ref|XP_008803497.1| PREDICTED: LOW QUALITY PROTEIN: galacturonosyltransferase 8-like 
[Phoenix dactylifera]
Length=556

 Score =   404 bits (1037),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDM+GKVNGAVETCFG
Sbjct  352  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMEGKVNGAVETCFG  411

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ +FNPKAC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENRTL
Sbjct  412  SFHRYAQYMNFSHPLIKERFNPKACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENRTL  471

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  472  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIKNAAVVHFNGNMKPWLDIAM  531

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY+ E+I+ CNF 
Sbjct  532  NQFRHLWTKYVDYDMEFIRQCNFA  555



>ref|XP_007049694.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOX93851.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=568

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 181/200 (91%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  361  RNPKYLSILNHLRFYLPEMYPTLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  420

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  421  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  480

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  481  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIAM  540

Query  217  AQFRPLWTKYVDYENEYIQA  158
             QF+PLWTKYVDY+ E++QA
Sbjct  541  NQFKPLWTKYVDYDLEFVQA  560



>ref|XP_008457595.1| PREDICTED: galacturonosyltransferase 8-like [Cucumis melo]
Length=567

 Score =   403 bits (1035),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDM+GKVNGAVETCFG
Sbjct  363  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMNGKVNGAVETCFG  422

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KF+PKACAWAYGMNFFDLDAWR+E CTE+YHYWQ +NENRTL
Sbjct  423  SFHRYAQYMNFSHPLIKQKFDPKACAWAYGMNFFDLDAWRRENCTEDYHYWQNMNENRTL  482

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIAI
Sbjct  483  WKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISKDEIQNAAVVHFNGNMKPWLDIAI  542

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
            +QF+P WT+YVDY+ E++Q+CN G+
Sbjct  543  SQFKPYWTRYVDYDLEFVQSCNLGV  567



>ref|XP_010913084.1| PREDICTED: galacturonosyltransferase 8 [Elaeis guineensis]
Length=557

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  353  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ +FNPKAC WAYGMNFFDLDAWR+EKCTE+YHYWQ LNENRTL
Sbjct  413  SFHRYAQYMNFSHPLIKARFNPKACGWAYGMNFFDLDAWRREKCTEQYHYWQNLNENRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  473  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIKNAAVVHFNGNMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY+ E+I  CNF 
Sbjct  533  NQFRHLWTKYVDYDMEFIHQCNFA  556



>ref|XP_006841268.1| hypothetical protein AMTR_s00135p00111710 [Amborella trichopoda]
 gb|ERN02943.1| hypothetical protein AMTR_s00135p00111710 [Amborella trichopoda]
Length=561

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW IDMDGKVNGAVETCFG
Sbjct  357  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWNIDMDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY +YMNFSHPLI+ +FNPKAC WAYGMNFFDLDAWR EKCTE+YHYWQ LNENRTL
Sbjct  417  SFHRYDKYMNFSHPLIKERFNPKACGWAYGMNFFDLDAWRSEKCTEQYHYWQNLNENRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIQNAAVVHFNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QFR LWTKYVDY+ E++Q CNFGL
Sbjct  537  NQFRHLWTKYVDYDMEFVQMCNFGL  561



>ref|XP_009379995.1| PREDICTED: galacturonosyltransferase 8-like [Musa acuminata subsp. 
malaccensis]
Length=557

 Score =   399 bits (1026),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLT LWKIDMDGKVNGAVETCFG
Sbjct  353  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTALWKIDMDGKVNGAVETCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENRTL
Sbjct  413  SFHRYTQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  473  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIKNAAVVHFNGNMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY+ E+++ CNF 
Sbjct  533  NQFRHLWTKYVDYDLEFVRQCNFA  556



>ref|XP_010908797.1| PREDICTED: galacturonosyltransferase 8-like [Elaeis guineensis]
Length=557

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDM+GKVNGAVETCFG
Sbjct  353  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMEGKVNGAVETCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ +F+PKAC WAYGMNFFDLDAWR+EKCTE+YHYWQ LNENRTL
Sbjct  413  SFHRYAQYMNFSHPLIKERFSPKACGWAYGMNFFDLDAWRREKCTEQYHYWQNLNENRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  473  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIKNAAVVHFNGNMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY+ E+I  CNF 
Sbjct  533  NQFRHLWTKYVDYDMEFIHQCNFA  556



>ref|XP_004290178.1| PREDICTED: galacturonosyltransferase 8 [Fragaria vesca subsp. 
vesca]
Length=562

 Score =   399 bits (1024),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKL+RILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETCFG
Sbjct  358  RNPKYLSILNHLRFYLPEMYPKLNRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWR+  CT +YHYWQ LNENRTL
Sbjct  418  SFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRRVNCTADYHYWQNLNENRTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  478  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+P+W K+VDY+ E++Q CNFG+
Sbjct  538  NQFKPIWEKHVDYDLEFVQGCNFGM  562



>ref|NP_001168623.1| uncharacterized protein LOC100382408 [Zea mays]
 gb|ACN28889.1| unknown [Zea mays]
Length=274

 Score =   387 bits (995),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  69   RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  128

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EKCTE+YHYWQ  NENRTL
Sbjct  129  SFHRYAQYMNFSHPLIKAKFNPNACGWAYGMNFFDLDSWRREKCTEQYHYWQNQNENRTL  188

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  189  WKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  248

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++ YI+ CNF 
Sbjct  249  NQFRHLWTKYVDYDDSYIRQCNFA  272



>gb|AID53187.1| galacturonosyltransferase 8-like protein [Dendrobium catenatum]
Length=551

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHR+LFLDDD+VVQRDLT LWK+DMDGKVNGAVETCFG
Sbjct  347  RNPKYLSMLNHLRFYLPEMYPKLHRVLFLDDDVVVQRDLTALWKLDMDGKVNGAVETCFG  406

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ +FNP AC WAYGMNFFDLDAWRKEK TE+YHYWQ LNENRTL
Sbjct  407  SFHRYAQYMNFSHPLIKERFNPNACGWAYGMNFFDLDAWRKEKSTEQYHYWQNLNENRTL  466

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  467  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMNEIRNAAVVHFNGNMKPWLDIGM  526

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFRPLW +YVDY+N++I  CNFG
Sbjct  527  NQFRPLWARYVDYDNDFISLCNFG  550



>gb|AFW71494.1| hypothetical protein ZEAMMB73_252708 [Zea mays]
Length=521

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  316  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  375

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EKCTE+YHYWQ  NENRTL
Sbjct  376  SFHRYAQYMNFSHPLIKAKFNPNACGWAYGMNFFDLDSWRREKCTEQYHYWQNQNENRTL  435

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  436  WKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  495

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++ YI+ CNF 
Sbjct  496  NQFRHLWTKYVDYDDSYIRQCNFA  519



>ref|XP_002453869.1| hypothetical protein SORBIDRAFT_04g020140 [Sorghum bicolor]
 gb|EES06845.1| hypothetical protein SORBIDRAFT_04g020140 [Sorghum bicolor]
Length=534

 Score =   393 bits (1009),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  329  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  388

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EKCTE+YHYWQ  NENRTL
Sbjct  389  SFHRYAQYMNFSHPLIKAKFNPNACGWAYGMNFFDLDSWRREKCTEQYHYWQNQNENRTL  448

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  449  WKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  508

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++ YI+ CNF 
Sbjct  509  NQFRHLWTKYVDYDDSYIRQCNFA  532



>ref|XP_004952528.1| PREDICTED: galacturonosyltransferase 8-like [Setaria italica]
Length=533

 Score =   392 bits (1006),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  328  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  387

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI+ KF+P AC WAYGMNFFDLD+WR+EKCTE+YHYWQ  NENRTL
Sbjct  388  SFHRYWQYMNFSHPLIKAKFSPNACGWAYGMNFFDLDSWRREKCTEQYHYWQNQNENRTL  447

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  448  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  507

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++EYI+ CNF 
Sbjct  508  NQFRHLWTKYVDYDDEYIRQCNFA  531



>ref|XP_006384242.1| hypothetical protein POPTR_0004s10980g [Populus trichocarpa]
 gb|ERP62039.1| hypothetical protein POPTR_0004s10980g [Populus trichocarpa]
Length=562

 Score =   392 bits (1006),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWK+D+DGKVNGAVETCFG
Sbjct  358  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKVDLDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+ +FNPKACAWA+GMN FDLDAWR+EKCTE+YHYWQ+LNE RTL
Sbjct  418  SFHRYAQYLNFSHPLIKERFNPKACAWAFGMNIFDLDAWRREKCTEQYHYWQSLNEERTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDIA+
Sbjct  478  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDIAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  538  NQYKNLWTKYVDNDMEFVQTCNFGL  562



>ref|XP_011012259.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
Length=562

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILF+DDD+VVQ+DLTGLWK+D+DGKVNGAVETCFG
Sbjct  358  RNPKYLSMLNHLRFYLPEMYPKLHKILFMDDDVVVQKDLTGLWKVDLDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+ +FNPKACAWA+GMN FDLDAWR+EKCTE+YHYWQ+ NE RTL
Sbjct  418  SFHRYAQYLNFSHPLIKERFNPKACAWAFGMNIFDLDAWRREKCTEQYHYWQSRNEERTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDIA+
Sbjct  478  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDIAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++QACNFGL
Sbjct  538  NQYKNLWTKYVDNDMEFVQACNFGL  562



>ref|XP_006373520.1| hypothetical protein POPTR_0017s144802g, partial [Populus trichocarpa]
 gb|ERP51317.1| hypothetical protein POPTR_0017s144802g, partial [Populus trichocarpa]
Length=504

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKY+S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWK+D+DGKVNGAVETCFG
Sbjct  300  RNPKYMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKVDLDGKVNGAVETCFG  359

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+ +FNPKACAWA+GMN FDLDAWR+EKCTE YHYWQ+LNE+RTL
Sbjct  360  SFHRYAQYLNFSHPLIKERFNPKACAWAFGMNIFDLDAWRREKCTEHYHYWQSLNEDRTL  419

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDIA+
Sbjct  420  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDIAM  479

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  480  NQYKNLWTKYVDNDMEFVQMCNFGL  504



>gb|KDP24309.1| hypothetical protein JCGZ_25605 [Jatropha curcas]
Length=562

 Score =   389 bits (999),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETCFG
Sbjct  358  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLIR +FNPK+CAWAYGMN FDLD+WR+EKCTE+YHYWQ LNE+RTL
Sbjct  418  SFHRYAQYLNFSHPLIRERFNPKSCAWAYGMNIFDLDSWRREKCTEQYHYWQNLNEDRTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+ STTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  478  WKLGTLPPGLITFCSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  538  NQYKNLWTKYVDNDMEFVQMCNFGL  562



>ref|XP_006482345.1| PREDICTED: probable galacturonosyltransferase 9-like [Citrus 
sinensis]
Length=559

 Score =   389 bits (998),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLW ID+DGKVNGAVETCFG
Sbjct  355  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWNIDLDGKVNGAVETCFG  414

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLIR KFNPKACAWA+GMN FDLDAWR+EKCT++YHYWQ LNE+RTL
Sbjct  415  SFHRYAQYLNFSHPLIREKFNPKACAWAFGMNIFDLDAWRREKCTDQYHYWQNLNEDRTL  474

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN AAV+H+NGNMKPWLDIA+
Sbjct  475  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINKAAVIHYNGNMKPWLDIAM  534

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  535  NQYKSLWTKYVDNDMEFVQVCNFGL  559



>ref|XP_006430887.1| hypothetical protein CICLE_v10011396mg [Citrus clementina]
 gb|ESR44127.1| hypothetical protein CICLE_v10011396mg [Citrus clementina]
Length=559

 Score =   389 bits (998),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLW ID+DGKVNGAVETCFG
Sbjct  355  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWNIDLDGKVNGAVETCFG  414

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLIR KFNPKACAWA+GMN FDLDAWR+EKCT++YHYWQ LNE+RTL
Sbjct  415  SFHRYAQYLNFSHPLIREKFNPKACAWAFGMNIFDLDAWRREKCTDQYHYWQNLNEDRTL  474

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN AAV+H+NGNMKPWLDIA+
Sbjct  475  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINKAAVIHYNGNMKPWLDIAM  534

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  535  NQYKSLWTKYVDNDMEFVQVCNFGL  559



>ref|XP_006648647.1| PREDICTED: galacturonosyltransferase 8-like, partial [Oryza brachyantha]
Length=420

 Score =   383 bits (984),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  215  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  274

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ  NENRTL
Sbjct  275  SFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQNQNENRTL  334

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  335  WKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  394

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++ +I+ CNF 
Sbjct  395  NQFRHLWTKYVDYDDSFIRQCNFA  418



>ref|XP_011021133.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021134.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021136.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021137.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021138.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
Length=558

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKY+S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWK+D+DGKVNGAVETCFG
Sbjct  354  RNPKYMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKVDLDGKVNGAVETCFG  413

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+ KFNPKACAWA+GMN FDLDAWR+EKCTE YHYWQ+LNE+RTL
Sbjct  414  SFHRYAQYLNFSHPLIKEKFNPKACAWAFGMNIFDLDAWRREKCTEHYHYWQSLNEDRTL  473

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDIA+
Sbjct  474  WKLGTLPPGLITFYSRTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDIAM  533

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  534  NQYKNLWTKYVDNDMEFVQMCNFGL  558



>emb|CDP02368.1| unnamed protein product [Coffea canephora]
Length=565

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLT LW+IDMDGKVNGAVETCFG
Sbjct  361  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTALWRIDMDGKVNGAVETCFG  420

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+AQYMNFSHPLIR KFNPKACAWA+GMN FDLDAWR+EKCTEEYHYWQ LNE+RTL
Sbjct  421  SFHRFAQYMNFSHPLIREKFNPKACAWAFGMNIFDLDAWRREKCTEEYHYWQNLNEDRTL  480

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W LGTLPPGL+T+YSTTK LDKSWHVLGLG+NPSIS DEINNAAV+HFNGNMKPWLDIA+
Sbjct  481  WMLGTLPPGLMTFYSTTKSLDKSWHVLGLGFNPSISMDEINNAAVIHFNGNMKPWLDIAM  540

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD +  ++Q CNFG+
Sbjct  541  NQYKHLWTKYVDSDMIFVQMCNFGM  565



>ref|XP_008230332.1| PREDICTED: probable galacturonosyltransferase 9 [Prunus mume]
Length=562

 Score =   387 bits (994),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETCFG
Sbjct  358  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLIR +FNP+ACAWAYGMN FDLDAWR+EKCTE+YHYWQ LNE+RTL
Sbjct  418  SFHRYAQYLNFSHPLIRERFNPRACAWAYGMNIFDLDAWRQEKCTEQYHYWQNLNEDRTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI NAAV+H+NGNMKPWLDIA+
Sbjct  478  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEIRNAAVIHYNGNMKPWLDIAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWT Y+D + E++Q CNFGL
Sbjct  538  NQYKKLWTYYLDNDMEFVQMCNFGL  562



>gb|EEC73220.1| hypothetical protein OsI_07307 [Oryza sativa Indica Group]
Length=533

 Score =   386 bits (991),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  328  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  387

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ+ NENRTL
Sbjct  388  SFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQSQNENRTL  447

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  448  WKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  507

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++ +I+ CNF 
Sbjct  508  NQFRHLWTKYVDYDDSFIRQCNFA  531



>ref|XP_002530802.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF31570.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=563

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGA ETCFG
Sbjct  359  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAAETCFG  418

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+ KFNPKACAWAYGMN FDLDAWR+EK TE+YHYWQ LNE+RTL
Sbjct  419  SFHRYAQYLNFSHPLIKEKFNPKACAWAYGMNVFDLDAWRREKSTEQYHYWQNLNEDRTL  478

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDIA+
Sbjct  479  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDIAM  538

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFG 
Sbjct  539  NQYKNLWTKYVDSDMEFVQMCNFGF  563



>dbj|BAD23465.1| putative glycosyl transferase [Oryza sativa Japonica Group]
 gb|EEE57037.1| hypothetical protein OsJ_06821 [Oryza sativa Japonica Group]
Length=533

 Score =   385 bits (990),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  328  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  387

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ+ NENRTL
Sbjct  388  SFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQSQNENRTL  447

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  448  WKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  507

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++ +I+ CNF 
Sbjct  508  NQFRHLWTKYVDYDDSFIRQCNFA  531



>ref|NP_001046899.1| Os02g0498700 [Oryza sativa Japonica Group]
 dbj|BAF08813.1| Os02g0498700, partial [Oryza sativa Japonica Group]
Length=563

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  358  RNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ+ NENRTL
Sbjct  418  SFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQSQNENRTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  478  WKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++ +I+ CNF 
Sbjct  538  NQFRHLWTKYVDYDDSFIRQCNFA  561



>gb|KJB10201.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=555

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETCFG
Sbjct  360  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETCFG  419

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  420  SFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  479

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDIA+
Sbjct  480  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDIAM  539

Query  217  AQFRPLW  197
             QF+PLW
Sbjct  540  NQFKPLW  546



>gb|EMS51766.1| Galacturonosyltransferase 8 [Triticum urartu]
Length=269

 Score =   373 bits (958),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  64   RNPKYLSMLNHLRFYLPEMYPKLQKILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  123

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDL++WR+EK TE+YH+WQ  NENR L
Sbjct  124  SFHRYWQYMNFSHPLIKAKFNPNACGWAYGMNFFDLNSWRREKSTEQYHHWQTQNENRLL  183

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  184  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  243

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++ +I+ CNF 
Sbjct  244  NQFRQLWTKYVDYDDSFIRQCNFA  267



>ref|XP_002987448.1| Quasimodo1-like protein [Selaginella moellendorffii]
 gb|EFJ11535.1| Quasimodo1-like protein [Selaginella moellendorffii]
Length=497

 Score =   380 bits (975),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL RILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  293  RNPKYLSMLNHLRFYLPEMYPKLDRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  352

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY +YMNFSHPLI  +FNPKAC WAYGMNFFDL+AWR+EKCTEEYHYWQ+ NENR+L
Sbjct  353  SFHRYDKYMNFSHPLIASRFNPKACGWAYGMNFFDLNAWRREKCTEEYHYWQSKNENRSL  412

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y TTKPLDKSWHVLGLGYNPSIS ++I +AAV+HFNGNMKPWLD+A+
Sbjct  413  WKLGTLPPGLITFYKTTKPLDKSWHVLGLGYNPSISLEKIRSAAVIHFNGNMKPWLDLAM  472

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             Q+R  WT+YVDY+ E +Q CNFG
Sbjct  473  NQYREFWTRYVDYDMELVQMCNFG  496



>ref|XP_003572545.1| PREDICTED: galacturonosyltransferase 8-like [Brachypodium distachyon]
Length=523

 Score =   380 bits (976),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  318  RNPKYLSMLNHLRFYLPEMYPKLQQILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  377

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ  NENRTL
Sbjct  378  SFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQNHNENRTL  437

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  438  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  497

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY + +I+ CNF 
Sbjct  498  NQFRHLWTKYVDYGDSFIRQCNFA  521



>ref|XP_008379476.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
9 [Malus domestica]
Length=553

 Score =   381 bits (978),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETCFG
Sbjct  349  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETCFG  408

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLIR +FNP+ACAWAYGMN FDLDAWR EK TE+YHYWQ LNE+RTL
Sbjct  409  SFHRYAQYLNFSHPLIRERFNPRACAWAYGMNIFDLDAWRLEKSTEQYHYWQNLNEDRTL  468

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLDIA+
Sbjct  469  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEIRKAAVIHYNGNMKPWLDIAM  528

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWT Y+D + E++Q CNFGL
Sbjct  529  NQYKKLWTNYLDNDMEFVQMCNFGL  553



>ref|XP_002980055.1| Quasimodo1-like protein [Selaginella moellendorffii]
 gb|EFJ18925.1| Quasimodo1-like protein [Selaginella moellendorffii]
Length=541

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL RILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  337  RNPKYLSMLNHLRFYLPEMYPKLDRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  396

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY +YMNFSHPLI  +FNPKAC WAYGMNFFDL+AWR+EKCTEEYHYWQ+ NENR+L
Sbjct  397  SFHRYDKYMNFSHPLIASRFNPKACGWAYGMNFFDLNAWRREKCTEEYHYWQSKNENRSL  456

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y TTKPLDKSWHVLGLGYNPSIS ++I +AAV+HFNGNMKPWLD+A+
Sbjct  457  WKLGTLPPGLITFYKTTKPLDKSWHVLGLGYNPSISLEKIRSAAVIHFNGNMKPWLDLAM  516

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             Q+R  WT+YVDY+ E +Q CNFG
Sbjct  517  NQYREFWTRYVDYDMELVQMCNFG  540



>ref|XP_009373741.1| PREDICTED: probable galacturonosyltransferase 9 [Pyrus x bretschneideri]
Length=562

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETCFG
Sbjct  358  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLIR +FNP+ACAWAYGMN FDLDAWR+EK TE+YHYWQ LNE+RTL
Sbjct  418  SFHRYAQYVNFSHPLIRERFNPRACAWAYGMNIFDLDAWRREKSTEQYHYWQNLNEDRTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLD+A+
Sbjct  478  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEIRKAAVIHYNGNMKPWLDVAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWT Y+D + E++Q CNFGL
Sbjct  538  NQYKKLWTYYLDNDMEFVQMCNFGL  562



>ref|XP_008341825.1| PREDICTED: probable galacturonosyltransferase 9 [Malus domestica]
Length=562

 Score =   380 bits (976),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETCFG
Sbjct  358  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETCFG  417

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLIR +FNP+ACAWAYGMN FDLDAWR+EK TE+YHYWQ LNE+RTL
Sbjct  418  SFHRYAQYLNFSHPLIRERFNPRACAWAYGMNIFDLDAWRQEKSTEQYHYWQNLNEDRTL  477

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLD+A+
Sbjct  478  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEIRKAAVIHYNGNMKPWLDVAM  537

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWT Y+D + E++Q CNFGL
Sbjct  538  NQYKKLWTYYLDNDMEFVQMCNFGL  562



>dbj|BAK03588.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=562

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFG
Sbjct  357  RNPKYLSMLNHLRFYLPEMYPKLQKILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDL++WR+EK TE+YHYWQ  NENR L
Sbjct  417  SFHRYWQYMNFSHPLIKAKFNPNACGWAYGMNFFDLNSWRREKSTEQYHYWQTQNENRLL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI +
Sbjct  477  WKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIGM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             QFR LWTKYVDY++ +I+ CNF 
Sbjct  537  NQFRQLWTKYVDYDDSFIRQCNFA  560



>ref|XP_009603685.1| PREDICTED: probable galacturonosyltransferase 9 [Nicotiana tomentosiformis]
Length=547

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLT LW ID+DGKVNGAVETCFG
Sbjct  343  KNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTALWTIDLDGKVNGAVETCFG  402

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPL+R KF PKACAWA+GMN FDLDAWR+E+CTE+YHYWQ LNE+RTL
Sbjct  403  SFHRYAQYLNFSHPLVREKFTPKACAWAFGMNIFDLDAWRREQCTEQYHYWQNLNEDRTL  462

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLP GL+T+YS TK LDKSWHVLGLGYNPS+S DEI+ AAV+H+NG+MKPWLDIA+
Sbjct  463  WKLGTLPAGLMTFYSKTKSLDKSWHVLGLGYNPSVSMDEIHKAAVIHYNGDMKPWLDIAL  522

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKY+D E E++Q CNFG+
Sbjct  523  NQYKELWTKYIDSEMEFVQMCNFGV  547



>ref|XP_009792003.1| PREDICTED: probable galacturonosyltransferase 9 [Nicotiana sylvestris]
Length=547

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLT LW ID+DGKVNGAVETCFG
Sbjct  343  KNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTALWTIDLDGKVNGAVETCFG  402

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPL+R KF PKACAWA+GMN FDLDAWR+E+CTE+YHYWQ LNE+RTL
Sbjct  403  SFHRYAQYLNFSHPLVREKFTPKACAWAFGMNIFDLDAWRREQCTEQYHYWQNLNEDRTL  462

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLP GL+T+YS TK LDKSWHVLGLGYNPS+S DEI+ AAV+H+NG+MKPWLDIA+
Sbjct  463  WKLGTLPAGLMTFYSKTKSLDKSWHVLGLGYNPSVSMDEIHKAAVIHYNGDMKPWLDIAL  522

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKY+D E E++Q CNFG+
Sbjct  523  NQYKELWTKYIDSEMEFVQMCNFGV  547



>ref|XP_010100891.1| putative galacturonosyltransferase 9 [Morus notabilis]
 gb|EXB85815.1| putative galacturonosyltransferase 9 [Morus notabilis]
Length=612

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 202/229 (88%), Gaps = 4/229 (2%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETCFG
Sbjct  359  RNPKYLSMLNHLRFYLPEIYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETCFG  418

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+ KFNPKACAWAYGMN FDLDAWR+EK TE+YHYWQ LNE+RTL
Sbjct  419  SFHRYAQYLNFSHPLIKEKFNPKACAWAYGMNIFDLDAWRREKSTEQYHYWQNLNEDRTL  478

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS D IN A+V+H+NGNMKPWLDIA+
Sbjct  479  WKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDAINRASVIHYNGNMKPWLDIAM  538

Query  217  AQFRPLWTKYVDYENEYIQACNFGL*VMVIVEALLRGFLQVLSMSLISS  71
             Q++ LWTKYVD + E++Q    G   + +VE    G L +LS +++S+
Sbjct  539  NQYKNLWTKYVDNDMEFVQIAKLGD-SLFLVE---NGGLMILSFNVLSA  583



>ref|XP_006338312.1| PREDICTED: probable galacturonosyltransferase 9-like [Solanum 
tuberosum]
Length=547

 Score =   375 bits (963),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYP LHRILFLDDD+VVQ+DLT LW ID+DGKVNGAVETCFG
Sbjct  343  KNPKYLSMLNHLRFYLPEMYPTLHRILFLDDDVVVQKDLTALWTIDLDGKVNGAVETCFG  402

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY+QY+NFSHPL+R KFNPKACAWA+GMN FDLDAWR+EKCTE+YHYWQ LNE+RTL
Sbjct  403  SFHRYSQYLNFSHPLVREKFNPKACAWAFGMNIFDLDAWRREKCTEQYHYWQNLNEDRTL  462

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLP GL+T++S TK LDKSWHVLGLG+NPS+S DEI+ AAV+H+NG+MKPWLDIA+
Sbjct  463  WKLGTLPAGLMTFFSKTKSLDKSWHVLGLGFNPSVSMDEIHKAAVIHYNGDMKPWLDIAL  522

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKY+D E E++Q CNFG+
Sbjct  523  NQYKELWTKYIDSEMEFVQMCNFGV  547



>ref|XP_007032944.1| Glycosyltransferase isoform 2 [Theobroma cacao]
 gb|EOY03870.1| Glycosyltransferase isoform 2 [Theobroma cacao]
Length=488

 Score =   373 bits (957),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++P Y+ +LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETCFG
Sbjct  284  RNPNYMPMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETCFG  343

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR++QY+NFSHPLI+ +FNPKACAWAYGMN FDLDAWR+EKCTE YH WQ LNE+RTL
Sbjct  344  SFHRFSQYLNFSHPLIKERFNPKACAWAYGMNIFDLDAWRREKCTETYHNWQNLNEDRTL  403

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  404  WKLGTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAM  463

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFG+
Sbjct  464  NQYKNLWTKYVDNDMEFVQMCNFGV  488



>ref|XP_004232120.1| PREDICTED: probable galacturonosyltransferase 9 [Solanum lycopersicum]
Length=547

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYP LHRILFLDDD+VVQ+DLT LW ID+DGKVNGAVETCFG
Sbjct  343  KNPKYLSMLNHLRFYLPEMYPTLHRILFLDDDVVVQKDLTALWTIDLDGKVNGAVETCFG  402

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY+QY+NFSHPL+R KFNPKACAWA+GMN FDLDAWR+EKCTE+YHYWQ LNE+RTL
Sbjct  403  SFHRYSQYLNFSHPLVREKFNPKACAWAFGMNIFDLDAWRREKCTEQYHYWQNLNEDRTL  462

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLP GL+T++S TK LDKSWHVLGLG+NPS+S DEI+ AAV+H+NG+MKPWLDIA+
Sbjct  463  WKLGTLPAGLMTFFSKTKSLDKSWHVLGLGFNPSVSMDEIHKAAVIHYNGDMKPWLDIAL  522

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKY+D E E++Q CNFG+
Sbjct  523  NQYKELWTKYIDSEMEFVQMCNFGV  547



>ref|XP_007032943.1| Glycosyltransferase isoform 1 [Theobroma cacao]
 gb|EOY03869.1| Glycosyltransferase isoform 1 [Theobroma cacao]
Length=554

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++P Y+ +LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETCFG
Sbjct  350  RNPNYMPMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETCFG  409

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR++QY+NFSHPLI+ +FNPKACAWAYGMN FDLDAWR+EKCTE YH WQ LNE+RTL
Sbjct  410  SFHRFSQYLNFSHPLIKERFNPKACAWAYGMNIFDLDAWRREKCTETYHNWQNLNEDRTL  469

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  470  WKLGTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAM  529

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFG+
Sbjct  530  NQYKNLWTKYVDNDMEFVQMCNFGV  554



>ref|XP_010029444.1| PREDICTED: probable galacturonosyltransferase 9 [Eucalyptus grandis]
 gb|KCW56357.1| hypothetical protein EUGRSUZ_I02091 [Eucalyptus grandis]
Length=554

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 162/205 (79%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++P  LS+LNHLRFYLPEMYPKLH+IL+LDDD+VVQ+DLTGLW IDM GKVNGAVETCFG
Sbjct  350  RNPGELSMLNHLRFYLPEMYPKLHKILYLDDDVVVQKDLTGLWNIDMAGKVNGAVETCFG  409

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY+QY+NFSHPLI+ +FNPKACAWAYGMN FDLDAWR+EKCTEEYHYWQ LN ++TL
Sbjct  410  SFHRYSQYLNFSHPLIKERFNPKACAWAYGMNLFDLDAWRREKCTEEYHYWQNLNGDQTL  469

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK GTLPPGLIT+YS+TK LDKSWHVLGLGYNPSIS DEIN+AAV+H++GNMKPWLD+A+
Sbjct  470  WKSGTLPPGLITFYSSTKSLDKSWHVLGLGYNPSISMDEINHAAVIHYSGNMKPWLDVAL  529

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  530  NQYKNLWTKYVDNDMEFVQMCNFGL  554



>ref|XP_010660537.1| PREDICTED: probable galacturonosyltransferase 9 [Vitis vinifera]
 emb|CBI16902.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 187/205 (91%), Gaps = 1/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++P Y S+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DL+ LW+ID+DGKVNGAVETCFG
Sbjct  340  RNPNY-SLLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLSALWRIDLDGKVNGAVETCFG  398

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYA Y+NFS+ +IR KFNPKACAWAYGMN FDLDAWR+EKCT++YHYWQ LNE+ TL
Sbjct  399  SFHRYAHYLNFSNSVIREKFNPKACAWAYGMNIFDLDAWRREKCTDQYHYWQNLNEDGTL  458

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK G LPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN+AAV+HFNGNMKPWLDIAI
Sbjct  459  WKSGMLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINHAAVIHFNGNMKPWLDIAI  518

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+ LWTKYVD + E++Q CNFGL
Sbjct  519  NQFKNLWTKYVDNDMEFVQVCNFGL  543



>gb|AFV46220.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=258

 Score =   357 bits (917),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFY+PEMYPKLH+ILFLDDD+VVQ+DLT LWKID+DGKVNGA+ TCFG
Sbjct  54   RNPKYLSMLNHLRFYMPEMYPKLHKILFLDDDVVVQKDLTALWKIDLDGKVNGAINTCFG  113

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR ++Y+NFSHPLI+ KFNP+ACAWA GMN FDLDAWR EKCTE+YHYWQ LNE+RTL
Sbjct  114  SFHRLSEYLNFSHPLIKEKFNPRACAWALGMNIFDLDAWRLEKCTEQYHYWQNLNEDRTL  173

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK+GTLP GL+T+YSTTKPLDK+WHVLGLG NPSIS +EI  AAV+HF+G+MKPWLDIA+
Sbjct  174  WKMGTLPAGLVTFYSTTKPLDKAWHVLGLGSNPSISMEEIEKAAVIHFSGDMKPWLDIAM  233

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
              ++ LWTKYVD E E++Q CNFG+
Sbjct  234  NHYKHLWTKYVDNEMEFVQMCNFGM  258



>ref|XP_010558537.1| PREDICTED: probable galacturonosyltransferase 9 [Tarenaya hassleriana]
Length=564

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++P Y+S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKI++DGKVNGAVETCFG
Sbjct  360  KNPNYISMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKINLDGKVNGAVETCFG  419

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY+QY+NFSHPLI+  FNP ACAWA+GMN FDLDAWR+EKCTE+ H+WQ LNE + L
Sbjct  420  SFHRYSQYLNFSHPLIKESFNPNACAWAFGMNIFDLDAWRREKCTEQLHHWQNLNEEQNL  479

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W+LGTLPPGLIT+YS TK LDK+WHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDIA+
Sbjct  480  WRLGTLPPGLITFYSKTKSLDKTWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDIAM  539

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  540  NQYKSLWTKYVDNEMEFVQMCNFGL  564



>ref|XP_010549958.1| PREDICTED: probable galacturonosyltransferase 9 isoform X2 [Tarenaya 
hassleriana]
 gb|ABD96860.1| hypothetical protein [Cleome spinosa]
Length=556

 Score =   367 bits (942),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++ K+LS+LNHLRFYLPEMYPKL ++LFLDDD+VVQ+DLTGLWKI++DGKVNGAVETCFG
Sbjct  352  KNAKHLSMLNHLRFYLPEMYPKLRKMLFLDDDVVVQKDLTGLWKINLDGKVNGAVETCFG  411

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+  FNP +CAWA+GMN FDLDAWR+EKCTE+YHYWQ LNE+++L
Sbjct  412  SFHRYAQYLNFSHPLIKESFNPNSCAWAFGMNIFDLDAWRREKCTEQYHYWQNLNEDQSL  471

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W++GTLPPGLIT+YS TK LDK+WHV+GLGYNPS+  DEI NAAV+H+NGNMKPWLDIA+
Sbjct  472  WRVGTLPPGLITFYSKTKSLDKAWHVMGLGYNPSVGMDEIRNAAVIHYNGNMKPWLDIAM  531

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  532  NQYKSLWTKYVDGEMEFVQMCNFGL  556



>emb|CAN73730.1| hypothetical protein VITISV_022574 [Vitis vinifera]
Length=543

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 186/205 (91%), Gaps = 1/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++P Y S+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DL+ LW+ID+DGKVNGAVETCFG
Sbjct  340  RNPNY-SLLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLSALWRIDLDGKVNGAVETCFG  398

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYA Y+NFS+ +IR K NPKACAWAYGMN FDLDAWR+EKCT++YHYWQ LNE+ TL
Sbjct  399  SFHRYAHYLNFSNSVIREKXNPKACAWAYGMNIFDLDAWRREKCTDQYHYWQNLNEDGTL  458

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK G LPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN+AAV+HFNGNMKPWLDIAI
Sbjct  459  WKSGMLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINHAAVIHFNGNMKPWLDIAI  518

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             QF+ LWTKYVD + E++Q CNFGL
Sbjct  519  NQFKNLWTKYVDNDMEFVQVCNFGL  543



>gb|KHG03994.1| putative galacturonosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=557

 Score =   365 bits (938),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++P+ +S+LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETCFG
Sbjct  353  KNPESMSMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR++QY+NF+HPLI+ +FNPKACAWAYGMN FDLDAWR+EKCTE Y  WQ LNE+RTL
Sbjct  413  SFHRFSQYLNFTHPLIKERFNPKACAWAYGMNIFDLDAWRREKCTETYEEWQNLNEDRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKL  LPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  473  WKLDALPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFG+
Sbjct  533  NQYKNLWTKYVDNDMEFVQMCNFGV  557



>gb|AFK41629.1| unknown [Lotus japonicus]
Length=274

 Score =   355 bits (912),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            +  KYLS+L+HLRFYLP+MYP LH IL LDDD+VVQ+DLTGLWKID+ GKVNGAVE CFG
Sbjct  70   KSAKYLSMLDHLRFYLPQMYPNLHHILLLDDDVVVQKDLTGLWKIDLGGKVNGAVEICFG  129

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+  FNPK CAWAYGMN FDL+AWR+EKCTE YHYWQ  NE++TL
Sbjct  130  SFHRYAQYLNFSHPLIKDSFNPKTCAWAYGMNIFDLEAWRREKCTENYHYWQNKNEDQTL  189

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  190  WKSGTLSPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAL  249

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  250  NQYKNLWTKYVDNDMEFVQMCNFGL  274



>ref|XP_003635905.1| Glycosyltransferase [Medicago truncatula]
 gb|KEH25211.1| glycosyltransferase Quasimodo protein, putative [Medicago truncatula]
Length=555

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++ KYLS+L++L+FYLPEMYPKL  IL LDDD+VVQ+DLTGLWKID+DGKVNGAVE CFG
Sbjct  351  RNAKYLSMLDYLQFYLPEMYPKLRNILLLDDDVVVQKDLTGLWKIDLDGKVNGAVEICFG  410

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY+QY+NFSHPLI+  FNPKACAW YGMN FDLDAWR+EKCTE YHYWQ  NE++T+
Sbjct  411  SFHRYSQYVNFSHPLIKETFNPKACAWTYGMNIFDLDAWRREKCTEHYHYWQNKNEDQTI  470

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK GTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  471  WKSGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAL  530

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  531  NQYKNLWTKYVDSDMEFVQMCNFGL  555



>gb|KJB48245.1| hypothetical protein B456_008G059800 [Gossypium raimondii]
Length=494

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  KYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFH  569
            +++S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+ GKVNGAVETCFGSFH
Sbjct  293  EHMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLSGKVNGAVETCFGSFH  352

Query  568  RYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKL  389
            R++QY+NFSHPLIR +FNPKACAWAYGMN FDLDAWR++KCTE YH WQ LN +R LWK 
Sbjct  353  RFSQYLNFSHPLIRERFNPKACAWAYGMNIFDLDAWRRKKCTETYHNWQNLNVDRALWKS  412

Query  388  GTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQF  209
            GTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS D INNAAV+H+NGNMKPWLDIA+ Q+
Sbjct  413  GTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDVINNAAVIHYNGNMKPWLDIAMNQY  472

Query  208  RPLWTKYVDYENEYIQACNFGL  143
            + LWTKYVD + E++Q CNFG+
Sbjct  473  KNLWTKYVDNDMEFLQTCNFGV  494



>ref|XP_010694564.1| PREDICTED: probable galacturonosyltransferase 9 [Beta vulgaris 
subsp. vulgaris]
Length=560

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  754  DPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGS  575
            +PKYLS+L+HLRFYLPEMYP LHRI+ LDDD+VVQ+DLT LW ID+DGKVNGAVETCFGS
Sbjct  357  NPKYLSMLSHLRFYLPEMYPDLHRIMLLDDDVVVQKDLTDLWNIDLDGKVNGAVETCFGS  416

Query  574  FHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLW  395
            FHRY+ Y+NFSHPLIR  FNPKACAWAYGMN FDLDAWR+EKCTE+YHYWQ LNE  TLW
Sbjct  417  FHRYSHYLNFSHPLIRENFNPKACAWAYGMNIFDLDAWRREKCTEQYHYWQNLNEESTLW  476

Query  394  KLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIA  215
            +LGTLP GL T+YS TK LDKSWH+LGLGYNPS+S DEI NAAVVHF+G+MKPWLDIA+ 
Sbjct  477  QLGTLPAGLATFYSKTKSLDKSWHILGLGYNPSVSMDEITNAAVVHFSGSMKPWLDIAMN  536

Query  214  QFRPLWTKYVDYENEYIQACNFGL  143
            Q++ LWTKYVD + E++Q CNFGL
Sbjct  537  QYKELWTKYVDNDMEFVQMCNFGL  560



>gb|KJB48243.1| hypothetical protein B456_008G059800 [Gossypium raimondii]
 gb|KJB48244.1| hypothetical protein B456_008G059800 [Gossypium raimondii]
Length=560

 Score =   363 bits (931),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  KYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFH  569
            +++S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+ GKVNGAVETCFGSFH
Sbjct  359  EHMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLSGKVNGAVETCFGSFH  418

Query  568  RYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKL  389
            R++QY+NFSHPLIR +FNPKACAWAYGMN FDLDAWR++KCTE YH WQ LN +R LWK 
Sbjct  419  RFSQYLNFSHPLIRERFNPKACAWAYGMNIFDLDAWRRKKCTETYHNWQNLNVDRALWKS  478

Query  388  GTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQF  209
            GTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS D INNAAV+H+NGNMKPWLDIA+ Q+
Sbjct  479  GTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDVINNAAVIHYNGNMKPWLDIAMNQY  538

Query  208  RPLWTKYVDYENEYIQACNFGL  143
            + LWTKYVD + E++Q CNFG+
Sbjct  539  KNLWTKYVDNDMEFLQTCNFGV  560



>gb|KJB10520.1| hypothetical protein B456_001G205700 [Gossypium raimondii]
Length=491

 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++P+ +S+LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETCFG
Sbjct  287  KNPESMSMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETCFG  346

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SF R++QY+NF+HPLI+ +FNPKACAWAYGMN FDLD WR+EKCTE Y  WQ LNE+RTL
Sbjct  347  SFRRFSQYLNFTHPLIKERFNPKACAWAYGMNIFDLDGWRREKCTETYEEWQNLNEDRTL  406

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKL  LPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  407  WKLDALPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAM  466

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFG+
Sbjct  467  NQYKNLWTKYVDNDMEFVQMCNFGV  491



>ref|XP_006593710.1| PREDICTED: probable galacturonosyltransferase 9-like [Glycine 
max]
Length=552

 Score =   362 bits (930),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++ K LS+L+HLRFYLPEMYPKL++IL LDDD+VVQ+DLTGLWKID+DGKVNGAVE CFG
Sbjct  348  KNAKSLSMLDHLRFYLPEMYPKLYKILLLDDDVVVQKDLTGLWKIDLDGKVNGAVEICFG  407

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+  FNPKACAWAYGMN F+LDAWR EKCT+ YHYWQ LNE++TL
Sbjct  408  SFHRYAQYLNFSHPLIKESFNPKACAWAYGMNIFNLDAWRHEKCTDNYHYWQNLNEDQTL  467

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W  GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDIA+
Sbjct  468  WTAGTLSPGLITFYSTTKTLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDIAL  527

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD   E++Q CNFGL
Sbjct  528  NQYKNLWTKYVDNNMEFVQMCNFGL  552



>ref|XP_007151434.1| hypothetical protein PHAVU_004G045900g [Phaseolus vulgaris]
 gb|ESW23428.1| hypothetical protein PHAVU_004G045900g [Phaseolus vulgaris]
Length=546

 Score =   362 bits (929),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++ K LS+++HLRFYLP+MYPKL++IL LD+D+VVQ+DLTGLWKID+DGKVNGAVE CFG
Sbjct  342  KNAKSLSMMDHLRFYLPDMYPKLYKILLLDEDVVVQKDLTGLWKIDLDGKVNGAVEICFG  401

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYA YMNFSHPLI+ KFNPKACAWAYGMN F+LDAWR+EKCT+ Y YWQ LNE++TL
Sbjct  402  SFHRYAHYMNFSHPLIKEKFNPKACAWAYGMNIFNLDAWRREKCTDNYQYWQNLNEDQTL  461

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK G LPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  462  WKAGPLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAL  521

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  522  NQYKNLWTKYVDNDMEFVQMCNFGL  546



>ref|XP_010549955.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549956.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549957.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Tarenaya 
hassleriana]
Length=557

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 188/206 (91%), Gaps = 1/206 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++ K+LS+LNHLRFYLPEMYPKL ++LFLDDD+VVQ+DLTGLWKI++DGKVNGAVETCFG
Sbjct  352  KNAKHLSMLNHLRFYLPEMYPKLRKMLFLDDDVVVQKDLTGLWKINLDGKVNGAVETCFG  411

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQAL-NENRT  401
            SFHRYAQY+NFSHPLI+  FNP +CAWA+GMN FDLDAWR+EKCTE+YHYWQ L NE+++
Sbjct  412  SFHRYAQYLNFSHPLIKESFNPNSCAWAFGMNIFDLDAWRREKCTEQYHYWQNLQNEDQS  471

Query  400  LWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIA  221
            LW++GTLPPGLIT+YS TK LDK+WHV+GLGYNPS+  DEI NAAV+H+NGNMKPWLDIA
Sbjct  472  LWRVGTLPPGLITFYSKTKSLDKAWHVMGLGYNPSVGMDEIRNAAVIHYNGNMKPWLDIA  531

Query  220  IAQFRPLWTKYVDYENEYIQACNFGL  143
            + Q++ LWTKYVD E E++Q CNFGL
Sbjct  532  MNQYKSLWTKYVDGEMEFVQMCNFGL  557



>gb|KHN02656.1| Putative galacturonosyltransferase 9 [Glycine soja]
Length=552

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++ K LS+L+HLRFYLPEMYPKL++IL LDDD+VVQ+DLTGLWKID+DGKVNGAVE CFG
Sbjct  348  KNAKSLSMLDHLRFYLPEMYPKLYKILLLDDDVVVQKDLTGLWKIDLDGKVNGAVEICFG  407

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+  FNPKACAWAYGMN F+LDAWR EKCT+ YHYWQ LNE++TL
Sbjct  408  SFHRYAQYLNFSHPLIKESFNPKACAWAYGMNIFNLDAWRHEKCTDNYHYWQNLNEDQTL  467

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W  GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDIA+
Sbjct  468  WTAGTLSPGLITFYSTTKTLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDIAL  527

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD   E++Q CNFGL
Sbjct  528  NQYKNLWTKYVDNNMEFVQMCNFGL  552



>ref|XP_006603944.1| PREDICTED: probable galacturonosyltransferase 9-like [Glycine 
max]
 gb|KHN30760.1| Putative galacturonosyltransferase 9 [Glycine soja]
Length=552

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++ K LS+L+HLRFYLPEMYP L++IL LDDD+VVQ+DLTGLWKID+DGKVNGAVE CFG
Sbjct  348  KNTKSLSMLDHLRFYLPEMYPNLYKILLLDDDVVVQKDLTGLWKIDLDGKVNGAVEICFG  407

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLI+  FNPK+CAWAYGMN F+LDAWR+EKCT+ YHYWQ LNE++TL
Sbjct  408  SFHRYAQYLNFSHPLIKESFNPKSCAWAYGMNIFNLDAWRREKCTDNYHYWQNLNEDQTL  467

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NG+MKPWLDIA+
Sbjct  468  WKAGTLSPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGDMKPWLDIAL  527

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  528  NQYKNLWTKYVDNDMEFVQMCNFGL  552



>ref|XP_002310951.2| hypothetical protein POPTR_0008s01050g [Populus trichocarpa]
 gb|EEE88318.2| hypothetical protein POPTR_0008s01050g [Populus trichocarpa]
Length=554

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  350  RNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  409

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY +Y+ F HPLI+  F+PKACAWAYGMN FDLD+WR++ CTE+YHYWQ LN NRTL
Sbjct  410  SFHRYDKYLKFDHPLIKETFDPKACAWAYGMNIFDLDSWRRDNCTEKYHYWQELNGNRTL  469

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W+LGTLPPGLIT+YSTTKPLDKSWHVLGLGYNP +S ++I NAAV+H+NG+ KPWL  AI
Sbjct  470  WRLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPGLSEEKIQNAAVIHYNGDSKPWLATAI  529

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             +++PLWTKYVDY+ E+ +ACNF 
Sbjct  530  PRYQPLWTKYVDYDLEFFRACNFA  553



>gb|KJB10519.1| hypothetical protein B456_001G205700 [Gossypium raimondii]
Length=557

 Score =   361 bits (926),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++P+ +S+LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETCFG
Sbjct  353  KNPESMSMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SF R++QY+NF+HPLI+ +FNPKACAWAYGMN FDLD WR+EKCTE Y  WQ LNE+RTL
Sbjct  413  SFRRFSQYLNFTHPLIKERFNPKACAWAYGMNIFDLDGWRREKCTETYEEWQNLNEDRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKL  LPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  473  WKLDALPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFG+
Sbjct  533  NQYKNLWTKYVDNDMEFVQMCNFGV  557



>ref|XP_011085570.1| PREDICTED: probable galacturonosyltransferase 9 [Sesamum indicum]
Length=557

 Score =   360 bits (925),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 186/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS LNHLRFYLPE+YP+LH+ILFLDDD+VVQ+DLT LWKIDMDGKVNGAV TCFG
Sbjct  353  RNPKYLSKLNHLRFYLPELYPRLHKILFLDDDVVVQKDLTALWKIDMDGKVNGAVNTCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
             FHR ++Y+NFSHPLI+ KFNP++CAWA+GMN FDLDAWR+EKCTE+YHYWQ LNE+RTL
Sbjct  413  PFHRLSEYLNFSHPLIKEKFNPRSCAWAFGMNMFDLDAWRREKCTEQYHYWQNLNEDRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLP GLIT+YSTTK LDK+WHVLGLG NPSIS +EI+ AAV+HF+G+MKPWLDIA+
Sbjct  473  WKLGTLPAGLITFYSTTKSLDKAWHVLGLGINPSISMEEIDKAAVIHFSGDMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
              ++ LWTKY+D E E++Q CNFG+
Sbjct  533  NHYKHLWTKYIDNEMEFLQMCNFGM  557



>ref|XP_011033002.1| PREDICTED: galacturonosyltransferase 8-like [Populus euphratica]
Length=554

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  350  RNPKYLSMLNHLRFYLPEMYPKLLKILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  409

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY +Y+ F HPLI+  F+PKACAWAYGMN FDLDAWR++ CTE+YHYWQ LN NRTL
Sbjct  410  SFHRYDKYLKFDHPLIKETFDPKACAWAYGMNIFDLDAWRRDNCTEKYHYWQELNGNRTL  469

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W+LGTLPPGLIT+YSTTKPLDKSWHVLGLGYNP +S ++I NAAV+H+NG+ KPWL  AI
Sbjct  470  WRLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPGLSEEKIQNAAVIHYNGDSKPWLATAI  529

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             +++PLWTKYVDY+ E+ +ACNF 
Sbjct  530  PRYQPLWTKYVDYDLEFFRACNFA  553



>gb|KHG26626.1| putative galacturonosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=559

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  748  KYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFH  569
            +++S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+ GKVNGAVETCFGSFH
Sbjct  358  EHMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLSGKVNGAVETCFGSFH  417

Query  568  RYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKL  389
            R++QY+NFSHPLIR +FN KACAWAYGMN FDLDAWR+EKCTE YH WQ LN +R LWK 
Sbjct  418  RFSQYLNFSHPLIRERFNHKACAWAYGMNIFDLDAWRREKCTETYHNWQNLNVDRALWKS  477

Query  388  GTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQF  209
            GTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS D INNAA++H+NGNMKPWLDIA+ Q+
Sbjct  478  GTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDVINNAALIHYNGNMKPWLDIAMNQY  537

Query  208  RPLWTKYVDYENEYIQACNFGL  143
            + LWTKYVD + E++Q CNFG+
Sbjct  538  KNLWTKYVDNDMEFLQTCNFGV  559



>ref|XP_004507267.1| PREDICTED: probable galacturonosyltransferase 9-like [Cicer arietinum]
Length=555

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++ KYLS+L++L+FYLPEMYPKL  IL LDDD+VVQ+DLTGLWKID+D KVNGAVE CFG
Sbjct  351  RNAKYLSMLDYLQFYLPEMYPKLRNILLLDDDVVVQKDLTGLWKIDLDDKVNGAVEICFG  410

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY+QY+NFSHPLI+  FNPKAC+W YGMN FDLDAWR++KCTE YHYWQ  NE++TL
Sbjct  411  SFHRYSQYLNFSHPLIKESFNPKACSWTYGMNIFDLDAWRRQKCTERYHYWQNKNEDQTL  470

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA+
Sbjct  471  WKSGTLAPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIAL  530

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD + E++Q CNFGL
Sbjct  531  NQYKNLWTKYVDSDMEFVQMCNFGL  555



>gb|EYU39355.1| hypothetical protein MIMGU_mgv1a003891mg [Erythranthe guttata]
Length=557

 Score =   355 bits (911),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YP L +ILFLDDD+VVQ+DLT LWKIDMDGKVNGAV TCFG
Sbjct  353  RNPKYLSMLNHLRFYLPELYPNLQKILFLDDDVVVQKDLTALWKIDMDGKVNGAVNTCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+++Y+NFSHPLI+ KFNP+ACAWA+GMN FDLDAWR EK T++YHYWQ LNE+RTL
Sbjct  413  SFHRFSEYLNFSHPLIKEKFNPRACAWAFGMNMFDLDAWRLEKSTDQYHYWQNLNEDRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WK+GTLP GL+T+YSTTK LDK+WHV GLG NPSIS +EI+ AAV+HF+G+MKPWLDIA+
Sbjct  473  WKMGTLPAGLVTFYSTTKSLDKAWHVQGLGINPSISMEEIDKAAVIHFSGDMKPWLDIAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             +++ LWTKYVD E E++Q CNFG+
Sbjct  533  NRYKHLWTKYVDNEMEFVQMCNFGM  557



>dbj|BAD94466.1| hypothetical protein [Arabidopsis thaliana]
Length=230

 Score =   343 bits (881),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  26   KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  85

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  86   SFHRYGQYLNFSHPLIKENFNPSACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  145

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NA V+H+NGNMKPWLDIA+
Sbjct  146  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAGVIHYNGNMKPWLDIAM  205

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  206  NQYKSLWTKYVDNEMEFVQMCNFGL  230



>gb|KFK37701.1| hypothetical protein AALP_AA3G017600 [Arabis alpina]
Length=560

 Score =   352 bits (904),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  356  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  415

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  416  SFHRYGQYLNFSHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  475

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDIA+
Sbjct  476  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDIAM  535

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKY+D E E++Q CNFGL
Sbjct  536  NQYKSLWTKYIDNEMEFVQMCNFGL  560



>ref|XP_011099072.1| PREDICTED: probable galacturonosyltransferase 9 [Sesamum indicum]
Length=557

 Score =   352 bits (903),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS++NHLRFYLPE+YPKL++ILFLDDD+VVQ+DLT LWKIDMDG VN AVETCFG
Sbjct  353  RNPKYLSMINHLRFYLPELYPKLNKILFLDDDVVVQKDLTALWKIDMDGNVNAAVETCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SF R+++Y+NFSHPLI++KFNP+ACAWA+GMN FDL+AWR+EKCTE+YHYWQ LNE+RTL
Sbjct  413  SFRRFSEYLNFSHPLIKQKFNPRACAWAFGMNMFDLEAWRREKCTEKYHYWQNLNEDRTL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLP GL T+YSTTK L+K+WHVLGLG NPSIS +EI+ AAV+HF+G+MKPWLDIA+
Sbjct  473  WKLGTLPAGLATFYSTTKSLEKAWHVLGLGINPSISMEEIDKAAVIHFSGDMKPWLDIAL  532

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
              ++ LWTKYVD E E++Q CNFG+
Sbjct  533  NGYKHLWTKYVDNEMEFLQMCNFGM  557



>ref|XP_010463640.1| PREDICTED: probable galacturonosyltransferase 9 [Camelina sativa]
Length=561

 Score =   352 bits (904),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  357  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  417  SFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  537  NQYKSLWTKYVDNEMEFVQMCNFGL  561



>gb|ABD96904.1| hypothetical protein [Cleome spinosa]
Length=528

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 181/207 (87%), Gaps = 3/207 (1%)
 Frame = -3

Query  754  DPKYLSILNHL---RFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  584
            +  Y+ +L  L   +FYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKI++DGKVNGAVETC
Sbjct  322  NSSYVPVLRQLESAKFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKINLDGKVNGAVETC  381

Query  583  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  404
            FGSFHRY+QY+NFSHPLI+  FNP ACAWA+GMN FDLDAWR+EKCTE+ H+WQ LNE +
Sbjct  382  FGSFHRYSQYLNFSHPLIKESFNPNACAWAFGMNIFDLDAWRREKCTEQLHHWQNLNEEQ  441

Query  403  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  224
             LW+LGTLPPGLIT+YS TK LDK+WHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDI
Sbjct  442  NLWRLGTLPPGLITFYSKTKSLDKTWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDI  501

Query  223  AIAQFRPLWTKYVDYENEYIQACNFGL  143
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  502  AMNQYKSLWTKYVDNEMEFVQMCNFGL  528



>gb|AHL38785.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=561

 Score =   352 bits (902),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  357  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  417  SFHRYGQYLNFSHPLIKENFNPSACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NA V+H+NGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAGVIHYNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  537  NQYKSLWTKYVDNEMEFVQMCNFGL  561



>gb|EPS65125.1| glycosyltransferase [Genlisea aurea]
Length=557

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKLH+ILFLDDD+VVQ+DLT LWKIDMDGKVN AV TCFG
Sbjct  353  RNPKYLSLLNHLRFYLPELYPKLHKILFLDDDVVVQKDLTDLWKIDMDGKVNAAVNTCFG  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR A+Y+NFSHPLI+ KFN ++CAWA+GMN FDLDAWR+EKCTEEYHYWQ  N+ R+L
Sbjct  413  SFHRLAEYLNFSHPLIKEKFNSRSCAWAFGMNMFDLDAWRREKCTEEYHYWQNKNQGRSL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLP GL+T+YS TK LDK+WH LGLG NPSIS +EI  AAV+HFNG+MKPWLDI +
Sbjct  473  WKLGTLPAGLVTFYSKTKALDKAWHALGLGINPSISMEEIKKAAVIHFNGDMKPWLDIGM  532

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
              ++  WTKYVD E E++Q CNFG+
Sbjct  533  NHYKQFWTKYVDNEMEFVQMCNFGM  557



>ref|NP_566170.1| putative galacturonosyltransferase 9 [Arabidopsis thaliana]
 sp|Q9FWA4.1|GAUT9_ARATH RecName: Full=Probable galacturonosyltransferase 9 [Arabidopsis 
thaliana]
 gb|AAG12603.1|AC068900_9 unknown protein; 9779-11709 [Arabidopsis thaliana]
 gb|AAL84957.1| AT3g02350/F11A12_103 [Arabidopsis thaliana]
 gb|AAM61096.1| glycosyl transferase, putative [Arabidopsis thaliana]
 gb|AAO42776.1| At3g02350/F11A12_103 [Arabidopsis thaliana]
 gb|AEE73795.1| putative galacturonosyltransferase 9 [Arabidopsis thaliana]
Length=561

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  357  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  417  SFHRYGQYLNFSHPLIKENFNPSACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NA V+H+NGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAGVIHYNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  537  NQYKSLWTKYVDNEMEFVQMCNFGL  561



>ref|XP_002882224.1| hypothetical protein ARALYDRAFT_477468 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58483.1| hypothetical protein ARALYDRAFT_477468 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  357  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  417  SFHRYGQYLNFSHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NA V+H+NGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAGVIHYNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  537  NQYKSLWTKYVDNEMEFVQMCNFGL  561



>ref|XP_006408424.1| hypothetical protein EUTSA_v10020416mg [Eutrema salsugineum]
 gb|ESQ49877.1| hypothetical protein EUTSA_v10020416mg [Eutrema salsugineum]
Length=561

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  357  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT +YHYWQ LNE+RTL
Sbjct  417  SFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTNQYHYWQNLNEDRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  537  NQYKSLWTKYVDNEMEFVQMCNFGL  561



>ref|XP_006297346.1| hypothetical protein CARUB_v10013365mg [Capsella rubella]
 gb|EOA30244.1| hypothetical protein CARUB_v10013365mg [Capsella rubella]
Length=561

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  357  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  F+P ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  417  SFHRYGQYLNFTHPLIKESFSPSACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  537  NQYKSLWTKYVDNEMEFVQMCNFGL  561



>ref|XP_008455575.1| PREDICTED: probable galacturonosyltransferase 9 [Cucumis melo]
 ref|XP_008455576.1| PREDICTED: probable galacturonosyltransferase 9 [Cucumis melo]
Length=550

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PK  S+LNHLRFYLPEM+PKL +I+FL+DD+VVQ+DLTGLWKID+DG+VNGAVETCFG
Sbjct  346  KNPKDTSLLNHLRFYLPEMFPKLQKIIFLEDDVVVQKDLTGLWKIDLDGRVNGAVETCFG  405

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+A Y+NFS+PLI+ KFN KACAW+YG+N FDLDAWR EKCTEEY+YWQ LNE+ +L
Sbjct  406  SFHRFAHYLNFSNPLIKEKFNAKACAWSYGINIFDLDAWRSEKCTEEYNYWQNLNEDGSL  465

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W  GTLPPGLIT+YS TK LD+SWHVLGLGYNPSIS D I+NAAV+H+NGNMKPWLDIA+
Sbjct  466  WSGGTLPPGLITFYSKTKSLDRSWHVLGLGYNPSISMDAISNAAVIHYNGNMKPWLDIAM  525

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++  WTKYVD + E++Q CNFGL
Sbjct  526  NQYKGFWTKYVDSDMEFVQVCNFGL  550



>ref|XP_009378304.1| PREDICTED: probable galacturonosyltransferase 9 [Pyrus x bretschneideri]
Length=561

 Score =   350 bits (898),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQ+D+TGLWKID+DGKVNGAVETCFG
Sbjct  357  RNPKYLSMLNHLRFYLPEMYPKLRKILFLDDDVVVQKDVTGLWKIDLDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRYAQY+NFSHPLIR +FN +ACAWAYGMN FDLDAWR EK TE+YHYWQ LNE+RTL
Sbjct  417  SFHRYAQYLNFSHPLIRERFNSRACAWAYGMNIFDLDAWRLEKSTEQYHYWQNLNEDRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPSISMDEIRKAAVIHYNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWT Y+D + E++Q CNFGL
Sbjct  537  NQYKKLWTNYLDNDMEFVQMCNFGL  561



>ref|XP_004137150.1| PREDICTED: probable galacturonosyltransferase 9-like [Cucumis 
sativus]
 ref|XP_004154733.1| PREDICTED: probable galacturonosyltransferase 9-like [Cucumis 
sativus]
 gb|KGN53749.1| hypothetical protein Csa_4G119780 [Cucumis sativus]
Length=550

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PK  S+L+HLRFYLPEM+PKL +I+FL+DD+VVQ+DLTGLWKID+DG+VNGAVETCFG
Sbjct  346  KNPKDTSLLSHLRFYLPEMFPKLQKIIFLEDDVVVQKDLTGLWKIDLDGRVNGAVETCFG  405

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+A Y+NFS+PLI+ KFN KACAW+YG+N FDLDAWR EKCTEEY+YWQ LNE+ +L
Sbjct  406  SFHRFAHYLNFSNPLIKEKFNAKACAWSYGINIFDLDAWRSEKCTEEYNYWQNLNEDASL  465

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W  GTLPPGLIT+YS TK LD+SWHVLGLGYNPSIS D I+NAAV+H+NGNMKPWLDIA+
Sbjct  466  WSGGTLPPGLITFYSKTKSLDRSWHVLGLGYNPSISMDAISNAAVIHYNGNMKPWLDIAM  525

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++  WTKYVD + E++Q CNFGL
Sbjct  526  NQYKGFWTKYVDSDMEFVQVCNFGL  550



>ref|XP_009134662.1| PREDICTED: probable galacturonosyltransferase 9 isoform X2 [Brassica 
rapa]
 ref|XP_009134664.1| PREDICTED: probable galacturonosyltransferase 9 isoform X2 [Brassica 
rapa]
Length=534

 Score =   348 bits (894),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  330  KNPKYLSVLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  389

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R+L
Sbjct  390  SFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRSL  449

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDIA+
Sbjct  450  WKLGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDIAM  509

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  510  NQYKSLWTKYVDNEMEFVQMCNFGL  534



>ref|XP_010476066.1| PREDICTED: probable galacturonosyltransferase 9 [Camelina sativa]
Length=561

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMY KL+++LFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  357  KNPKYLSMLNHLRFYLPEMYSKLNKVLFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  417  SFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  537  NQYKSLWTKYVDNEMEFVQMCNFGL  561



>emb|CDX91987.1| BnaC03g32890D [Brassica napus]
Length=544

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  340  KNPKYLSVLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  399

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R+L
Sbjct  400  SFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRSL  459

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDIA+
Sbjct  460  WKLGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDIAM  519

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  520  NQYKSLWTKYVDNEMEFVQMCNFGL  544



>ref|XP_009134660.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Brassica 
rapa]
 ref|XP_009134661.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Brassica 
rapa]
 ref|XP_009134663.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Brassica 
rapa]
Length=539

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  335  KNPKYLSVLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  394

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R+L
Sbjct  395  SFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRSL  454

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDIA+
Sbjct  455  WKLGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDIAM  514

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  515  NQYKSLWTKYVDNEMEFVQMCNFGL  539



>ref|XP_010485478.1| PREDICTED: probable galacturonosyltransferase 9 [Camelina sativa]
Length=561

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  357  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  416

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+H LI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  417  SFHRYGQYLNFTHLLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  476

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDIA+
Sbjct  477  WKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDIAM  536

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  537  NQYKSLWTKYVDNEMEFVQMCNFGL  561



>emb|CDX74263.1| BnaA03g27840D [Brassica napus]
Length=544

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  340  KNPKYLSVLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  399

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R+L
Sbjct  400  SFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRSL  459

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDIA+
Sbjct  460  WKLGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDIAM  519

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  520  NQYKSLWTKYVDNEMEFVQMCNFGL  544



>emb|CDY34723.1| BnaA01g33020D [Brassica napus]
Length=491

 Score =   346 bits (887),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  287  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  346

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+RTL
Sbjct  347  SFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDRTL  406

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W+LGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDIA+
Sbjct  407  WELGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDIAM  466

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  467  NQYKSLWTKYVDNEMEFVQMCNFGL  491



>emb|CDY00812.1| BnaCnng00120D [Brassica napus]
Length=460

 Score =   344 bits (883),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -3

Query  658  VVQRDLTGLWKIDMDGKVNGAVETCFGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNF  479
            V  +DLTGLW+IDMDGKVNGAVETCFGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNF
Sbjct  289  VFHKDLTGLWEIDMDGKVNGAVETCFGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNF  348

Query  478  FDLDAWRKEKCTEEYHYWQALNENRTLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNP  299
            FDLDAWRKEKCTEEYHYWQ LNENRTLWKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNP
Sbjct  349  FDLDAWRKEKCTEEYHYWQNLNENRTLWKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNP  408

Query  298  SISTDEINNAAVVHFNGNMKPWLDIAIAQFRPLWTKYVDYENEYIQACNFGL  143
            SIS DEI NAAVVHFNGNMKPWLDIA+ QFRPLWTK+VD++ E++QACNFGL
Sbjct  409  SISMDEIRNAAVVHFNGNMKPWLDIAMNQFRPLWTKHVDHDLEFVQACNFGL  460



>ref|XP_004304175.1| PREDICTED: probable galacturonosyltransferase 9 [Fragaria vesca 
subsp. vesca]
Length=542

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -3

Query  745  YLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHR  566
            Y S+L+ LRFY+PEMYPKL++ILFLDDD+VVQ+DLTGLW ID+DGKVNGAVETCFGSF R
Sbjct  342  YSSLLHELRFYMPEMYPKLNKILFLDDDVVVQKDLTGLWNIDLDGKVNGAVETCFGSFRR  401

Query  565  YAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLG  386
            YAQY+NFSHPLIR +FNP++CAWAYGMN FDLDAWR+E CTE+YH WQ LNEN+TL+K G
Sbjct  402  YAQYLNFSHPLIRERFNPRSCAWAYGMNIFDLDAWRQEGCTEQYHSWQNLNENQTLYKSG  461

Query  385  TLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  206
            T   GLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN AAV+H+NG+MKPWLDIA+ Q++
Sbjct  462  TSAAGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINKAAVIHYNGHMKPWLDIAMNQYK  521

Query  205  PLWTKYVDYENEYIQACNFGL  143
             LWTKY+D   E++Q CNFGL
Sbjct  522  NLWTKYMDNGMEFVQMCNFGL  542



>ref|XP_009117942.1| PREDICTED: probable galacturonosyltransferase 9 [Brassica rapa]
Length=551

 Score =   346 bits (888),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETCFG
Sbjct  347  KNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETCFG  406

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNENRTL
Sbjct  407  SFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNENRTL  466

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            W+LGTLPPGL+ +YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDIA+
Sbjct  467  WELGTLPPGLMAFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDIAM  526

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             Q++ LWTKYVD E E++Q CNFGL
Sbjct  527  NQYKSLWTKYVDNEMEFVQMCNFGL  551



>ref|XP_010326484.1| PREDICTED: LOW QUALITY PROTEIN: galacturonosyltransferase 8 [Solanum 
lycopersicum]
Length=510

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 182/222 (82%), Gaps = 12/222 (5%)
 Frame = -3

Query  745  YLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHR  566
            +LSI+NHL FYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETCFGSF+R
Sbjct  271  HLSIMNHLMFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETCFGSFYR  330

Query  565  YAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALN---------  413
            Y   M+FSHPLI+ KFNPKACAWA+GMNFFD +AWR+EK TEEYHY Q +          
Sbjct  331  YRXLMDFSHPLIKNKFNPKACAWAFGMNFFDFNAWRREKSTEEYHYLQNMVRCTTNILHI  390

Query  412  ENRTLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPW  233
            ENRTLW+LGTLPPGLIT+YSTTK LDKSWHVL   +NPS+S ++I N +VVHFNGNM+PW
Sbjct  391  ENRTLWRLGTLPPGLITFYSTTKVLDKSWHVLDPHFNPSVSMNDIGNVSVVHFNGNMRPW  450

Query  232  LDIAIAQFRPLWTKYVDYENEYIQACNFGL*VMVIVEALLRG  107
            LD AI +FRPLW+KYVD E   +  C + +  +V+VE +L G
Sbjct  451  LDNAINKFRPLWSKYVDKE---MSMCRYVISSLVMVEHMLDG  489



>ref|XP_009409999.1| PREDICTED: probable galacturonosyltransferase 9 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   323 bits (827),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 176/201 (88%), Gaps = 1/201 (0%)
 Frame = -3

Query  742  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  563
            LS+L+HLRFYLPEMYPKL RI+ L+DD+VVQ+DLTGLW++D+DG VNGAVETCFG F RY
Sbjct  319  LSMLDHLRFYLPEMYPKLRRIVLLEDDVVVQKDLTGLWRVDLDGMVNGAVETCFGGFRRY  378

Query  562  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWK-LG  386
            ++Y+NFS P +R +F+P+ACAWAYG+N FDLDAWR+E+CT+ +H +Q+LNE+ TLW    
Sbjct  379  SRYLNFSIPQVRDQFSPRACAWAYGVNVFDLDAWRRERCTDRFHQYQSLNEDGTLWNPAS  438

Query  385  TLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  206
             LP GL+T+Y+TTKPLDK+WHV+GLGYNPS+S DEI NAAV+HF+GNMKPWLD+A+ Q++
Sbjct  439  VLPAGLVTFYTTTKPLDKTWHVMGLGYNPSVSPDEIRNAAVIHFDGNMKPWLDVALNQYK  498

Query  205  PLWTKYVDYENEYIQACNFGL  143
             LWTKYVD E +++Q CNFG+
Sbjct  499  HLWTKYVDTEMDFLQLCNFGI  519



>ref|NP_001131608.1| uncharacterized protein LOC100192958 [Zea mays]
 gb|ACF80095.1| unknown [Zea mays]
Length=228

 Score =   313 bits (801),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  24   RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  83

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  84   SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDRVL  143

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++A+
Sbjct  144  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAM  203

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ YI+ CN  
Sbjct  204  TKYRPYWTKYIKYDHPYIRGCNLS  227



>gb|AFW67949.1| hypothetical protein ZEAMMB73_846223 [Zea mays]
Length=269

 Score =   313 bits (803),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  65   RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  124

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  125  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  184

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  185  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTVERSEIDNAAVIHYNGNMKPWLEIAM  244

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++YE+ YI  C F 
Sbjct  245  TKYRPYWTKYINYEHPYIHGCKFS  268



>gb|AFW67950.1| hypothetical protein ZEAMMB73_846223 [Zea mays]
Length=399

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  195  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  254

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  255  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  314

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  315  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTVERSEIDNAAVIHYNGNMKPWLEIAM  374

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++YE+ YI  C F 
Sbjct  375  TKYRPYWTKYINYEHPYIHGCKFS  398



>ref|XP_010937117.1| PREDICTED: probable galacturonosyltransferase 9 [Elaeis guineensis]
Length=533

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = -3

Query  742  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  563
            LS+L++LRFYLPEMYP L R++FL+DD+VVQ+DL GLW++D+DGKVNGAVE CFG F RY
Sbjct  333  LSLLHYLRFYLPEMYPSLQRVVFLEDDVVVQKDLAGLWRVDLDGKVNGAVEMCFGGFRRY  392

Query  562  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLGT  383
             +YMNFSHP++R +F P+ACAW+YG+N FDLDAWR+E+CTE++H +Q LNE+  +W  GT
Sbjct  393  NRYMNFSHPVVRERFTPRACAWSYGVNVFDLDAWRRERCTEKFHEYQDLNEDGMIWNPGT  452

Query  382  -LPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  206
             LP GL+T+Y+TTKPLDKSWHV+GLGYNPSIS+D I NAAVVHFNG+MKPWLD+A+ Q++
Sbjct  453  VLPAGLMTFYTTTKPLDKSWHVMGLGYNPSISSDAIRNAAVVHFNGHMKPWLDVALNQYK  512

Query  205  PLWTKYVDYENEYIQACNFGL  143
             LWTKYVD E E++  CNFGL
Sbjct  513  HLWTKYVDTEMEFLPLCNFGL  533



>gb|AFW67951.1| hypothetical protein ZEAMMB73_846223 [Zea mays]
Length=507

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  303  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  362

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  363  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  422

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  423  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTVERSEIDNAAVIHYNGNMKPWLEIAM  482

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++YE+ YI  C F 
Sbjct  483  TKYRPYWTKYINYEHPYIHGCKFS  506



>ref|XP_008802618.1| PREDICTED: probable galacturonosyltransferase 9 [Phoenix dactylifera]
Length=536

 Score =   320 bits (821),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 179/201 (89%), Gaps = 1/201 (0%)
 Frame = -3

Query  742  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  563
            L++L++LRFYLPEMYP+L R++FL+DD+VVQ+DL GLW++D+DGKVNGAVE CFGSF RY
Sbjct  336  LALLDYLRFYLPEMYPRLRRVVFLEDDLVVQKDLAGLWRVDLDGKVNGAVEMCFGSFRRY  395

Query  562  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLGT  383
             +YMNFSHP+++ +F+P+ACAWAYG+N FDLDAWR+++CTE++H +Q LNE+  LW   T
Sbjct  396  NRYMNFSHPVVQERFSPRACAWAYGVNVFDLDAWRRDRCTEQFHQYQDLNEDGMLWNPET  455

Query  382  -LPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  206
             LP GL+T+Y+TTKPLDKSWHV+GLGYNP++S DEI+NAAV+HFNGNMKPWLD+A+ Q++
Sbjct  456  VLPAGLMTFYTTTKPLDKSWHVMGLGYNPNVSPDEIHNAAVIHFNGNMKPWLDVALNQYK  515

Query  205  PLWTKYVDYENEYIQACNFGL  143
             LWTKYVD E +++Q CNFGL
Sbjct  516  HLWTKYVDTEMQFLQLCNFGL  536



>gb|ACF78990.1| unknown [Zea mays]
 tpg|DAA50752.1| TPA: hypothetical protein ZEAMMB73_194342 [Zea mays]
Length=291

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  87   RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  146

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  147  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  206

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  207  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEIAM  266

Query  217  AQFRPLWTKYVDYENEYIQAC  155
             ++RP WTKY++Y++ YI  C
Sbjct  267  IKYRPYWTKYINYQHSYIHGC  287



>ref|XP_006657336.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Oryza brachyantha]
Length=584

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC  
Sbjct  380  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETCGE  439

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  440  SFHRFDKYLNFSNPNIARNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  499

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  500  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIERSEIDNAAVIHYNGNMKPWLEIAM  559

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++YE+ Y++ C   
Sbjct  560  TKYRPYWTKYINYEHTYVRGCKIS  583



>ref|NP_001169332.1| hypothetical protein precursor [Zea mays]
 gb|ACN33451.1| unknown [Zea mays]
 gb|AFW67952.1| hypothetical protein ZEAMMB73_846223 [Zea mays]
Length=590

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  386  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  445

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  446  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  505

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  506  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTVERSEIDNAAVIHYNGNMKPWLEIAM  565

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++YE+ YI  C F 
Sbjct  566  TKYRPYWTKYINYEHPYIHGCKFS  589



>ref|XP_008650863.1| PREDICTED: uncharacterized protein LOC100192958 isoform X3 [Zea 
mays]
Length=608

 Score =   321 bits (823),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  404  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  463

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  464  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDRVL  523

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++A+
Sbjct  524  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAM  583

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ YI+ CN  
Sbjct  584  TKYRPYWTKYIKYDHPYIRGCNLS  607



>gb|EEC81302.1| hypothetical protein OsI_24438 [Oryza sativa Indica Group]
 gb|EEE66344.1| hypothetical protein OsJ_22634 [Oryza sativa Japonica Group]
Length=588

 Score =   320 bits (821),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC  
Sbjct  384  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETCGE  443

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  444  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  503

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  504  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIERSEIDNAAVIHYNGNMKPWLEIAM  563

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
            +++RP WTKY++YE+ Y++ C   
Sbjct  564  SKYRPYWTKYINYEHTYVRGCKIS  587



>ref|XP_008784292.1| PREDICTED: probable galacturonosyltransferase 9 [Phoenix dactylifera]
Length=531

 Score =   318 bits (816),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 174/201 (87%), Gaps = 1/201 (0%)
 Frame = -3

Query  742  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  563
            LS+L++LRFYLPEMYP L R++FL+DD+VVQ+DL GLW++D+DGK NGAVE CFG F RY
Sbjct  331  LSLLHYLRFYLPEMYPSLQRVVFLEDDVVVQKDLAGLWRVDLDGKANGAVEMCFGGFRRY  390

Query  562  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLGT  383
            ++YMNFSHP+IR +F+P+ACAWAYG+N FDLDAWR+E+ TE++H +Q LNE+  +W  GT
Sbjct  391  SRYMNFSHPVIRERFSPRACAWAYGVNVFDLDAWRRERSTEKFHEYQDLNEDGIIWNPGT  450

Query  382  -LPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  206
             LP GL+T+Y+TTKPL+KSWHV GLGYNPSIS DEI NAAV+HFNG+MKPWLD+A+ Q++
Sbjct  451  VLPAGLMTFYTTTKPLEKSWHVTGLGYNPSISLDEIRNAAVIHFNGHMKPWLDVALNQYK  510

Query  205  PLWTKYVDYENEYIQACNFGL  143
             LWTKYVD E E++  CNFGL
Sbjct  511  HLWTKYVDTEMEFLPLCNFGL  531



>ref|XP_008671920.1| PREDICTED: uncharacterized protein LOC100191781 isoform X1 [Zea 
mays]
Length=553

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  349  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  408

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  409  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  468

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  469  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEIAM  528

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++Y++ YI  C   
Sbjct  529  IKYRPYWTKYINYQHSYIHGCKIS  552



>ref|XP_001785716.1| predicted protein [Physcomitrella patens]
 gb|EDQ49475.1| predicted protein [Physcomitrella patens]
Length=228

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE++PKL +ILFLDDDIVVQ+DLT LW ID++G VNGAVETC  
Sbjct  24   RNPKYLSMLNHLRFYLPEVFPKLDKILFLDDDIVVQKDLTPLWDIDLNGNVNGAVETCGA  83

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+PLI   F+P AC WAYGMN FDL  W+KE  T  YH WQ+LNE+RTL
Sbjct  84   SFHRFDKYLNFSNPLISENFDPNACGWAYGMNVFDLKQWKKEDITGIYHRWQSLNEDRTL  143

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T+PL+KSWHVLGLGYNP+I   EI  AAV+H+NGNMKPWL+I +
Sbjct  144  WKLGTLPPGLITFYNLTQPLEKSWHVLGLGYNPAIEESEIETAAVIHWNGNMKPWLEIGM  203

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             +F+P WTK+V Y + ++Q CN 
Sbjct  204  VKFKPYWTKFVKYNHPFLQQCNI  226



>ref|XP_010939506.1| PREDICTED: probable galacturonosyltransferase 9 [Elaeis guineensis]
Length=536

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 176/201 (88%), Gaps = 1/201 (0%)
 Frame = -3

Query  742  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  563
            L++L++LRFYLPEMYP+L R++FL+DD+VVQ+DL GLW++D+DGKVNGAVE CFG F RY
Sbjct  336  LALLDNLRFYLPEMYPRLRRVVFLEDDVVVQKDLAGLWRVDLDGKVNGAVEMCFGGFRRY  395

Query  562  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLGT  383
             +YMNFSHP+++ +F+P+ACAWAYG+N FDLDAWR+E+CTE++H +Q LNE+  LW  GT
Sbjct  396  GRYMNFSHPVVQERFSPRACAWAYGVNVFDLDAWRRERCTEQFHEYQDLNEDGMLWNPGT  455

Query  382  -LPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  206
             LP GL+T+ +TTKPLDKSWHV+GLGYNPSIS ++I NAAV+HFNGNMKPWLD+A+ Q++
Sbjct  456  VLPAGLMTFSTTTKPLDKSWHVMGLGYNPSISPEKILNAAVIHFNGNMKPWLDVALNQYK  515

Query  205  PLWTKYVDYENEYIQACNFGL  143
             LWTKYVD E +++  CNFGL
Sbjct  516  HLWTKYVDTEMQFLPLCNFGL  536



>ref|XP_008650862.1| PREDICTED: uncharacterized protein LOC100192958 isoform X2 [Zea 
mays]
 tpg|DAA62449.1| TPA: hypothetical protein ZEAMMB73_004043 [Zea mays]
Length=683

 Score =   321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  479  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  538

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  539  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDRVL  598

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++A+
Sbjct  599  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAM  658

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ YI+ CN  
Sbjct  659  TKYRPYWTKYIKYDHPYIRGCNLS  682



>gb|EEC84934.1| hypothetical protein OsI_32147 [Oryza sativa Indica Group]
Length=695

 Score =   322 bits (824),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  491  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  550

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ++NE+R L
Sbjct  551  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQSMNEDRVL  610

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++A+
Sbjct  611  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAM  670

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WT+Y+ Y++ YI+ CN  
Sbjct  671  TKYRPYWTRYIKYDHPYIRGCNLA  694



>ref|XP_004982129.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Setaria italica]
Length=589

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  385  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  444

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+++  T  YH WQ +NENR L
Sbjct  445  SFHRFDKYLNFSNPNISQNFDPNACGWAYGMNMFDLEEWKRKDITGIYHKWQNMNENRLL  504

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  505  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEIAM  564

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++YE+ YI  C   
Sbjct  565  TKYRPYWTKYINYEHPYIHGCKIS  588



>ref|NP_001063757.1| Os09g0531900 [Oryza sativa Japonica Group]
 dbj|BAD46018.1| glycosyl transferase family 8 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD46265.1| glycosyl transferase family 8 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF25671.1| Os09g0531900 [Oryza sativa Japonica Group]
 gb|EEE70102.1| hypothetical protein OsJ_30110 [Oryza sativa Japonica Group]
Length=695

 Score =   321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  491  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  550

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ++NE+R L
Sbjct  551  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQSMNEDRVL  610

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++A+
Sbjct  611  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAM  670

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WT+Y+ Y++ YI+ CN  
Sbjct  671  TKYRPYWTRYIKYDHPYIRGCNLA  694



>ref|NP_001130678.1| uncharacterized protein LOC100191781 precursor [Zea mays]
 gb|ACF78549.1| unknown [Zea mays]
 tpg|DAA50751.1| TPA: hypothetical protein ZEAMMB73_194342 [Zea mays]
Length=588

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  384  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  443

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  444  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  503

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  504  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEIAM  563

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++Y++ YI  C   
Sbjct  564  IKYRPYWTKYINYQHSYIHGCKIS  587



>tpg|DAA50750.1| TPA: hypothetical protein ZEAMMB73_194342 [Zea mays]
Length=593

 Score =   318 bits (815),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  389  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  448

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  449  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  508

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  509  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEIAM  568

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++Y++ YI  C   
Sbjct  569  IKYRPYWTKYINYQHSYIHGCKIS  592



>ref|XP_002466644.1| hypothetical protein SORBIDRAFT_01g011560 [Sorghum bicolor]
 gb|EER93642.1| hypothetical protein SORBIDRAFT_01g011560 [Sorghum bicolor]
Length=588

 Score =   317 bits (813),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC  
Sbjct  384  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETCGE  443

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+ +  T  YH WQ +NENR L
Sbjct  444  SFHRFDKYLNFSNPNISQNFDPNACGWAYGMNMFDLEEWKNKDITGIYHKWQNMNENRLL  503

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  504  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEIAM  563

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++YE+ YI  C   
Sbjct  564  TKYRPYWTKYINYEHPYIHGCKIS  587



>ref|XP_006660882.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Oryza brachyantha]
Length=693

 Score =   320 bits (820),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  489  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  548

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  549  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHRWQNMNEDRVL  608

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++A+
Sbjct  609  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAM  668

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WT+Y+ Y++ YI+ CN  
Sbjct  669  TKYRPYWTRYIKYDHPYIRGCNLA  692



>ref|XP_008650861.1| PREDICTED: uncharacterized protein LOC100192958 isoform X1 [Zea 
mays]
Length=725

 Score =   321 bits (822),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  521  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  580

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  581  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDRVL  640

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++A+
Sbjct  641  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAM  700

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ YI+ CN  
Sbjct  701  TKYRPYWTKYIKYDHPYIRGCNLS  724



>ref|XP_002462717.1| hypothetical protein SORBIDRAFT_02g030820 [Sorghum bicolor]
 gb|EER99238.1| hypothetical protein SORBIDRAFT_02g030820 [Sorghum bicolor]
Length=683

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  479  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  538

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ LNE+R L
Sbjct  539  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNLNEDRAL  598

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI++AAVVH+NGNMKPWL++A+
Sbjct  599  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDSAAVVHYNGNMKPWLELAM  658

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ YI+ CN  
Sbjct  659  TKYRPYWTKYIKYDHPYIRGCNLS  682



>emb|CDX71763.1| BnaC08g31110D [Brassica napus]
Length=673

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  469  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  528

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  529  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  588

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++A+
Sbjct  589  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLELAM  648

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  649  SKYRPYWTKYIKFDHPYLRRCNL  671



>emb|CDY52336.1| BnaA09g38850D [Brassica napus]
Length=671

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  467  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  526

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  527  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  586

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++A+
Sbjct  587  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLELAM  646

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  647  SKYRPYWTKYIKFDHPYLRRCNL  669



>ref|XP_009116771.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Brassica rapa]
Length=671

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  467  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  526

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  527  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  586

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++A+
Sbjct  587  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLELAM  646

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  647  SKYRPYWTKYIKFDHPYLRRCNL  669



>ref|XP_010523706.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Tarenaya hassleriana]
Length=682

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLT LW++D+ GKVNGAVETC  
Sbjct  478  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTPLWEVDLKGKVNGAVETCGE  537

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  538  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  597

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI   EI NAAV+H+NGNMKPWL++A+
Sbjct  598  WKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIDKKEIENAAVIHYNGNMKPWLELAM  657

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
            +++RP WTKY+ Y++ Y++ CN  
Sbjct  658  SKYRPYWTKYIKYDHPYVRRCNLS  681



>ref|XP_009381434.1| PREDICTED: probable galacturonosyltransferase 9 [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   313 bits (803),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 172/201 (86%), Gaps = 1/201 (0%)
 Frame = -3

Query  742  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  563
            LS+LNHLRFYLPEMYPKL RI+ L+DD+VVQ+DL  LW++DMDGKVNGAVETCFG F RY
Sbjct  315  LSVLNHLRFYLPEMYPKLRRIVLLEDDVVVQKDLAQLWRLDMDGKVNGAVETCFGGFRRY  374

Query  562  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLGT  383
            ++Y+NFS+  IR +F+P+ CAWAYG+N FDL AWR+E CTE++H +Q +NE+ TLW   +
Sbjct  375  SRYLNFSNHEIRDRFSPRTCAWAYGVNVFDLGAWRREGCTEQFHQYQRMNEDGTLWNPSS  434

Query  382  -LPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  206
             L  GL+T+Y+TTKPLDK+WHV+GLGYNPS+S DEI NAAV+HF+GNMKPWLD+A+ Q++
Sbjct  435  VLSAGLVTFYTTTKPLDKNWHVMGLGYNPSVSVDEIQNAAVIHFDGNMKPWLDVALNQYK  494

Query  205  PLWTKYVDYENEYIQACNFGL  143
             LWTKYVD E +++Q CNFGL
Sbjct  495  HLWTKYVDTEMDFLQLCNFGL  515



>gb|EMS50352.1| Alpha-1,4-galacturonosyltransferase 1 [Triticum urartu]
Length=507

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC  
Sbjct  303  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETCGE  362

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  363  SFHRFDKYLNFSNPNISQNFDPNACGWAYGMNIFDLEEWKKKDITGIYHKWQNMNENRLL  422

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+ AAV+H+NGNMKPWL+IA+
Sbjct  423  WKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPTVEHAEIDTAAVIHYNGNMKPWLEIAM  482

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WT+Y++YE+ Y++ C   
Sbjct  483  TKYRPYWTQYINYEHSYVRGCKIS  506



>ref|XP_006375320.1| hypothetical protein POPTR_0014s06970g [Populus trichocarpa]
 gb|ERP53117.1| hypothetical protein POPTR_0014s06970g [Populus trichocarpa]
Length=468

 Score =   311 bits (797),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLT LW +D++GKVNGAVETC  
Sbjct  264  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTKLWSVDLNGKVNGAVETCGE  323

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P +C WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  324  SFHRFDKYLNFSNPHIARHFDPNSCGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDRVL  383

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T PL KSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL++A+
Sbjct  384  WKLGTLPPGLITFYNLTHPLQKSWHVLGLGYNPSIDRSEIENAAVVHYNGNMKPWLELAM  443

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ Y++ CN  
Sbjct  444  TKYRPYWTKYIKYDHPYLRNCNLS  467



>dbj|BAJ99110.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=591

 Score =   315 bits (807),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC  
Sbjct  387  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETCGE  446

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  447  SFHRFDKYLNFSNPNISQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  506

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+ AAV+H+NGNMKPWL+IA+
Sbjct  507  WKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPTVEHAEIDTAAVIHYNGNMKPWLEIAM  566

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY++YE+ Y++ C   
Sbjct  567  TKYRPYWTKYINYEHSYVRGCKIS  590



>ref|XP_003578496.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Brachypodium distachyon]
Length=691

 Score =   318 bits (814),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  487  RNPKYLSMLNHLRFYLPQIYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  546

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+ +  T  YH WQ +NE+R L
Sbjct  547  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKQWKNKDITGIYHRWQNMNEDRVL  606

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++A+
Sbjct  607  WKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLELAM  666

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WT+Y+ Y++ YI+ CN  
Sbjct  667  TKYRPYWTRYIKYDHPYIRGCNLS  690



>ref|XP_008670350.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X5 [Zea mays]
 ref|XP_008670351.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X5 [Zea mays]
Length=557

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC  
Sbjct  353  RNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETCGE  412

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R L
Sbjct  413  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGRVL  472

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++A+
Sbjct  473  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLELAM  532

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++RP WT+Y+ Y++ YI+ CN 
Sbjct  533  TKYRPYWTRYIKYDHPYIRGCNL  555



>ref|XP_004957448.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Setaria italica]
Length=682

 Score =   317 bits (812),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  478  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETCGE  537

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  538  SFHRFDKYLNFSNPHIAQNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDRVL  597

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+ AAVVH+NGNMKPWL++A+
Sbjct  598  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDGAAVVHYNGNMKPWLELAM  657

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ YI+ CN  
Sbjct  658  TKYRPYWTKYIKYDHPYIRGCNLS  681



>ref|XP_002320745.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
 gb|EEE99060.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
Length=520

 Score =   312 bits (800),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLT LW +D++GKVNGAVETC  
Sbjct  316  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTKLWSVDLNGKVNGAVETCGE  375

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P +C WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  376  SFHRFDKYLNFSNPHIARHFDPNSCGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDRVL  435

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T PL KSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL++A+
Sbjct  436  WKLGTLPPGLITFYNLTHPLQKSWHVLGLGYNPSIDRSEIENAAVVHYNGNMKPWLELAM  495

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ Y++ CN  
Sbjct  496  TKYRPYWTKYIKYDHPYLRNCNLS  519



>ref|XP_010231443.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Brachypodium distachyon]
Length=589

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC  
Sbjct  385  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETCGE  444

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  445  SFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENRLL  504

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI++AAV+H+NGNMKPWL+IA+
Sbjct  505  WKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPTVEHSEIDSAAVIHYNGNMKPWLEIAM  564

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WT+Y++YE+ Y++ C   
Sbjct  565  TKYRPYWTRYINYEHSYVRGCKIS  588



>ref|XP_006828896.1| hypothetical protein AMTR_s00001p00190810 [Amborella trichopoda]
 gb|ERM96312.1| hypothetical protein AMTR_s00001p00190810 [Amborella trichopoda]
Length=684

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  480  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWLVDLHGKVNGAVETCGE  539

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL AW+K+  T  YH WQ +NE+RTL
Sbjct  540  SFHRFDKYLNFSNPRISRNFDPYACGWAYGMNVFDLIAWKKKDITGIYHKWQNMNEDRTL  599

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI NAAV+HFNGNMKPWL++A+
Sbjct  600  WKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSVDKSEIENAAVIHFNGNMKPWLELAM  659

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             +++P WTKY+ Y++ YI  CN  
Sbjct  660  TKYKPYWTKYIKYDHPYITRCNLS  683



>ref|XP_010512443.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Camelina sativa]
Length=676

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  472  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  531

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  532  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  591

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  592  WKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLELAM  651

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  652  SKYRPYWTKYIKFDHPYLRRCNL  674



>emb|CDY42486.1| BnaC04g21950D [Brassica napus]
Length=670

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  466  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  525

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  526  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  585

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++A+
Sbjct  586  WKLGTLPPGLITFYELTHPLNKAWHVLGLGYNPSIAKKDIENAAVVHYNGNMKPWLELAM  645

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  646  SKYRPYWTKYIQFDHPYLRRCNL  668



>ref|XP_010512445.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X3 [Camelina sativa]
Length=674

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  470  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  529

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  530  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  589

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  590  WKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLELAM  649

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  650  SKYRPYWTKYIKFDHPYLRRCNL  672



>emb|CDX89098.1| BnaA04g00880D [Brassica napus]
Length=671

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  467  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  526

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  527  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  586

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++A+
Sbjct  587  WKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIAKKDIENAAVVHYNGNMKPWLELAM  646

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  647  SKYRPYWTKYIQFDHPYLRRCNL  669



>ref|XP_010469034.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Camelina sativa]
Length=673

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  469  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  528

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  529  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  588

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  589  WKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLELAM  648

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  649  SKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_010512446.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X4 [Camelina sativa]
Length=673

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  469  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  528

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  529  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  588

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  589  WKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLELAM  648

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  649  SKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_010272612.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nelumbo nucifera]
 ref|XP_010272613.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nelumbo nucifera]
Length=682

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  478  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETCGE  537

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NE R L
Sbjct  538  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNIFDLKEWKKRDITGIYHKWQNMNEERVL  597

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPSI   EI NAAV+H+NGNMKPWL+IA+
Sbjct  598  WKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSIDRSEIENAAVIHYNGNMKPWLEIAM  657

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WT+Y+ Y++ Y++ CN  
Sbjct  658  TKYRPYWTRYIKYDHPYLRNCNLS  681



>ref|XP_011460082.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=644

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPE++PKL+++LFLDDDIVV++DLTGLW +D+ G VNGAVETC  
Sbjct  440  RNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVRKDLTGLWSLDLKGNVNGAVETCGE  499

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+PLI + F+P AC WAYGMN FDL+ W+K+  TE YH WQ LN +R L
Sbjct  500  SFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLEQWKKQNITEVYHRWQKLNHDRQL  559

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT++  T PLD+SWHVLGLGYNPS+S  EI+ AAV+H+NGNMKPWL+I I
Sbjct  560  WKLGTLPPGLITFWKHTYPLDRSWHVLGLGYNPSVSQKEIDRAAVIHYNGNMKPWLEIGI  619

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  W KYVDY+++Y++ CN  
Sbjct  620  PKYRSYWAKYVDYDHKYMRECNIN  643



>ref|XP_010512444.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Camelina sativa]
Length=675

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  471  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  530

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  531  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  590

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  591  WKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLELAM  650

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  651  SKYRPYWTKYIKFDHPYLRRCNL  673



>ref|XP_011460081.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=647

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPE++PKL+++LFLDDDIVV++DLTGLW +D+ G VNGAVETC  
Sbjct  443  RNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVRKDLTGLWSLDLKGNVNGAVETCGE  502

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+PLI + F+P AC WAYGMN FDL+ W+K+  TE YH WQ LN +R L
Sbjct  503  SFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLEQWKKQNITEVYHRWQKLNHDRQL  562

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT++  T PLD+SWHVLGLGYNPS+S  EI+ AAV+H+NGNMKPWL+I I
Sbjct  563  WKLGTLPPGLITFWKHTYPLDRSWHVLGLGYNPSVSQKEIDRAAVIHYNGNMKPWLEIGI  622

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  W KYVDY+++Y++ CN  
Sbjct  623  PKYRSYWAKYVDYDHKYMRECNIN  646



>ref|XP_008670348.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X4 [Zea mays]
 ref|XP_008670349.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X4 [Zea mays]
Length=606

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC  
Sbjct  402  RNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETCGE  461

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R L
Sbjct  462  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGRVL  521

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++A+
Sbjct  522  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLELAM  581

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++RP WT+Y+ Y++ YI+ CN 
Sbjct  582  TKYRPYWTRYIKYDHPYIRGCNL  604



>ref|XP_010413456.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Camelina sativa]
Length=673

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  469  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  528

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  529  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  588

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  589  WKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLELAM  648

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  649  SKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_011460080.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=648

 Score =   315 bits (808),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPE++PKL+++LFLDDDIVV++DLTGLW +D+ G VNGAVETC  
Sbjct  444  RNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVRKDLTGLWSLDLKGNVNGAVETCGE  503

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+PLI + F+P AC WAYGMN FDL+ W+K+  TE YH WQ LN +R L
Sbjct  504  SFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLEQWKKQNITEVYHRWQKLNHDRQL  563

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT++  T PLD+SWHVLGLGYNPS+S  EI+ AAV+H+NGNMKPWL+I I
Sbjct  564  WKLGTLPPGLITFWKHTYPLDRSWHVLGLGYNPSVSQKEIDRAAVIHYNGNMKPWLEIGI  623

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  W KYVDY+++Y++ CN  
Sbjct  624  PKYRSYWAKYVDYDHKYMRECNIN  647



>gb|EMT14751.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=587

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC  
Sbjct  383  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETCGE  442

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR L
Sbjct  443  SFHRFDKYLNFSNPNISQNFDPNACGWAYGMNIFDLEEWKKKDITGIYHKWQNMNENRLL  502

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+ AAV+H+NGNMKPWL+IA+
Sbjct  503  WKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPTVEHAEIDTAAVIHYNGNMKPWLEIAM  562

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WT+Y++YE+ Y++ C   
Sbjct  563  TKYRPYWTQYINYEHSYVRGCKIS  586



>ref|XP_008670347.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X3 [Zea mays]
Length=624

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC  
Sbjct  420  RNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETCGE  479

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R L
Sbjct  480  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGRVL  539

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++A+
Sbjct  540  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLELAM  599

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++RP WT+Y+ Y++ YI+ CN 
Sbjct  600  TKYRPYWTRYIKYDHPYIRGCNL  622



>ref|XP_006339506.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Solanum tuberosum]
Length=688

 Score =   316 bits (809),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  484  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETCGQ  543

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  544  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKQDITGIYHKWQNMNEDRVL  603

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  604  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDRSDIENAAVVHYNGNMKPWLELAM  663

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ +++ Y+++C   
Sbjct  664  TKYRPYWTKYIKFDHPYMRSCKLS  687



>ref|XP_002962728.1| GAUT1, alpha-1,4-galaturonosyltransferase-like protein [Selaginella 
moellendorffii]
 gb|EFJ36191.1| GAUT1, alpha-1,4-galaturonosyltransferase-like protein [Selaginella 
moellendorffii]
Length=533

 Score =   311 bits (797),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW ID+ GKVNGAVETC  
Sbjct  329  RNPKYLSMLNHLRFYLPQIYPKLDKILFLDDDIVVQKDLTGLWSIDLQGKVNGAVETCGA  388

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W++   T  YH WQ +NE+R L
Sbjct  389  SFHRFDKYLNFSNPHIARNFNPDACGWAYGMNVFDLKEWKRRDITGIYHKWQNMNEDRLL  448

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T PLDKSWHVLGLGYNPSI   +++ AAVVH+NGN+KPWLDI +
Sbjct  449  WKLGTLPPGLITFYNLTHPLDKSWHVLGLGYNPSIDKADMDAAAVVHYNGNLKPWLDIGL  508

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
            ++++  WT+YV Y++ Y+Q CN  
Sbjct  509  SRYKSYWTRYVSYDHPYLQQCNIN  532



>ref|XP_001779123.1| predicted protein [Physcomitrella patens]
 gb|EDQ56069.1| predicted protein, partial [Physcomitrella patens]
Length=516

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW ID+ G VNGAVETC  
Sbjct  312  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDIDLKGNVNGAVETCGP  371

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+  Y+NFS+PLI R F   AC WAYGMN FDL  W+ +  T  YH WQ++NE RTL
Sbjct  372  SFHRFNTYLNFSNPLIARNFKSDACGWAYGMNIFDLKQWKIQDITGIYHKWQSMNEERTL  431

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T+PL+KSWHVLGLGYNP+I   +I +AAV+H+NGNMKPWL+IAI
Sbjct  432  WKLGTLPPGLITFYKLTQPLEKSWHVLGLGYNPAIEETDIESAAVIHWNGNMKPWLEIAI  491

Query  217  AQFRPLWTKYVDYENEYIQACN  152
            ++F+P W+KYV Y++ ++Q CN
Sbjct  492  SKFKPYWSKYVKYDHPFLQQCN  513



>ref|XP_010056256.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Eucalyptus grandis]
 gb|KCW72890.1| hypothetical protein EUGRSUZ_E01335 [Eucalyptus grandis]
 gb|KCW72891.1| hypothetical protein EUGRSUZ_E01335 [Eucalyptus grandis]
Length=675

 Score =   315 bits (807),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +++ GKVNGAVETC  
Sbjct  471  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVNLHGKVNGAVETCGE  530

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K   T  YH WQ +NE+R L
Sbjct  531  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNEDRVL  590

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPS+   +I+NAAVVH+NGNMKPWL++A+
Sbjct  591  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSVDRSDIDNAAVVHYNGNMKPWLELAM  650

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ Y++ CN  
Sbjct  651  TKYRPYWTKYIKYDHPYLRTCNLS  674



>ref|XP_002980359.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
 gb|EFJ18619.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
Length=533

 Score =   311 bits (796),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW ID+ GKVNGAVETC  
Sbjct  329  RNPKYLSMLNHLRFYLPQIYPKLDKILFLDDDIVVQKDLTGLWSIDLQGKVNGAVETCGA  388

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W++   T  YH WQ +NE+R L
Sbjct  389  SFHRFDKYLNFSNPHIARNFNPDACGWAYGMNVFDLKEWKRRDITGIYHKWQNMNEDRLL  448

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T PLDKSWHVLGLGYNPSI   +++ AAVVH+NGN+KPWLDI +
Sbjct  449  WKLGTLPPGLITFYNLTHPLDKSWHVLGLGYNPSIDKADMDAAAVVHYNGNLKPWLDIGL  508

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
            ++++  WT+YV Y++ Y+Q CN  
Sbjct  509  SRYKSYWTRYVSYDHPYLQQCNIN  532



>ref|XP_006402518.1| hypothetical protein EUTSA_v10005820mg [Eutrema salsugineum]
 gb|ESQ43971.1| hypothetical protein EUTSA_v10005820mg [Eutrema salsugineum]
Length=674

 Score =   315 bits (807),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  470  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  529

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  530  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  589

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  590  WKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIDKKDIENAAVVHYNGNMKPWLELAM  649

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  650  SKYRPYWTKYIKFDHPYLRRCNL  672



>ref|XP_002876594.1| GAUT1/LGT1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52853.1| GAUT1/LGT1 [Arabidopsis lyrata subsp. lyrata]
Length=673

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  469  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  528

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  529  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  588

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  589  WKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLELAM  648

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  649  SKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_004229870.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Solanum lycopersicum]
Length=688

 Score =   315 bits (807),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  484  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETCGQ  543

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  544  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDRVL  603

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  604  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDRSDIENAAVVHYNGNMKPWLELAM  663

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ +++ Y+++C   
Sbjct  664  TKYRPYWTKYIKFDHPYMRSCKLS  687



>gb|KHN04100.1| Alpha-1,4-galacturonosyltransferase 1 [Glycine soja]
Length=666

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  462  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLNGKVNGAVETCGQ  521

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  522  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKVWKKKDITGIYHKWQNMNEDRVL  581

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPS+   EI NAAVVH+NGNMKPWL+IA+
Sbjct  582  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSLDRSEIENAAVVHYNGNMKPWLEIAM  641

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++R  WTKYV Y + Y+Q C  
Sbjct  642  TKYRSYWTKYVKYNHPYLQNCKL  664



>ref|XP_006576391.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Glycine max]
 ref|XP_006576392.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Glycine max]
Length=666

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  462  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLNGKVNGAVETCGQ  521

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  522  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKVWKKKDITGIYHKWQNMNEDRVL  581

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPS+   EI NAAVVH+NGNMKPWL+IA+
Sbjct  582  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSLDRSEIENAAVVHYNGNMKPWLEIAM  641

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++R  WTKYV Y + Y+Q C  
Sbjct  642  TKYRSYWTKYVKYNHPYLQNCKL  664



>ref|NP_191672.1| alpha-1,4-galacturonosyltransferase 1 [Arabidopsis thaliana]
 sp|Q9LE59.1|GAUT1_ARATH RecName: Full=Polygalacturonate 4-alpha-galacturonosyltransferase; 
AltName: Full=Alpha-1,4-galacturonosyltransferase 1; AltName: 
Full=Galacturonosyltransferase 1; AltName: Full=Like 
glycosyl transferase 1 [Arabidopsis thaliana]
 emb|CAB71043.1| putative protein [Arabidopsis thaliana]
 emb|CAB91508.1| like glycosyl transferase 1 [Arabidopsis thaliana]
 gb|ABD14404.1| homogalacturonan alpha-1,4-galacturonosyltransferase [Arabidopsis 
thaliana]
 gb|AEE80159.1| alpha-1,4-galacturonosyltransferase 1 [Arabidopsis thaliana]
 gb|AHL38722.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=673

 Score =   315 bits (806),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  469  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  528

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  529  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  588

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  589  WKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIDKKDIENAAVVHYNGNMKPWLELAM  648

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  649  SKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_006290325.1| hypothetical protein CARUB_v10016785mg [Capsella rubella]
 gb|EOA23223.1| hypothetical protein CARUB_v10016785mg [Capsella rubella]
Length=673

 Score =   315 bits (806),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  469  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  528

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  529  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENRTL  588

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+K WHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++A+
Sbjct  589  WKLGTLPPGLITFYGLTHPLNKGWHVLGLGYNPSIDKKDIENAAVVHYNGNMKPWLELAM  648

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  649  SKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_008776919.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Phoenix dactylifera]
Length=697

 Score =   315 bits (807),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDIVVQ+DLT LW ID+ G VNGAVETC  
Sbjct  493  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIVVQKDLTALWSIDLRGNVNGAVETCGQ  552

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ+LNENR L
Sbjct  553  SFHRFDKYLNFSNPHIAKNFDPNACGWAYGMNMFDLNEWKKKDITGIYHKWQSLNENRAL  612

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL+I +
Sbjct  613  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIENAAVVHYNGNMKPWLEIGM  672

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  WT+Y+ Y++ Y++ CN  
Sbjct  673  TKYRHYWTRYISYDDPYVKICNLS  696



>ref|XP_011002081.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Populus euphratica]
Length=683

 Score =   314 bits (805),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLT LW +D+ GKVNGAVETC  
Sbjct  479  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTKLWSVDLHGKVNGAVETCGE  538

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  539  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDREL  598

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T PL+K+WHVLGLGYNPSI   EI +AAVVH+NGNMKPWL++A+
Sbjct  599  WKLGTLPPGLITFYNLTNPLEKTWHVLGLGYNPSIDRSEIESAAVVHYNGNMKPWLELAM  658

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ Y+++CN  
Sbjct  659  TKYRPYWTKYIKYDHPYLRSCNLS  682



>ref|XP_007051985.1| Galacturonosyltransferase 1 [Theobroma cacao]
 gb|EOX96142.1| Galacturonosyltransferase 1 [Theobroma cacao]
Length=676

 Score =   314 bits (805),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  472  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETCGE  531

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  532  SFHRFDKYLNFSNPHISRNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDRVL  591

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI+ AAV+H+NGNMKPWL++A+
Sbjct  592  WKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRREIDRAAVIHYNGNMKPWLELAM  651

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP W KY+ Y++ Y+++CN  
Sbjct  652  TKYRPYWAKYIKYDHPYLRSCNLS  675



>ref|XP_002511763.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF50432.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=710

 Score =   315 bits (807),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL++ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC  
Sbjct  506  RNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIVVQKDLTGLWSVNLNGKVNGAVETCGE  565

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NF++P I R FNP  C WAYGMN FDLD W+K+  T  YH WQ +NE+R L
Sbjct  566  SFHRFDKYLNFTNPHIARNFNPNDCGWAYGMNIFDLDEWKKQDITGIYHKWQNMNEDRVL  625

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL+IA+
Sbjct  626  WKLGTLPPGLITFYKLTHPLQKSWHVLGLGYNPSIDRKEIENAAVVHYNGNMKPWLEIAM  685

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  WTKY+ Y++ Y++ CN  
Sbjct  686  TKYRSYWTKYIKYDHPYLRNCNLS  709



>ref|XP_011002080.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Populus euphratica]
Length=686

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLT LW +D+ GKVNGAVETC  
Sbjct  482  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTKLWSVDLHGKVNGAVETCGE  541

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  542  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDREL  601

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T PL+K+WHVLGLGYNPSI   EI +AAVVH+NGNMKPWL++A+
Sbjct  602  WKLGTLPPGLITFYNLTNPLEKTWHVLGLGYNPSIDRSEIESAAVVHYNGNMKPWLELAM  661

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ Y+++CN  
Sbjct  662  TKYRPYWTKYIKYDHPYLRSCNLS  685



>gb|KJB41168.1| hypothetical protein B456_007G093500 [Gossypium raimondii]
Length=676

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  472  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETCGQ  531

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+  I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  532  SFHRFDKYLNFSNHHISRNFDPNACGWAYGMNMFDLRVWKKKDITGIYHKWQNMNEDRAL  591

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI +AAV+H+NGNMKPWLD+A+
Sbjct  592  WKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVHKKEIEHAAVIHYNGNMKPWLDLAM  651

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKYV Y++ Y+++CN  
Sbjct  652  TKYRPYWTKYVKYDHYYLRSCNLS  675



>ref|XP_004172284.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
Length=679

 Score =   314 bits (804),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  475  RNPKYLSMLNHLRFYLPQVYPKLEKILFLDDDIVVQKDLTGLWDVDLHGKVNGAVETCGE  534

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I RKF+P AC WAYGMN FDL  W+K   T  YH WQ LNE R L
Sbjct  535  SFHRFDKYLNFSNPHIARKFDPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNLNEERLL  594

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI   EI+NAAV+H+NGNMKPWL++A+
Sbjct  595  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDKSEIDNAAVIHYNGNMKPWLELAM  654

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++R  WTKY+ Y + Y++ C  
Sbjct  655  TKYRGYWTKYIKYNHPYLRQCKL  677



>ref|XP_004144992.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
 ref|XP_004153994.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis sativus]
 gb|KGN46221.1| hypothetical protein Csa_6G075210 [Cucumis sativus]
Length=679

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  475  RNPKYLSMLNHLRFYLPQVYPKLEKILFLDDDIVVQKDLTGLWDVDLHGKVNGAVETCGE  534

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I RKF+P AC WAYGMN FDL  W+K   T  YH WQ LNE R L
Sbjct  535  SFHRFDKYLNFSNPHIARKFDPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNLNEERLL  594

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI   EI+NAAV+H+NGNMKPWL++A+
Sbjct  595  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDKSEIDNAAVIHYNGNMKPWLELAM  654

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++R  WTKY+ Y + Y++ C  
Sbjct  655  TKYRGYWTKYIKYNHPYLRQCKL  677



>ref|XP_008670346.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Zea mays]
 tpg|DAA40616.1| TPA: hypothetical protein ZEAMMB73_629807 [Zea mays]
Length=684

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC  
Sbjct  480  RNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETCGE  539

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R L
Sbjct  540  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGRVL  599

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++A+
Sbjct  600  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLELAM  659

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++RP WT+Y+ Y++ YI+ CN 
Sbjct  660  TKYRPYWTRYIKYDHPYIRGCNL  682



>ref|XP_008232828.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
isoform X1 [Prunus mume]
Length=675

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  471  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLHGKVNGAVETCGE  530

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+RTL
Sbjct  531  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDRTL  590

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPS+   EI+NAAVVH+NGNMKPWL++A+
Sbjct  591  WKLGTLPPGLITFYGLTHPLHKSWHVLGLGYNPSLDRSEIDNAAVVHYNGNMKPWLELAM  650

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  WTKY+ Y++ YI++C   
Sbjct  651  TKYRGYWTKYIKYDHPYIRSCKIS  674



>ref|XP_008232829.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
isoform X2 [Prunus mume]
Length=674

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  470  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLHGKVNGAVETCGE  529

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+RTL
Sbjct  530  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDRTL  589

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPS+   EI+NAAVVH+NGNMKPWL++A+
Sbjct  590  WKLGTLPPGLITFYGLTHPLHKSWHVLGLGYNPSLDRSEIDNAAVVHYNGNMKPWLELAM  649

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  WTKY+ Y++ YI++C   
Sbjct  650  TKYRGYWTKYIKYDHPYIRSCKIS  673



>gb|KDP28715.1| hypothetical protein JCGZ_14486 [Jatropha curcas]
Length=686

 Score =   313 bits (803),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +++ GKVNGAVETC  
Sbjct  482  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWSVNLGGKVNGAVETCGE  541

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NF++P I R F+P AC WAYGMN FDL  W+K   T  YH WQ +NE+R L
Sbjct  542  SFHRFDKYLNFTNPHIARNFDPNACGWAYGMNIFDLKEWKKRDITGIYHKWQKMNEDRVL  601

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  602  WKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRSEIDNAAVIHYNGNMKPWLEIAM  661

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  WTKY+ Y++ Y+ +CN  
Sbjct  662  TKYRTYWTKYIKYDHPYLHSCNLS  685



>ref|XP_009107093.1| PREDICTED: probable galacturonosyltransferase 4 [Brassica rapa]
Length=631

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPE++PKL ++LFLDDDIVVQ+DL+GLW +D+ G VNGAVETC  
Sbjct  427  RNPKYLSILNHLRFYLPEIFPKLSKVLFLDDDIVVQKDLSGLWSVDLKGNVNGAVETCGE  486

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+PLI + F+P+AC WAYGMN FDLD W+++  TE YH WQ LN++R L
Sbjct  487  SFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITEVYHRWQNLNQDRDL  546

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT++  T PLD+ WHVLGLGYNPS++  +I  AAVVH+NGN+KPWL+I I
Sbjct  547  WKLGTLPPGLITFWKRTYPLDRKWHVLGLGYNPSVNQRDIERAAVVHYNGNLKPWLEIGI  606

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R LW+K+VDY++ Y++ CN  
Sbjct  607  PKYRGLWSKHVDYQHVYLRECNIN  630



>dbj|BAJ53137.1| JHL05D22.8 [Jatropha curcas]
Length=693

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +++ GKVNGAVETC  
Sbjct  489  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWSVNLGGKVNGAVETCGE  548

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NF++P I R F+P AC WAYGMN FDL  W+K   T  YH WQ +NE+R L
Sbjct  549  SFHRFDKYLNFTNPHIARNFDPNACGWAYGMNIFDLKEWKKRDITGIYHKWQKMNEDRVL  608

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI+NAAV+H+NGNMKPWL+IA+
Sbjct  609  WKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRSEIDNAAVIHYNGNMKPWLEIAM  668

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  WTKY+ Y++ Y+ +CN  
Sbjct  669  TKYRTYWTKYIKYDHPYLHSCNLS  692



>ref|XP_008460145.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis melo]
Length=679

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 165/203 (81%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  475  RNPKYLSMLNHLRFYLPQVYPKLEKILFLDDDIVVQKDLTGLWDVDLHGKVNGAVETCGE  534

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I RKF+P AC WAYGMN FDL  W+K   T  YH WQ LNE R L
Sbjct  535  SFHRFDKYLNFSNPHIARKFDPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNLNEERLL  594

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI   EI NAAV+H+NGNMKPWL++A+
Sbjct  595  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDKSEIENAAVIHYNGNMKPWLELAM  654

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++R  WTKY+ Y + Y++ C  
Sbjct  655  TKYRGYWTKYIKYNHPYLRQCKL  677



>ref|XP_009138790.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Brassica rapa]
Length=674

 Score =   313 bits (802),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LN LRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC  
Sbjct  470  RNPKYLSMLNRLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETCGE  529

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENRTL
Sbjct  530  SFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLXEWKKRDITGIYHKWQNMNENRTL  589

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++A+
Sbjct  590  WKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIAKKDIENAAVVHYNGNMKPWLELAM  649

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
            +++RP WTKY+ +++ Y++ CN 
Sbjct  650  SKYRPYWTKYIQFDHPYLRRCNL  672



>ref|XP_011469111.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Fragaria vesca subsp. vesca]
 ref|XP_011469112.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Fragaria vesca subsp. vesca]
Length=671

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  467  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWAVDLHGKVNGAVETCGE  526

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE RTL
Sbjct  527  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEERTL  586

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPS+  +EI NAAVVH+NGNMKPWL++A+
Sbjct  587  WKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSLDRNEIENAAVVHYNGNMKPWLELAM  646

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  WTKY+ Y++ Y+++C   
Sbjct  647  TKYRAYWTKYIKYDHPYLRSCKLS  670



>ref|XP_009418721.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=656

 Score =   312 bits (800),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLT LW +D+ G VNGAVETC  
Sbjct  452  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTALWSVDLKGNVNGAVETCGE  511

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P +C WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  512  SFHRFDKYLNFSNPHIARNFDPNSCGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDRVL  571

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL++A+
Sbjct  572  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDHSEIQNAAVVHYNGNMKPWLELAM  631

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ Y++ C   
Sbjct  632  TKYRPYWTKYIKYDHPYVRGCKLS  655



>ref|XP_007220901.1| hypothetical protein PRUPE_ppa002418mg [Prunus persica]
 gb|EMJ22100.1| hypothetical protein PRUPE_ppa002418mg [Prunus persica]
Length=674

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  470  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLHGKVNGAVETCGE  529

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+RTL
Sbjct  530  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDRTL  589

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPS+   E++NAAVVH+NGNMKPWL++A+
Sbjct  590  WKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSLDRSELDNAAVVHYNGNMKPWLELAM  649

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  WTKY+ Y++ YI++C   
Sbjct  650  TKYRGYWTKYIKYDHPYIRSCKLS  673



>ref|XP_008670345.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Zea mays]
Length=693

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC  
Sbjct  489  RNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETCGE  548

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R L
Sbjct  549  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGRVL  608

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++A+
Sbjct  609  WKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLELAM  668

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++RP WT+Y+ Y++ YI+ CN 
Sbjct  669  TKYRPYWTRYIKYDHPYIRGCNL  691



>ref|XP_010934420.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Elaeis guineensis]
Length=716

 Score =   313 bits (803),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ G VNGAVETC  
Sbjct  512  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVDLKGNVNGAVETCGE  571

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  572  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKQWKKKDITGIYHKWQNMNEDRVL  631

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGL+T+Y  T PL KSWHVLGLGYNP I   EI NAAVVH+NGNMKPWL++A+
Sbjct  632  WKLGTLPPGLLTFYKLTYPLGKSWHVLGLGYNPGIDRSEIENAAVVHYNGNMKPWLELAM  691

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ Y++ CN  
Sbjct  692  TKYRPYWTKYIKYDDRYVRGCNVS  715



>ref|XP_002302550.1| hypothetical protein POPTR_0002s15270g [Populus trichocarpa]
 gb|EEE81823.1| hypothetical protein POPTR_0002s15270g [Populus trichocarpa]
Length=644

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 169/204 (83%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLT LW +D+ GKVNGAVETC  
Sbjct  440  RNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTKLWSVDLHGKVNGAVETCGE  499

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  500  SFHRFDKYLNFSNPHIAKNFDPNACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDRVL  559

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T PL+K+WHVLGLGYNPSI   EI +AAVVH+NGNMKPWL++A+
Sbjct  560  WKLGTLPPGLITFYNLTNPLEKTWHVLGLGYNPSIDRSEIESAAVVHYNGNMKPWLELAM  619

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++RP WTKY+ Y++ Y++ CN  
Sbjct  620  TKYRPYWTKYIKYDHPYLRNCNLS  643



>ref|XP_001770653.1| predicted protein [Physcomitrella patens]
 gb|EDQ64477.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 170/202 (84%), Gaps = 0/202 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLPE++PKL++ILFLDDDIVVQRDLT LW  D++G VNGAVETC  
Sbjct  318  RNPKYLSMLNHLRFYLPEVFPKLNKILFLDDDIVVQRDLTPLWHTDLNGNVNGAVETCGA  377

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+PLI   F+P AC WAYGMN FDL  W+K   T  YH WQ+LNE+R+L
Sbjct  378  SFHRFDKYLNFSNPLISTNFHPNACGWAYGMNVFDLKEWKKLDITGIYHRWQSLNEHRSL  437

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T+PL+KSWHVLGLGYNP++   EI  AAV+H+NGNMKPWL+I +
Sbjct  438  WKLGTLPPGLITFYNLTQPLEKSWHVLGLGYNPAVEESEIEAAAVIHWNGNMKPWLEIGM  497

Query  217  AQFRPLWTKYVDYENEYIQACN  152
            A+++P WTK+V+Y + Y+Q CN
Sbjct  498  AKYKPYWTKFVNYNHPYLQQCN  519



>gb|KHN04587.1| Alpha-1,4-galacturonosyltransferase 1 [Glycine soja]
Length=665

 Score =   312 bits (799),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  461  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWTVDLNGKVNGAVETCGP  520

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  521  SFHRFDKYLNFSNPHIARNFDPHACGWAYGMNMFDLKVWKKKDITGIYHKWQNMNEDRVL  580

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPS+   EI NAAVVH+NGNMKPWL+IA+
Sbjct  581  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSLDRSEIENAAVVHYNGNMKPWLEIAM  640

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++R  WTKYV Y + Y++ C  
Sbjct  641  TKYRSYWTKYVKYNHPYLRNCKL  663



>ref|XP_006445203.1| hypothetical protein CICLE_v10019146mg [Citrus clementina]
 ref|XP_006490965.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Citrus sinensis]
 gb|ESR58443.1| hypothetical protein CICLE_v10019146mg [Citrus clementina]
Length=683

 Score =   312 bits (800),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 170/203 (84%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLT LW +D+ GKVNGAVETC  
Sbjct  479  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTRLWSVDLQGKVNGAVETCGE  538

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NF++P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+RTL
Sbjct  539  SFHRFDKYLNFTNPHIARSFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDRTL  598

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y+ T PL+KSWHVLGLGYNPS+   EI NAAVVH+NGNMKPWL++A+
Sbjct  599  WKLGTLPPGLITFYNLTHPLEKSWHVLGLGYNPSVDRSEIENAAVVHYNGNMKPWLELAM  658

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++R  WTKY+ Y++ Y++ CN 
Sbjct  659  TKYRSYWTKYIKYDHPYLRNCNL  681



>ref|XP_010910637.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Elaeis 
guineensis]
Length=549

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLSILNHLRFYLPEM+PKL++++FLDDDIVVQ+DLTGLW I++ GKVNGAVETC  
Sbjct  345  RNPKYLSILNHLRFYLPEMFPKLNKVVFLDDDIVVQKDLTGLWTINLKGKVNGAVETCRE  404

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+PLI + F+P AC WAYGMN FDL  WRK+  TE YH WQ LN +R L
Sbjct  405  SFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLAEWRKQNITELYHSWQKLNHDRLL  464

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+++ T PLD+SWHVLGLGYNP +   EI  AAV+H+NGNMKPWL+I +
Sbjct  465  WKLGTLPPGLITFWNRTFPLDRSWHVLGLGYNPHVVQKEIEQAAVIHYNGNMKPWLEIGM  524

Query  217  AQFRPLWTKYVDYENEYIQACNFGL  143
             ++R  W+KY++Y+  ++Q CN  L
Sbjct  525  PKYRNHWSKYINYDQVFLQDCNINL  549



>ref|XP_006583368.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Glycine max]
Length=665

 Score =   311 bits (798),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC  
Sbjct  461  RNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWTVDLNGKVNGAVETCGP  520

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R L
Sbjct  521  SFHRFDKYLNFSNPHIARNFDPHACGWAYGMNMFDLKVWKKKDITGIYHKWQNMNEDRVL  580

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPS+   EI NAAVVH+NGNMKPWL+IA+
Sbjct  581  WKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSLDRSEIENAAVVHYNGNMKPWLEIAM  640

Query  217  AQFRPLWTKYVDYENEYIQACNF  149
             ++R  WTKYV Y + Y++ C  
Sbjct  641  TKYRSYWTKYVKYNHPYLRNCKL  663



>ref|XP_009589124.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nicotiana tomentosiformis]
Length=687

 Score =   312 bits (800),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 168/204 (82%), Gaps = 0/204 (0%)
 Frame = -3

Query  757  QDPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  578
            ++PKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC  
Sbjct  483  RNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETCGQ  542

Query  577  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  398
            SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K   T  YH WQ +NE+R L
Sbjct  543  SFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNEDRVL  602

Query  397  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  218
            WKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   EI NAAV+H+NGNMKPWL++A+
Sbjct  603  WKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSIDRSEIENAAVIHYNGNMKPWLELAM  662

Query  217  AQFRPLWTKYVDYENEYIQACNFG  146
             ++R  WTKY+ +++ YI++C   
Sbjct  663  TKYRSYWTKYIKFDHPYIRSCKLS  686



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470